(data stored in SCRATCH3701 zone)

EMBL: CP000539

ID   CP000539; SV 1; circular; genomic DNA; STD; PRO; 4448856 BP.
XX
AC   CP000539; AASD01000000-AASD01000065;
XX
PR   Project:PRJNA15685;
XX
DT   05-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Acidovorax sp. JS42, complete genome.
XX
KW   .
XX
OS   Acidovorax sp. JS42
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Acidovorax; unclassified Acidovorax.
XX
RN   [1]
RP   1-4448856
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Chertkov O., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Stahl D., Richardson P.;
RT   "Complete sequence of Chromosome1 of Acidovorax sp. JS42";
RL   Unpublished.
XX
RN   [2]
RP   1-4448856
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Chertkov O., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Stahl D., Richardson P.;
RT   ;
RL   Submitted (21-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 7d027a1ad565940058c7bc7db5c2fbfb.
DR   BioSample; SAMN02598333.
DR   EnsemblGenomes-Gn; Ajs_R0001.
DR   EnsemblGenomes-Gn; Ajs_R0002.
DR   EnsemblGenomes-Gn; Ajs_R0003.
DR   EnsemblGenomes-Gn; Ajs_R0004.
DR   EnsemblGenomes-Gn; Ajs_R0005.
DR   EnsemblGenomes-Gn; Ajs_R0006.
DR   EnsemblGenomes-Gn; Ajs_R0007.
DR   EnsemblGenomes-Gn; Ajs_R0008.
DR   EnsemblGenomes-Gn; Ajs_R0009.
DR   EnsemblGenomes-Gn; Ajs_R0010.
DR   EnsemblGenomes-Gn; Ajs_R0011.
DR   EnsemblGenomes-Gn; Ajs_R0012.
DR   EnsemblGenomes-Gn; Ajs_R0013.
DR   EnsemblGenomes-Gn; Ajs_R0014.
DR   EnsemblGenomes-Gn; Ajs_R0015.
DR   EnsemblGenomes-Gn; Ajs_R0016.
DR   EnsemblGenomes-Gn; Ajs_R0017.
DR   EnsemblGenomes-Gn; Ajs_R0018.
DR   EnsemblGenomes-Gn; Ajs_R0019.
DR   EnsemblGenomes-Gn; Ajs_R0020.
DR   EnsemblGenomes-Gn; Ajs_R0021.
DR   EnsemblGenomes-Gn; Ajs_R0022.
DR   EnsemblGenomes-Gn; Ajs_R0023.
DR   EnsemblGenomes-Gn; Ajs_R0024.
DR   EnsemblGenomes-Gn; Ajs_R0025.
DR   EnsemblGenomes-Gn; Ajs_R0026.
DR   EnsemblGenomes-Gn; Ajs_R0027.
DR   EnsemblGenomes-Gn; Ajs_R0028.
DR   EnsemblGenomes-Gn; Ajs_R0029.
DR   EnsemblGenomes-Gn; Ajs_R0031.
DR   EnsemblGenomes-Gn; Ajs_R0032.
DR   EnsemblGenomes-Gn; Ajs_R0033.
DR   EnsemblGenomes-Gn; Ajs_R0034.
DR   EnsemblGenomes-Gn; Ajs_R0035.
DR   EnsemblGenomes-Gn; Ajs_R0036.
DR   EnsemblGenomes-Gn; Ajs_R0037.
DR   EnsemblGenomes-Gn; Ajs_R0038.
DR   EnsemblGenomes-Gn; Ajs_R0039.
DR   EnsemblGenomes-Gn; Ajs_R0040.
DR   EnsemblGenomes-Gn; Ajs_R0041.
DR   EnsemblGenomes-Gn; Ajs_R0042.
DR   EnsemblGenomes-Gn; Ajs_R0043.
DR   EnsemblGenomes-Gn; Ajs_R0044.
DR   EnsemblGenomes-Gn; Ajs_R0045.
DR   EnsemblGenomes-Gn; Ajs_R0046.
DR   EnsemblGenomes-Gn; Ajs_R0048.
DR   EnsemblGenomes-Gn; Ajs_R0049.
DR   EnsemblGenomes-Gn; Ajs_R0050.
DR   EnsemblGenomes-Gn; Ajs_R0051.
DR   EnsemblGenomes-Gn; Ajs_R0052.
DR   EnsemblGenomes-Gn; Ajs_R0053.
DR   EnsemblGenomes-Gn; Ajs_R0054.
DR   EnsemblGenomes-Gn; Ajs_R0055.
DR   EnsemblGenomes-Gn; Ajs_R0056.
DR   EnsemblGenomes-Gn; Ajs_R0057.
DR   EnsemblGenomes-Gn; Ajs_R0058.
DR   EnsemblGenomes-Gn; Ajs_R0059.
DR   EnsemblGenomes-Gn; Ajs_R0060.
DR   EnsemblGenomes-Gn; Ajs_R0061.
DR   EnsemblGenomes-Gn; Ajs_R0062.
DR   EnsemblGenomes-Gn; Ajs_R0064.
DR   EnsemblGenomes-Gn; EBG00001163262.
DR   EnsemblGenomes-Gn; EBG00001163263.
DR   EnsemblGenomes-Gn; EBG00001163264.
DR   EnsemblGenomes-Gn; EBG00001163265.
DR   EnsemblGenomes-Gn; EBG00001163266.
DR   EnsemblGenomes-Gn; EBG00001163267.
DR   EnsemblGenomes-Gn; EBG00001163268.
DR   EnsemblGenomes-Gn; EBG00001163269.
DR   EnsemblGenomes-Gn; EBG00001163270.
DR   EnsemblGenomes-Gn; EBG00001163271.
DR   EnsemblGenomes-Gn; EBG00001163272.
DR   EnsemblGenomes-Gn; EBG00001163273.
DR   EnsemblGenomes-Gn; EBG00001163274.
DR   EnsemblGenomes-Gn; EBG00001163275.
DR   EnsemblGenomes-Gn; EBG00001163276.
DR   EnsemblGenomes-Gn; EBG00001163277.
DR   EnsemblGenomes-Gn; EBG00001163278.
DR   EnsemblGenomes-Gn; EBG00001163279.
DR   EnsemblGenomes-Gn; EBG00001163280.
DR   EnsemblGenomes-Gn; EBG00001163281.
DR   EnsemblGenomes-Gn; EBG00001163282.
DR   EnsemblGenomes-Gn; EBG00001163283.
DR   EnsemblGenomes-Gn; EBG00001163284.
DR   EnsemblGenomes-Gn; EBG00001163285.
DR   EnsemblGenomes-Gn; EBG00001163286.
DR   EnsemblGenomes-Gn; EBG00001163287.
DR   EnsemblGenomes-Gn; EBG00001163288.
DR   EnsemblGenomes-Gn; EBG00001163289.
DR   EnsemblGenomes-Gn; EBG00001163290.
DR   EnsemblGenomes-Gn; EBG00001163291.
DR   EnsemblGenomes-Gn; EBG00001163292.
DR   EnsemblGenomes-Gn; EBG00001163293.
DR   EnsemblGenomes-Gn; EBG00001163294.
DR   EnsemblGenomes-Gn; EBG00001163295.
DR   EnsemblGenomes-Gn; EBG00001163296.
DR   EnsemblGenomes-Gn; EBG00001163297.
DR   EnsemblGenomes-Gn; EBG00001163298.
DR   EnsemblGenomes-Gn; EBG00001163299.
DR   EnsemblGenomes-Gn; EBG00001163300.
DR   EnsemblGenomes-Gn; EBG00001163301.
DR   EnsemblGenomes-Gn; EBG00001163302.
DR   EnsemblGenomes-Gn; EBG00001163303.
DR   EnsemblGenomes-Gn; EBG00001163304.
DR   EnsemblGenomes-Gn; EBG00001163305.
DR   EnsemblGenomes-Gn; EBG00001163306.
DR   EnsemblGenomes-Gn; EBG00001163307.
DR   EnsemblGenomes-Gn; EBG00001163308.
DR   EnsemblGenomes-Gn; EBG00001163309.
DR   EnsemblGenomes-Gn; EBG00001163310.
DR   EnsemblGenomes-Gn; EBG00001163311.
DR   EnsemblGenomes-Gn; EBG00001163312.
DR   EnsemblGenomes-Gn; EBG00001163313.
DR   EnsemblGenomes-Gn; EBG00001163314.
DR   EnsemblGenomes-Gn; EBG00001163315.
DR   EnsemblGenomes-Gn; EBG00001163316.
DR   EnsemblGenomes-Gn; EBG00001163317.
DR   EnsemblGenomes-Gn; EBG00001163318.
DR   EnsemblGenomes-Gn; EBG00001163319.
DR   EnsemblGenomes-Gn; EBG00001163320.
DR   EnsemblGenomes-Gn; EBG00001163321.
DR   EnsemblGenomes-Gn; EBG00001163322.
DR   EnsemblGenomes-Gn; EBG00001163323.
DR   EnsemblGenomes-Gn; EBG00001163324.
DR   EnsemblGenomes-Gn; EBG00001163325.
DR   EnsemblGenomes-Gn; EBG00001163326.
DR   EnsemblGenomes-Gn; EBG00001163327.
DR   EnsemblGenomes-Gn; EBG00001163328.
DR   EnsemblGenomes-Gn; EBG00001163329.
DR   EnsemblGenomes-Gn; EBG00001163330.
DR   EnsemblGenomes-Gn; EBG00001163331.
DR   EnsemblGenomes-Gn; EBG00001163332.
DR   EnsemblGenomes-Gn; EBG00001163333.
DR   EnsemblGenomes-Gn; EBG00001163334.
DR   EnsemblGenomes-Gn; EBG00001163335.
DR   EnsemblGenomes-Gn; EBG00001163336.
DR   EnsemblGenomes-Gn; EBG00001163337.
DR   EnsemblGenomes-Gn; EBG00001163338.
DR   EnsemblGenomes-Gn; EBG00001163339.
DR   EnsemblGenomes-Gn; EBG00001163340.
DR   EnsemblGenomes-Gn; EBG00001163341.
DR   EnsemblGenomes-Gn; EBG00001163342.
DR   EnsemblGenomes-Gn; EBG00001163343.
DR   EnsemblGenomes-Gn; EBG00001163344.
DR   EnsemblGenomes-Gn; EBG00001163345.
DR   EnsemblGenomes-Gn; EBG00001163346.
DR   EnsemblGenomes-Gn; EBG00001163347.
DR   EnsemblGenomes-Gn; EBG00001163348.
DR   EnsemblGenomes-Gn; EBG00001163349.
DR   EnsemblGenomes-Gn; EBG00001163350.
DR   EnsemblGenomes-Gn; EBG00001163351.
DR   EnsemblGenomes-Gn; EBG00001163352.
DR   EnsemblGenomes-Gn; EBG00001163353.
DR   EnsemblGenomes-Gn; EBG00001163354.
DR   EnsemblGenomes-Gn; EBG00001163355.
DR   EnsemblGenomes-Gn; EBG00001163356.
DR   EnsemblGenomes-Gn; EBG00001163357.
DR   EnsemblGenomes-Gn; EBG00001163358.
DR   EnsemblGenomes-Gn; EBG00001163359.
DR   EnsemblGenomes-Gn; EBG00001163360.
DR   EnsemblGenomes-Gn; EBG00001163361.
DR   EnsemblGenomes-Gn; EBG00001163362.
DR   EnsemblGenomes-Gn; EBG00001163363.
DR   EnsemblGenomes-Gn; EBG00001163364.
DR   EnsemblGenomes-Gn; EBG00001163365.
DR   EnsemblGenomes-Gn; EBG00001163366.
DR   EnsemblGenomes-Gn; EBG00001163367.
DR   EnsemblGenomes-Gn; EBG00001163368.
DR   EnsemblGenomes-Gn; EBG00001163369.
DR   EnsemblGenomes-Gn; EBG00001163370.
DR   EnsemblGenomes-Gn; EBG00001163371.
DR   EnsemblGenomes-Gn; EBG00001163372.
DR   EnsemblGenomes-Gn; EBG00001163373.
DR   EnsemblGenomes-Gn; EBG00001163374.
DR   EnsemblGenomes-Gn; EBG00001163375.
DR   EnsemblGenomes-Gn; EBG00001163376.
DR   EnsemblGenomes-Gn; EBG00001163377.
DR   EnsemblGenomes-Gn; EBG00001163378.
DR   EnsemblGenomes-Gn; EBG00001163379.
DR   EnsemblGenomes-Gn; EBG00001163380.
DR   EnsemblGenomes-Gn; EBG00001163381.
DR   EnsemblGenomes-Gn; EBG00001163382.
DR   EnsemblGenomes-Gn; EBG00001163383.
DR   EnsemblGenomes-Gn; EBG00001163384.
DR   EnsemblGenomes-Gn; EBG00001163385.
DR   EnsemblGenomes-Gn; EBG00001163386.
DR   EnsemblGenomes-Gn; EBG00001163387.
DR   EnsemblGenomes-Gn; EBG00001163388.
DR   EnsemblGenomes-Gn; EBG00001163389.
DR   EnsemblGenomes-Gn; EBG00001163390.
DR   EnsemblGenomes-Gn; EBG00001163391.
DR   EnsemblGenomes-Gn; EBG00001163392.
DR   EnsemblGenomes-Gn; EBG00001163393.
DR   EnsemblGenomes-Gn; EBG00001163394.
DR   EnsemblGenomes-Gn; EBG00001163395.
DR   EnsemblGenomes-Gn; EBG00001163396.
DR   EnsemblGenomes-Gn; EBG00001163397.
DR   EnsemblGenomes-Gn; EBG00001163398.
DR   EnsemblGenomes-Gn; EBG00001163399.
DR   EnsemblGenomes-Gn; EBG00001163400.
DR   EnsemblGenomes-Gn; EBG00001163401.
DR   EnsemblGenomes-Gn; EBG00001163402.
DR   EnsemblGenomes-Gn; EBG00001163403.
DR   EnsemblGenomes-Gn; EBG00001163404.
DR   EnsemblGenomes-Gn; EBG00001163405.
DR   EnsemblGenomes-Gn; EBG00001163406.
DR   EnsemblGenomes-Gn; EBG00001163407.
DR   EnsemblGenomes-Gn; EBG00001163408.
DR   EnsemblGenomes-Tr; Ajs_R0001-1.
DR   EnsemblGenomes-Tr; Ajs_R0002-1.
DR   EnsemblGenomes-Tr; Ajs_R0003-1.
DR   EnsemblGenomes-Tr; Ajs_R0004-1.
DR   EnsemblGenomes-Tr; Ajs_R0005-1.
DR   EnsemblGenomes-Tr; Ajs_R0006-1.
DR   EnsemblGenomes-Tr; Ajs_R0007-1.
DR   EnsemblGenomes-Tr; Ajs_R0008-1.
DR   EnsemblGenomes-Tr; Ajs_R0009-1.
DR   EnsemblGenomes-Tr; Ajs_R0010-1.
DR   EnsemblGenomes-Tr; Ajs_R0011-1.
DR   EnsemblGenomes-Tr; Ajs_R0012-1.
DR   EnsemblGenomes-Tr; Ajs_R0013-1.
DR   EnsemblGenomes-Tr; Ajs_R0014-1.
DR   EnsemblGenomes-Tr; Ajs_R0015-1.
DR   EnsemblGenomes-Tr; Ajs_R0016-1.
DR   EnsemblGenomes-Tr; Ajs_R0017-1.
DR   EnsemblGenomes-Tr; Ajs_R0018-1.
DR   EnsemblGenomes-Tr; Ajs_R0019-1.
DR   EnsemblGenomes-Tr; Ajs_R0020-1.
DR   EnsemblGenomes-Tr; Ajs_R0021-1.
DR   EnsemblGenomes-Tr; Ajs_R0022-1.
DR   EnsemblGenomes-Tr; Ajs_R0023-1.
DR   EnsemblGenomes-Tr; Ajs_R0024-1.
DR   EnsemblGenomes-Tr; Ajs_R0025-1.
DR   EnsemblGenomes-Tr; Ajs_R0026-1.
DR   EnsemblGenomes-Tr; Ajs_R0027-1.
DR   EnsemblGenomes-Tr; Ajs_R0028-1.
DR   EnsemblGenomes-Tr; Ajs_R0029-1.
DR   EnsemblGenomes-Tr; Ajs_R0031-1.
DR   EnsemblGenomes-Tr; Ajs_R0032-1.
DR   EnsemblGenomes-Tr; Ajs_R0033-1.
DR   EnsemblGenomes-Tr; Ajs_R0034-1.
DR   EnsemblGenomes-Tr; Ajs_R0035-1.
DR   EnsemblGenomes-Tr; Ajs_R0036-1.
DR   EnsemblGenomes-Tr; Ajs_R0037-1.
DR   EnsemblGenomes-Tr; Ajs_R0038-1.
DR   EnsemblGenomes-Tr; Ajs_R0039-1.
DR   EnsemblGenomes-Tr; Ajs_R0040-1.
DR   EnsemblGenomes-Tr; Ajs_R0041-1.
DR   EnsemblGenomes-Tr; Ajs_R0042-1.
DR   EnsemblGenomes-Tr; Ajs_R0043-1.
DR   EnsemblGenomes-Tr; Ajs_R0044-1.
DR   EnsemblGenomes-Tr; Ajs_R0045-1.
DR   EnsemblGenomes-Tr; Ajs_R0046-1.
DR   EnsemblGenomes-Tr; Ajs_R0048-1.
DR   EnsemblGenomes-Tr; Ajs_R0049-1.
DR   EnsemblGenomes-Tr; Ajs_R0050-1.
DR   EnsemblGenomes-Tr; Ajs_R0051-1.
DR   EnsemblGenomes-Tr; Ajs_R0052-1.
DR   EnsemblGenomes-Tr; Ajs_R0053-1.
DR   EnsemblGenomes-Tr; Ajs_R0054-1.
DR   EnsemblGenomes-Tr; Ajs_R0055-1.
DR   EnsemblGenomes-Tr; Ajs_R0056-1.
DR   EnsemblGenomes-Tr; Ajs_R0057-1.
DR   EnsemblGenomes-Tr; Ajs_R0058-1.
DR   EnsemblGenomes-Tr; Ajs_R0059-1.
DR   EnsemblGenomes-Tr; Ajs_R0060-1.
DR   EnsemblGenomes-Tr; Ajs_R0061-1.
DR   EnsemblGenomes-Tr; Ajs_R0062-1.
DR   EnsemblGenomes-Tr; Ajs_R0064-1.
DR   EnsemblGenomes-Tr; EBT00001730220.
DR   EnsemblGenomes-Tr; EBT00001730221.
DR   EnsemblGenomes-Tr; EBT00001730222.
DR   EnsemblGenomes-Tr; EBT00001730223.
DR   EnsemblGenomes-Tr; EBT00001730224.
DR   EnsemblGenomes-Tr; EBT00001730225.
DR   EnsemblGenomes-Tr; EBT00001730226.
DR   EnsemblGenomes-Tr; EBT00001730227.
DR   EnsemblGenomes-Tr; EBT00001730228.
DR   EnsemblGenomes-Tr; EBT00001730229.
DR   EnsemblGenomes-Tr; EBT00001730230.
DR   EnsemblGenomes-Tr; EBT00001730231.
DR   EnsemblGenomes-Tr; EBT00001730232.
DR   EnsemblGenomes-Tr; EBT00001730233.
DR   EnsemblGenomes-Tr; EBT00001730234.
DR   EnsemblGenomes-Tr; EBT00001730235.
DR   EnsemblGenomes-Tr; EBT00001730236.
DR   EnsemblGenomes-Tr; EBT00001730237.
DR   EnsemblGenomes-Tr; EBT00001730238.
DR   EnsemblGenomes-Tr; EBT00001730239.
DR   EnsemblGenomes-Tr; EBT00001730240.
DR   EnsemblGenomes-Tr; EBT00001730241.
DR   EnsemblGenomes-Tr; EBT00001730242.
DR   EnsemblGenomes-Tr; EBT00001730243.
DR   EnsemblGenomes-Tr; EBT00001730244.
DR   EnsemblGenomes-Tr; EBT00001730245.
DR   EnsemblGenomes-Tr; EBT00001730246.
DR   EnsemblGenomes-Tr; EBT00001730247.
DR   EnsemblGenomes-Tr; EBT00001730248.
DR   EnsemblGenomes-Tr; EBT00001730249.
DR   EnsemblGenomes-Tr; EBT00001730250.
DR   EnsemblGenomes-Tr; EBT00001730251.
DR   EnsemblGenomes-Tr; EBT00001730252.
DR   EnsemblGenomes-Tr; EBT00001730253.
DR   EnsemblGenomes-Tr; EBT00001730254.
DR   EnsemblGenomes-Tr; EBT00001730255.
DR   EnsemblGenomes-Tr; EBT00001730256.
DR   EnsemblGenomes-Tr; EBT00001730257.
DR   EnsemblGenomes-Tr; EBT00001730258.
DR   EnsemblGenomes-Tr; EBT00001730259.
DR   EnsemblGenomes-Tr; EBT00001730260.
DR   EnsemblGenomes-Tr; EBT00001730261.
DR   EnsemblGenomes-Tr; EBT00001730262.
DR   EnsemblGenomes-Tr; EBT00001730263.
DR   EnsemblGenomes-Tr; EBT00001730264.
DR   EnsemblGenomes-Tr; EBT00001730265.
DR   EnsemblGenomes-Tr; EBT00001730266.
DR   EnsemblGenomes-Tr; EBT00001730267.
DR   EnsemblGenomes-Tr; EBT00001730268.
DR   EnsemblGenomes-Tr; EBT00001730269.
DR   EnsemblGenomes-Tr; EBT00001730270.
DR   EnsemblGenomes-Tr; EBT00001730271.
DR   EnsemblGenomes-Tr; EBT00001730272.
DR   EnsemblGenomes-Tr; EBT00001730273.
DR   EnsemblGenomes-Tr; EBT00001730274.
DR   EnsemblGenomes-Tr; EBT00001730275.
DR   EnsemblGenomes-Tr; EBT00001730276.
DR   EnsemblGenomes-Tr; EBT00001730277.
DR   EnsemblGenomes-Tr; EBT00001730278.
DR   EnsemblGenomes-Tr; EBT00001730279.
DR   EnsemblGenomes-Tr; EBT00001730280.
DR   EnsemblGenomes-Tr; EBT00001730281.
DR   EnsemblGenomes-Tr; EBT00001730282.
DR   EnsemblGenomes-Tr; EBT00001730283.
DR   EnsemblGenomes-Tr; EBT00001730284.
DR   EnsemblGenomes-Tr; EBT00001730285.
DR   EnsemblGenomes-Tr; EBT00001730286.
DR   EnsemblGenomes-Tr; EBT00001730287.
DR   EnsemblGenomes-Tr; EBT00001730288.
DR   EnsemblGenomes-Tr; EBT00001730289.
DR   EnsemblGenomes-Tr; EBT00001730290.
DR   EnsemblGenomes-Tr; EBT00001730291.
DR   EnsemblGenomes-Tr; EBT00001730292.
DR   EnsemblGenomes-Tr; EBT00001730293.
DR   EnsemblGenomes-Tr; EBT00001730294.
DR   EnsemblGenomes-Tr; EBT00001730295.
DR   EnsemblGenomes-Tr; EBT00001730296.
DR   EnsemblGenomes-Tr; EBT00001730297.
DR   EnsemblGenomes-Tr; EBT00001730298.
DR   EnsemblGenomes-Tr; EBT00001730299.
DR   EnsemblGenomes-Tr; EBT00001730300.
DR   EnsemblGenomes-Tr; EBT00001730301.
DR   EnsemblGenomes-Tr; EBT00001730302.
DR   EnsemblGenomes-Tr; EBT00001730303.
DR   EnsemblGenomes-Tr; EBT00001730304.
DR   EnsemblGenomes-Tr; EBT00001730305.
DR   EnsemblGenomes-Tr; EBT00001730306.
DR   EnsemblGenomes-Tr; EBT00001730307.
DR   EnsemblGenomes-Tr; EBT00001730308.
DR   EnsemblGenomes-Tr; EBT00001730309.
DR   EnsemblGenomes-Tr; EBT00001730310.
DR   EnsemblGenomes-Tr; EBT00001730311.
DR   EnsemblGenomes-Tr; EBT00001730312.
DR   EnsemblGenomes-Tr; EBT00001730313.
DR   EnsemblGenomes-Tr; EBT00001730314.
DR   EnsemblGenomes-Tr; EBT00001730315.
DR   EnsemblGenomes-Tr; EBT00001730316.
DR   EnsemblGenomes-Tr; EBT00001730317.
DR   EnsemblGenomes-Tr; EBT00001730318.
DR   EnsemblGenomes-Tr; EBT00001730319.
DR   EnsemblGenomes-Tr; EBT00001730320.
DR   EnsemblGenomes-Tr; EBT00001730321.
DR   EnsemblGenomes-Tr; EBT00001730322.
DR   EnsemblGenomes-Tr; EBT00001730323.
DR   EnsemblGenomes-Tr; EBT00001730324.
DR   EnsemblGenomes-Tr; EBT00001730325.
DR   EnsemblGenomes-Tr; EBT00001730326.
DR   EnsemblGenomes-Tr; EBT00001730327.
DR   EnsemblGenomes-Tr; EBT00001730328.
DR   EnsemblGenomes-Tr; EBT00001730329.
DR   EnsemblGenomes-Tr; EBT00001730330.
DR   EnsemblGenomes-Tr; EBT00001730331.
DR   EnsemblGenomes-Tr; EBT00001730332.
DR   EnsemblGenomes-Tr; EBT00001730333.
DR   EnsemblGenomes-Tr; EBT00001730334.
DR   EnsemblGenomes-Tr; EBT00001730335.
DR   EnsemblGenomes-Tr; EBT00001730336.
DR   EnsemblGenomes-Tr; EBT00001730337.
DR   EnsemblGenomes-Tr; EBT00001730338.
DR   EnsemblGenomes-Tr; EBT00001730339.
DR   EnsemblGenomes-Tr; EBT00001730340.
DR   EnsemblGenomes-Tr; EBT00001730341.
DR   EnsemblGenomes-Tr; EBT00001730342.
DR   EnsemblGenomes-Tr; EBT00001730343.
DR   EnsemblGenomes-Tr; EBT00001730344.
DR   EnsemblGenomes-Tr; EBT00001730345.
DR   EnsemblGenomes-Tr; EBT00001730346.
DR   EnsemblGenomes-Tr; EBT00001730347.
DR   EnsemblGenomes-Tr; EBT00001730348.
DR   EnsemblGenomes-Tr; EBT00001730349.
DR   EnsemblGenomes-Tr; EBT00001730350.
DR   EnsemblGenomes-Tr; EBT00001730351.
DR   EnsemblGenomes-Tr; EBT00001730352.
DR   EnsemblGenomes-Tr; EBT00001730353.
DR   EnsemblGenomes-Tr; EBT00001730354.
DR   EnsemblGenomes-Tr; EBT00001730355.
DR   EnsemblGenomes-Tr; EBT00001730356.
DR   EnsemblGenomes-Tr; EBT00001730357.
DR   EnsemblGenomes-Tr; EBT00001730358.
DR   EnsemblGenomes-Tr; EBT00001730359.
DR   EnsemblGenomes-Tr; EBT00001730360.
DR   EnsemblGenomes-Tr; EBT00001730361.
DR   EnsemblGenomes-Tr; EBT00001730362.
DR   EnsemblGenomes-Tr; EBT00001730363.
DR   EnsemblGenomes-Tr; EBT00001730364.
DR   EnsemblGenomes-Tr; EBT00001730365.
DR   EnsemblGenomes-Tr; EBT00001730366.
DR   EuropePMC; PMC3375312; 22719259.
DR   EuropePMC; PMC4248833; 25182498.
DR   EuropePMC; PMC5054157; 22768985.
DR   EuropePMC; PMC5512189; 28748209.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01811; PtaRNA1.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02227; sX8.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000539.
DR   SILVA-SSU; CP000539.
DR   StrainInfo; 579311; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001426
CC   Source DNA and bacteria available from David Stahl
CC   (dastahl@u.washington.edu)
CC   Contacts: David Stahl (dastahl@u.washington.edu)
CC        Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4448856
FT                   /organism="Acidovorax sp. JS42"
FT                   /strain="JS42"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:232721"
FT   gene            212..694
FT                   /locus_tag="Ajs_0001"
FT   CDS_pept        212..694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0001"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: rfr:Rfer_0741 NLP/P60"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40257"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Y2"
FT                   /protein_id="ABM40257.1"
FT                   /translation="MRAFALPVLTLAASLLVVGCGTTPPTSASRNAAYSRLSPEQSSDI
FT                   AIHALGLVGTPYRYGGNTPDSGFDCSGLIGYVYTSRAGVAPPRTVAQLSGFGQSVDADE
FT                   LRTGDLVVFGRGRPTHAGIYVGEGRFVHAPSSGGTVRLDHLKSRYWSQQFASFRRP"
FT   sig_peptide     212..298
FT                   /locus_tag="Ajs_0001"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.407 at
FT                   residue 29"
FT   gene            822..1922
FT                   /locus_tag="Ajs_0002"
FT   CDS_pept        822..1922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0002"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: bbr:BB2422 3-deoxy-7-phosphoheptulonate
FT                   synthase; TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40258"
FT                   /db_xref="GOA:A1W1Y3"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Y3"
FT                   /protein_id="ABM40258.1"
FT                   /translation="MTLTERLASPLTTHDTTRIDDLRIKAVRPLITPALLQEWQPAPEA
FT                   AQTLVESSRVAISRVLHGQDDRLIVVVGPCSIHDHDQAMEYARLLKEQADALAQDLLIV
FT                   MRVYFEKPRTTVGWKGYINDPHLDGSFAINEGLERARALLLDVLALGLPVGTEFLDLLS
FT                   PQFISDLVSWGAIGARTTESQSHRQLASGLSCPVGFKNGTDGGVKVAADAIQAAQAPHA
FT                   FMGMTKMGQAAIFETRGNHDCHVILRGGKTPNYGAADVQAACEMLEKAGQRPQVMIDLS
FT                   HANSSKQHRRQIDVAQDVAQQIAAGDARITGVMIESHLQEGRQDIVDGQPLTPGVSVTD
FT                   ACISFAQTVPVLQQLAAAVRERRTRG"
FT   gene            2149..4158
FT                   /locus_tag="Ajs_0003"
FT   CDS_pept        2149..4158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0003"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: tbd:Tbd_1042 putative diguanylate
FT                   cyclase/phosphodiesterase (GGDEF & EAL domains) with
FT                   PAS/PAC and GAF sensor(s); TIGRFAM: PAS sensor protein;
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   EAL domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40259"
FT                   /db_xref="GOA:A1W1Y4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Y4"
FT                   /protein_id="ABM40259.1"
FT                   /translation="MVDGVAQPNAEYVLEGTPSERLLTQRSLVIRDRARERFPRAPVLA
FT                   RTGARSYVGQQLTASDGTPIGMIFVVFRQTLERSRFVSNTLQIFAARAAAELQRQTDDQ
FT                   RIRQQASLLDKARDAIIVRDLEHRITFWNEGAERMYGWSREEVLGRSIATLLYQNPEDF
FT                   LRATQQVMQHGVWSGEILQCDRAGRTLEAEGRWTLVRNDRGEPESVLAINADIGTRKHQ
FT                   EREIQRLAFFDPLTHLPNRVQLLDRVDQALAKAQRLEQGGALLFIDLDNFKTLNDTLGH
FT                   DQGDELLQIVAQRLNTCVRSADTVARLGGDEFVVLVEQLSAHSDTLAEQAGAVGEKILA
FT                   VLSAPYALTGYQHRSTPSIGIALFNHAPTTVGELLKQADLAMYQAKTAGRNTLRFFNPS
FT                   MQHAVAERASLEADLRNALAQKEFLLHYQPQINARGAIVGVEALLRWAHPRRGMVSPGQ
FT                   FIPLAEETGLVLPLGHWVLHTACSVLADWQRVPALAPLTMAVNVSSRQFRDAGFVDDVA
FT                   GVLAATGAPASQLKLELTESLLVEDLAATIATMAALRALGVGFSLDDFGTGYSSLAYLK
FT                   RMPLGQLKIDQSFVRDLLTDPNDAAIVRTIIGLAASLGLEVIAEGVETSAQRDWLAHAG
FT                   CAVYQGYFFSRPLPLDLLEQLLHDHIAAARTPSL"
FT   gene            complement(4216..5019)
FT                   /locus_tag="Ajs_0004"
FT   CDS_pept        complement(4216..5019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0004"
FT                   /product="regulatory protein, IclR"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: mag:amb2598
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40260"
FT                   /db_xref="GOA:A1W1Y5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Y5"
FT                   /protein_id="ABM40260.1"
FT                   /translation="MARTRNIDFDEGADSRRFVTALARGLDVLACFQVDEKWLTNAEIA
FT                   ARTGLPKPTVVRLAYTLCVLGYLRHSRDSGKYALGDSLAALGITMVSNLRLRRIARPYM
FT                   QDFADRYDISVSLGIRNGLSVLYVENCRSGTPLSLGLDLGARLPVAETAMGHALLAVME
FT                   PRERERLLAEIRQAEGERWPQLRQSIETGCAHWRARGFTVVVRDWQTDIAGVGAAIRQP
FT                   DGRVISFNAGGSASKFPRALLEQEIGPQFARMVKGLEPFVRSEEA"
FT   gene            5262..6233
FT                   /locus_tag="Ajs_0005"
FT   CDS_pept        5262..6233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0005"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   reu:Reut_A1420 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40261"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Y6"
FT                   /protein_id="ABM40261.1"
FT                   /translation="MTHALLNRRTLSLLLAAGCVAGPALAQPERFPSRPIKVLIGFTAG
FT                   GSTDVPFRVLAENASKILGQPVIIENKPGAGGVLPAQMMQSTPADGYTLAQVPLPVFRL
FT                   PYTQKINWNPATDLQYVIGLAGYAFGLVVPADSPIKSMQDYIAYAKNNPGKLNYGTPGA
FT                   LTTLHLTMENIALQAGVTLNHIPYKGNSESLQAVLGGHVMSIADTPGWAPYVEQGKLRV
FT                   LSVWGDKRSARFPNVPTLKEVGINLVQTSPFGLVVPKGTDPKITQVLHDAFKKAMEMPN
FT                   YKESLAKFDMDTYYMDSATYKQYALDTMKTEKVIIEKLGLAK"
FT   sig_peptide     5262..5342
FT                   /locus_tag="Ajs_0005"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(6572..7177)
FT                   /locus_tag="Ajs_0006"
FT   CDS_pept        complement(6572..7177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40262"
FT                   /db_xref="GOA:A1W1Y7"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Y7"
FT                   /protein_id="ABM40262.1"
FT                   /translation="MPTIARRSAFFRRTALLSPVPFLAAAAACLTAPPALAQPSEDRAY
FT                   APSVYVQGEWARRQTDAITIGATLPWGTWRRPLWGGELRGHWDVSLSRWSFDGIGGHNS
FT                   AVVVGVAPTLRLRPDEGRSPWFWEAGIGATVASHRYRVQDHEFSTRFNFASHLGLGRNF
FT                   GAQRQHELMLSVQHVSNAGIKSPNPGENFLQLRYALHF"
FT   sig_peptide     complement(7064..7177)
FT                   /locus_tag="Ajs_0006"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 38"
FT   gene            complement(7318..7947)
FT                   /locus_tag="Ajs_0007"
FT   CDS_pept        complement(7318..7947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40263"
FT                   /db_xref="GOA:A1W1Y8"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Y8"
FT                   /protein_id="ABM40263.1"
FT                   /translation="MARFKITQRLAATAVAAAVLAGMAVPTLAQPGPGPAATEQGASQA
FT                   QQRPRQRALTPEQREQYMAQRAEAFKRKLQLTPEQEPAWNSFLQSMKPDADARKARLDW
FT                   QGMDQLTTPERIDRMRALRSQRAAEMDRRGDAVKAFYGTLTPAQQKTFDAEGKRMYRHW
FT                   GGDHPMGKRWGKDGARGDFRGDGRGMRHQGPGPGAGAAPGAPLTPQ"
FT   sig_peptide     complement(7858..7947)
FT                   /locus_tag="Ajs_0007"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            8260..9237
FT                   /locus_tag="Ajs_0008"
FT   CDS_pept        8260..9237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0008"
FT                   /product="putative exonuclease, RdgC"
FT                   /note="PFAM: putative exonuclease, RdgC; KEGG:
FT                   rfr:Rfer_0012 putative exonuclease, RdgC"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40264"
FT                   /db_xref="GOA:A1W1Y9"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Y9"
FT                   /protein_id="ABM40264.1"
FT                   /translation="MFKNMIVYRIAPEWQVELTQLEEALAKAPFQECGATQEKSSGWVP
FT                   PRGEAHGLLAESVGGHWMLRFQWEAKMLPATVLARKVKEKAAQIEQQTGRKPGKKETKE
FT                   LKEEAKLDLLPMAFTKQGGTWVWIDPQAHLLVLDTGAQGRADEVVSLLVEHLPGLSLAL
FT                   LDTQTSPQAAMALWLKEQEPPAGFSIDRECELKAPDETKAVVRYARHPLDIEEVQGHIE
FT                   AGKLPTKLAMSWDDRVSFVLTEGLQLKKVAFLDTVFEGQTQDDGGFDADVAIATGELSQ
FT                   LIPDLIAALGGEGRTSLGGAAAAPAPTAGALHAAASGPDDDAPF"
FT   gene            complement(9306..10658)
FT                   /locus_tag="Ajs_0009"
FT   CDS_pept        complement(9306..10658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0009"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   xac:XAC3471 C4-dicarboxylate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40265"
FT                   /db_xref="GOA:A1W1Z0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W1Z0"
FT                   /protein_id="ABM40265.1"
FT                   /translation="MHAISSAAPAPSVRLPFYRQLYFQVVFAIIIGVLLGHFQPEYGAA
FT                   MKPFGDAFIKLIKMIIAPVIFLTIVTGIASMSHLSAVGRVFGKAMAYFLTFSTLALVVG
FT                   LVVANVMQPGTGMHINVAELDQTAVKGYVSKSHEMTLTGFALDIIPKTLISPFVGDNIL
FT                   QVLLVAVLFGVSLAMVGDAGKPILDFLDGLTKPVFKLVNIVMKAAPIGAFGAMAFTIGK
FT                   FGLGSLVNLAELVLTFYITSAVFVLVVLGAVARACGFSVLKLIRYLKAELLLVLGTSSS
FT                   ESALPSLMEKMEKAGCAKSVVGLVVPTGYSFNLDGTNIYMTLAALFIAQATDTHLTLGH
FT                   QIALLLVAMLSSKGAAGVTGAGFITLAATLAVVPEVPVAGMALILGVDRFMSECRSLTN
FT                   FIGNAVATVVVSRWENALDADRLHRVLDGEAEFLPEPERAVEPVVLARHRA"
FT   gene            10828..13482
FT                   /locus_tag="Ajs_0010"
FT   CDS_pept        10828..13482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0010"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; PAS fold-4 domain
FT                   protein; KEGG: xcb:XC_0818 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40266"
FT                   /db_xref="GOA:A1W1Z1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Z1"
FT                   /protein_id="ABM40266.1"
FT                   /translation="MPLRRRRPLLTALVALFVLAGMAVCMLLASQYAQRRALHDESQGV
FT                   RRQLTLYGQALEQRIDRFRTLPEVLALDAQLRDALTHPLTPAEVDVLNRKLEQANGASH
FT                   SSTLTLINLQGRAIAASNWRDTPNNVGEDYHFRPYVQQALAQGHGRFYGIGLTTGEAGY
FT                   FLSTAIRGDDGQTLGLVAIKILLTELEREWRQSPDVVLASDAHGVVFLASRDAWRYRLL
FT                   VPLTPQARQELEATRQYTGQPLTPLGLQVERRVDEGTVLARAQEPPLPGPLLWHTQELA
FT                   GTGWQLHLLHHADSAIEARRWAAGAAAGLWLALALLVLFVRQRQRLALLRQRSRQELET
FT                   VLRQHAQELRTAQDGIVQAAREADTGLSRSLQHLPQGVVVIDRDLNLVAWNSRYVELFR
FT                   FPPELMRVGTPVEALIRHNARRGLLGATPTEDAIQRRLQHLRSGKPHLHESAKSDGTVL
FT                   EIRGNPLPDGGFVTSYADITSYKNAARELRSLADALELRIAERTRDLDAARREAEAANR
FT                   YKTRFVAAAVHDLLQPLNAARMFASLLRGHLHDAAGRQVADSIDGALAAQDGILNSLLD
FT                   ISRMESGQLEVHVRDFALGPLLQVMQHNFGIIAASRGLRLRTVGTRYAVRSDEALLRRI
FT                   LQNLVSNAIRYTPRGRVLIGCRRRGRYLRIEVHDQGPGIPESLQREIFEEFRRLGEGHS
FT                   QDGDRGAGLGLAIVERLGKLLGHEIGLRSELGRGSVFWVCVPLADAAAAPRPAAAGAAA
FT                   PPEGDQPLQGTTAWYIDDDAPSCEATGALLRRWGCEVPLAGGPQSALDLAAPGNAPQLV
FT                   LLDVRMGPFHGPDLYDRLCTVWGQAPSVVLVTAERSSTLRRQAAERGWGYLLKPVRPSA
FT                   LRALISQMMLRKQ"
FT   sig_peptide     10828..10917
FT                   /locus_tag="Ajs_0010"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.790 at
FT                   residue 30"
FT   gene            complement(13553..14197)
FT                   /locus_tag="Ajs_0011"
FT   CDS_pept        complement(13553..14197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0011"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2; KEGG: xcb:XC_0816
FT                   transcriptional regulator LuxR/UhpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40267"
FT                   /db_xref="GOA:A1W1Z2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Z2"
FT                   /protein_id="ABM40267.1"
FT                   /translation="MPPPTLLVADDHPLFRAALIQVLHERFAPLQTLEAASAATLGQAL
FT                   QDHPEVELVLLDLAMPGARGFSALLHVRGEYPQVPVVVISSNDHPRVIRRAQQFGAAGF
FT                   IPKSAPAEDMGAAIRAVLDGGSWFPPMAAERSEADAALAAKLAQLTPQQFRVLLCLADG
FT                   LLNKQIAHELGLAENTVKVHVTAILKKLECYSRTQAAVLVKSLETEPEAAP"
FT   gene            14252..15505
FT                   /locus_tag="Ajs_0012"
FT   CDS_pept        14252..15505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0012"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   rme:Rmet_3343 nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40268"
FT                   /db_xref="GOA:A1W1Z3"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Z3"
FT                   /protein_id="ABM40268.1"
FT                   /translation="MALNWVWTGFFIVAFATAVVRWLLGEAGLFQALLTALFDGARAGF
FT                   EISLGLAGIMALWLGLMRVGERAGMVELLARLAGPLLTRLFPAVPAGHPAQGAMTMNIS
FT                   ANLLGLDNAATPLGLKAMQELQTLNREPAGAASNAQIMFVVMNTAGLTLIPTSVIAIRQ
FT                   SVALKQGLGAGFNAADIFLPTLLVTFASLLAGVLAVALFQRLPIWRARLLLPLLAVGGV
FT                   LAAAVAGLAQLPAEQAAQIAGATGAGVILGVVALFLLAGAWRRVNVYDAFIDGAKEGFG
FT                   VAVQIIPYLVAILAAIGVFRAAGCMDALLAAIGAGVAALGWNTDFLPALPVGLMKVLSG
FT                   AGARGLMIDVLQTHGVDSFVGRLAAIVQGSTETTFYVLAVYFGSVGVKHTRHALACALV
FT                   ADAVGLLAAIGVGYALLR"
FT   gene            15982..16272
FT                   /locus_tag="Ajs_0013"
FT   CDS_pept        15982..16272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40269"
FT                   /db_xref="InterPro:IPR021724"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Z4"
FT                   /protein_id="ABM40269.1"
FT                   /translation="MQALYCFPRPFPVTDSALLPLPDRLAIDPRSPHHVAAVFQQAADI
FT                   GIRFNGKERVDVEEYCVSEGWIKVPAGKTLDRKGRPLLITLKGSVEVFYKP"
FT   gene            complement(16463..17650)
FT                   /locus_tag="Ajs_0014"
FT   CDS_pept        complement(16463..17650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0014"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: eba:p2A409 beta-ketothiolase protein; TIGRFAM:
FT                   acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40270"
FT                   /db_xref="GOA:A1W1Z5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Z5"
FT                   /protein_id="ABM40270.1"
FT                   /translation="MTHREVFVVSTARTAIGTFGGSLKDVPNTQLATTAVKAAIARAGI
FT                   APDAVGHVVMGNVIPTDTKDAYLSRVAAIDAGCPIETPAFNVNRLCGSGLQAIISAAQA
FT                   IGYGDCDVAVGGGSESMSRGPYFDQGARWGTRMGDSKSIDYMLGILHDPWQKMHMGITA
FT                   ENVAERYQISREMQDQLALASQQRAAAAIAAGYFKEQIVPVEIATRKGTVLFQEDEHVR
FT                   AATTLDVLAGMKPAFKKEGGTVTAGNASGINDGASAVVLVAGDRLQALNVKPLARLVGY
FT                   AHAGVDPAYMGIGPVPATQKVLQRTGLKVQDMDVIEANEAFAAQACAVVQELGLQPSKV
FT                   NPNGSGISLGHPVGATGAIITTKAIAELHRTGGRYALVTMCIGGGQGIAAIFERV"
FT   gene            complement(17647..18198)
FT                   /locus_tag="Ajs_0015"
FT   CDS_pept        complement(17647..18198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0015"
FT                   /product="protein of unknown function DUF1130"
FT                   /note="PFAM: protein of unknown function DUF1130; KEGG:
FT                   bbr:BB2477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40271"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Z6"
FT                   /protein_id="ABM40271.1"
FT                   /translation="MAAPPLYTIGHSTLAVQDFIALLQREGVTRVIDVRAIPRSLRQPQ
FT                   FHEDRLPGALAAQGIAYTHMPALGGRRSLQRGVPPTTNGYWDNRSFHNYADYALQPAFR
FT                   AALAALRMAAAREPCAIMCAEAVWWRCHRRIITDHVLAAGGAVRHILGARTESATLTPA
FT                   AQVHPDGTVTYPPPTTVSAP"
FT   gene            complement(18211..18426)
FT                   /locus_tag="Ajs_0016"
FT   CDS_pept        complement(18211..18426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_2097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40272"
FT                   /db_xref="InterPro:IPR021331"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Z7"
FT                   /protein_id="ABM40272.1"
FT                   /translation="MAHPFKVGDHVSWNSEAGRVSGRITAVHTRALQWKGYTHHASAEE
FT                   PQYEIQSDKTDHVALHKGSALHRLAR"
FT   gene            complement(18538..19041)
FT                   /locus_tag="Ajs_0017"
FT   CDS_pept        complement(18538..19041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0017"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cu(I)-responsive transcriptional regulator;
FT                   PFAM: regulatory protein, MerR; KEGG: rfr:Rfer_0023
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40273"
FT                   /db_xref="GOA:A1W1Z8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Z8"
FT                   /protein_id="ABM40273.1"
FT                   /translation="MSTAPRRPAHRVPSDGAGPAAALDWPVAIGTAAERAGVSARMLRH
FT                   YESLGLLTGVARTDSGYRQYTEADVHTLRFIRRARDLGFSMEEIATLLGLWQDKQRASS
FT                   QVKRIAQAHIDNLSERIAAMQAMQRSLQALVHCCHGDDRPDCPILDDLAMAGIPNSGAA
FT                   DVAI"
FT   gene            complement(19038..19235)
FT                   /locus_tag="Ajs_0018"
FT   CDS_pept        complement(19038..19235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0018"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: bxe:Bxe_A3162 heavy metal binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40274"
FT                   /db_xref="GOA:A1W1Z9"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A1W1Z9"
FT                   /protein_id="ABM40274.1"
FT                   /translation="MQYTFQVQGMTCGHCERAVVHAVRQVDTDALVKVDLPTGQVIVES
FT                   DKSREALANAIQEEGYKVAA"
FT   gene            19413..21761
FT                   /locus_tag="Ajs_0019"
FT   CDS_pept        19413..21761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0019"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: rfr:Rfer_0024 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40275"
FT                   /db_xref="GOA:A1W200"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1W200"
FT                   /protein_id="ABM40275.1"
FT                   /translation="MTSASLSPAASGDAPAGTLDLGIAGMTCASCVGRVERALRKVPGV
FT                   QDATVNLATERAHIVFDAASGGGIEALARRAVRNAGYEPRSVEEQEAGEEGAQSPWAGF
FT                   TPVAVGLLLSAPLVLPMLGDLFGLHWMLPAWVQFILATPVQFILGARFYKAGWHAAKAL
FT                   TGNMDLLVAIGTSAGYGLSLWLWATAESTHGAGHTPHLYFEASAVVITLVLLGKWLEAR
FT                   AKRQTTAAIRALHALRPEVAHLLGRDGEVDVPIAEVMAGDRLVVRPGERIPVDGTVVEG
FT                   HTQVDESMLTGEPLPVARSADGPEGGALTGGSINGDGRIVMQVTAVGSETVLARIIRLV
FT                   EEAQAAKAPIQRLVDKVSAVFVPVVLAIAIVTLLGWLWAGAGVEAALIHAVAVLVIACP
FT                   CALGLATPAAIMAGTGVAARHGILIKDAEALETAHRVQTVAFDKTGTLTVGRPRLTAFH
FT                   VEPGVDEAALLSAVAAVQSGSEHPLARAVVSAAQERGLPVPAPDGVRAVPGRGTEGEVA
FT                   ARSYLVGSLRWMQELGVDLGPLADRAATLQAEGATVSAVAERVAQDPSGARPPEAASTP
FT                   LGGSEDTIVPSAGAHYVLRALLAFGDEPKPGAREALAQLRVQGVRCVMISGDNRGAAEA
FT                   MARRLGLQPEAGEVMAEVLPGDKAAAVNALKAQGHVVAMVGDGVNDAPALAAADVGMAM
FT                   GNGTDVAMHAAGITLMRGDPQLVAAALDISRRTVAKIRQNLFWAFAYNVAGIPLAALGY
FT                   LSPVVAGAAMALSSVSVMTNALLLKRWRG"
FT   gene            21945..23597
FT                   /locus_tag="Ajs_0020"
FT   CDS_pept        21945..23597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0020"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rfr:Rfer_2354
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40276"
FT                   /db_xref="GOA:A1W201"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A1W201"
FT                   /protein_id="ABM40276.1"
FT                   /translation="MNIYALMRLFTIRLRMIGAIGVVLGLLGLLGGAGMLGMFRIHGLA
FT                   QDFISQPHAAVKLMGQLRSEMGEIRQHEKDMIIHYERPESVRAAHDRWLASLDRAGKVT
FT                   ATLGQIWQGEDLAEAKDVAKHLVAYREQFAHVARQLEAGGYDTATIANRMSGKAVEQFT
FT                   IATEKVAALDKRLAAEVDSAIAHQDRVTDQTKWLFALAVLITVVVVVPLTLLNMVSICR
FT                   PLEVARAMAQAIAGGDLSQRIHVEGRDEAADLQRALLDMQNGLGAMVAQVRDASSNIAT
FT                   ASQEIATGNQDLSARTEQTASNAQEAVAALSQLTATVQQTASSSQVANQLVTSASGIAT
FT                   RGGQVVQQAVNSMHEISSSSRKIGDIIGLIDSIAFQTNILALNAAVEAARAGEQGRGFA
FT                   VVAGEVRSLAQRSAAAASEIKGLISSSVTAVDGGVRHVEDAGKAMQEIVSSVQRVTDII
FT                   GEINSAASEQADGIGEVNASVGEIDRMTQQNAALVEESAAAAESLREQAARLSQVVSQF
FT                   QLADDGHAPAAFTRTGAPAPALRGGDTPRLSAA"
FT   sig_peptide     21945..22082
FT                   /locus_tag="Ajs_0020"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.640 at
FT                   residue 46"
FT   gene            complement(23784..24527)
FT                   /locus_tag="Ajs_0021"
FT   CDS_pept        complement(23784..24527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN2125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40277"
FT                   /db_xref="GOA:A1W202"
FT                   /db_xref="UniProtKB/TrEMBL:A1W202"
FT                   /protein_id="ABM40277.1"
FT                   /translation="MHGDTGRPRPGRRRGGLRARPVGLCVQHGGHVVLGLGAGATPGGG
FT                   AGGVRLAHRPGAGCGDHAPRLQCPPAVAVHSGRSGGRARGRQPAAPPERPLVQSTLLVC
FT                   WCPAMLMARSLPRVRWGGRTADAVVGLCGGVMGGIGGFTGVLPTLWCTLRGLPKDTQRA
FT                   VVQNFNLAMLAVAMATYLAKGLVTRDMLPAFGIVATAVLVPVLLGTRLYIGISEVRFRQ
FT                   IVLGLLTLSGGALLVASVPRLLASA"
FT   gene            complement(24678..25802)
FT                   /locus_tag="Ajs_0022"
FT   CDS_pept        complement(24678..25802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0022"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   pol:Bpro_0063 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40278"
FT                   /db_xref="GOA:A1W203"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1W203"
FT                   /protein_id="ABM40278.1"
FT                   /translation="MPTLFDPIQAGDLHLANRIAMAPLTRNRSPRAVPRDITATYYAQR
FT                   ASAGLLITEGTAITHQGQGYSDVPGLYGTEQLDGWKRVTQAVHARGGKIVTQLWHVGRV
FT                   SHTALQPEGGAPVAPSAVRAQSQTYLVDAASGQGQFVPTSEPRALAAEELPDIVHAFAA
FT                   AARNAVQTAGFDGVEIHGANGYLLDQFLKDGANQRKDDYGGGIANRVRLMVEVTRAVVD
FT                   AIGGGRVGIRLSPVTPANDIRDSDPQPLFEHLARELAPLGLAFIHVIEGATGGPREVEG
FT                   RPFDYAAFKNAYRSAGGRGAWMVNNGYDRDMAQEALASGRADIVAFGRAFISNPDLVER
FT                   LRRGAPLNAWDKTTFYGGGEHGYIDYPALEQVPA"
FT   gene            complement(26068..26676)
FT                   /locus_tag="Ajs_0023"
FT   CDS_pept        complement(26068..26676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0023"
FT                   /product="Glutathione S-transferase, C-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain; KEGG:
FT                   rfr:Rfer_0047 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40279"
FT                   /db_xref="GOA:A1W204"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A1W204"
FT                   /protein_id="ABM40279.1"
FT                   /translation="MKLYYSPGACSLSPHIVLHEAGLAHTSVLASTKSHKLQDGTDYYT
FT                   INPLGYVPVLELNDGTRLREGPAIVQYLADQAPHKNLAPANGTLARYRLQEWLTFIGTE
FT                   IHKGFSPLFKPTTPADYKSLVHEQLLSRLKWVDGELAHKPYLMGEHFSVADAYLFTVTN
FT                   WAPAVNLDISALKNLAAYRERIAARPAVQAAMKAEGLLK"
FT   gene            complement(26810..27145)
FT                   /locus_tag="Ajs_0024"
FT   CDS_pept        complement(26810..27145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0024"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   bbr:BB3393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40280"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A1W205"
FT                   /protein_id="ABM40280.1"
FT                   /translation="MTEAKTGISAYPTSADSYELNSAMDCRPGCGACCTAPSISSPIPG
FT                   MPHGKPAGMRCVQLDDDARCRIFGRPERPTVCASLRPSPAMCGDSRAHAMRWLAFMEQA
FT                   TQPSTPR"
FT   gene            complement(27142..27726)
FT                   /locus_tag="Ajs_0025"
FT   CDS_pept        complement(27142..27726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0025"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   pol:Bpro_0072 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40281"
FT                   /db_xref="GOA:A1W206"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1W206"
FT                   /protein_id="ABM40281.1"
FT                   /translation="MKFLVFAGSTRTQSFNRRLAAVAAHMARDAGAEVTLLELADFDIP
FT                   LYNADLETVGTPADVIRLKEVLDAHPAWVICSPEYNGSYTGLLKNTIDWASSPVAGHAE
FT                   WSDGTRPFAGKVVGMLSASNGALGGLRSQSHLAPLLLNLECWLAPRHFALPRAASAFDA
FT                   QGQLVDASQAAHVRGVVEQVLWAAGRLHGTA"
FT   gene            27939..29924
FT                   /locus_tag="Ajs_0026"
FT   CDS_pept        27939..29924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0026"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: pol:Bpro_0073
FT                   glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40282"
FT                   /db_xref="GOA:A1W207"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W207"
FT                   /protein_id="ABM40282.1"
FT                   /translation="MLYPQDFDVIVVGGGHAGTEAALAAARMGSRTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMALATDEAGIQFRILNSSKGPAVRATRAQADRILY
FT                   KAAIRRMLENQPNLWLFQQAVDDLMVEGDRVVGAVTQVGIRFRSRAVVLTAGTFLDGKI
FT                   HVGLNNYAAGRAGDPPAVSLSARLKELQLPQGRLKTGTPPRIDGRSIDFSQCEEQPGDG
FT                   MPGGVNEGQVPVFSFMAHAYGGAAMHPRQVPCWITHTNARTHEIIRSGFDRSPMFTGKI
FT                   EGVGPRYCPSVEDKINRFADKESHQIFLEPEGLTTHEFYPNGISTSLPFDIQYDLVRSM
FT                   HGLENAHILRPGYAIEYDYFDPRSLKSSFETRQIQGLFFAGQINGTTGYEEAAAQGLFA
FT                   GINAALQCRGVGAWVPARDEAYLGVLVDDLITKGVTEPYRMFTSRAEFRLQLREDNADM
FT                   RLTEAGRRMGLVDDARWDAFSRKRDAVSRETERLKSTWVNPRNLPTVEAERVLGKAIEH
FT                   EYNLFDLLRRPDVGYDALTTMDGGKYASEAVSRETLGELSASVIEQVEIAAKYAGYIDR
FT                   QRDEVQRAAHFEKLRLPEDLDYMQVAALSIEVRQKLQKHRPETLGQASRISGVTPAAIS
FT                   LLMVHLKKGGFKGFAPQPADGVETVA"
FT   gene            29921..30601
FT                   /locus_tag="Ajs_0027"
FT   CDS_pept        29921..30601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0027"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: pol:Bpro_0074
FT                   methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40283"
FT                   /db_xref="GOA:A1W208"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W208"
FT                   /protein_id="ABM40283.1"
FT                   /translation="MSVVSNTSFEHALREGANALGLDLSEAQITQLLDFLALLQKWNKV
FT                   YNLTAVRDPQEMLTHHLLDSLAAVPPLRRHVAQRGQDSAARPGARLLDVGSGGGLPGVV
FT                   FAICCPEVDVSCVDTVAKKAAFIQQAAGTLGLSNLHGIHARVETLAGPFDVVSCRAFAA
FT                   LADFTAWSRQALAPHGVWLAMKGKHPHDEIAALPADVSVFHVEQLTVPGLQAERCILWL
FT                   RPVA"
FT   gene            30636..31250
FT                   /locus_tag="Ajs_0028"
FT   CDS_pept        30636..31250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0028"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pol:Bpro_0075 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40284"
FT                   /db_xref="GOA:A1W209"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1W209"
FT                   /protein_id="ABM40284.1"
FT                   /translation="MFGIADYGAFVAAIVLFLAIPGPGNLALITSTGKGGVRAGMAACM
FT                   GVIAADQVLMWMAVAGVAGLLAAYPAAFHAVQWLGAVYLGWMGYKMLTAKPGDAPVLNI
FT                   APRHYFRQGAVITLLNPKAIVFYMAFFPLFVNPATHRGLVTFAAMAATIATLTFLYSLV
FT                   VVLLTHFLAERMRANPTVARVLEKTAGVFLIGFGVKLAISK"
FT   gene            31267..32037
FT                   /locus_tag="Ajs_0029"
FT   CDS_pept        31267..32037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0029"
FT                   /product="chromosome segregation ATPase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   pol:Bpro_0076 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40285"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W210"
FT                   /protein_id="ABM40285.1"
FT                   /translation="MAKIFCIANQKGGVGKTTTSVNLAAGLAKIGQRVLLVDLDPQGNA
FT                   TMGSGVDKRALELSVYDVLLESASVPEAAVLSEQCGYRVLGANRELAGAEVELVPLEQR
FT                   ERRLKAALAAVDSDYDFVLIDCPPSLSMLTLNGLCSAHGVIVPMQCEYFALEGLTDLVN
FT                   TIKQVHANLNPDLQIIGLLRVMFDPRITLQSQVSEQLKDHFGDKVFDTVIPRNVRLAEA
FT                   PSYGLPGVVFDPAAKGSQAFLEFAREMVERVKRM"
FT   gene            32124..32666
FT                   /locus_tag="Ajs_0030"
FT   CDS_pept        32124..32666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0030"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   rfr:Rfer_0052 protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40286"
FT                   /db_xref="GOA:A1W211"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1W211"
FT                   /protein_id="ABM40286.1"
FT                   /translation="MNPSQILLLPGWQNSGPGHWQTEWERLHGYQRVQQHDWMRPLRGD
FT                   WSARLEEVVADAPGEVVLAAHSLGCILTAWWAAHTRYAHKVRGALLVAPGDVERPDLAA
FT                   QIPGWAPIARQVLPFPAVLVGSQDDPYCSFERAQTLAGAWGARFVDSGPRGHINADSDL
FT                   GDWPEGHALLRALMNKD"
FT   gene            32673..33668
FT                   /locus_tag="Ajs_0031"
FT   CDS_pept        32673..33668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0031"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /note="TIGRFAM: parB-like partition proteins; PFAM: ParB
FT                   domain protein nuclease; KEGG: pol:Bpro_0078 ParB-like
FT                   partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40287"
FT                   /db_xref="GOA:A1W212"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A1W212"
FT                   /protein_id="ABM40287.1"
FT                   /translation="MVTKKPKGLGRGLEALLGPKVADKAPAGANAAGAADGPVSTLALD
FT                   RLVPGIYQPRTRMDEGALYELAESIKAQGIMQPILVRRLDDEQAQQRRQERASQGASAA
FT                   MGALSASGPLYEIIAGERRFRASRLAGLAEVPVLVRDVPNEAAAAMALIENIQREDLNP
FT                   LEEAQGLQRLIREFGLTHEQAAQAVGRSRSAASNLLRLLNLAEPVQTMLMAGDIDMGHA
FT                   RALLSLERAAQITAGNQIAAKKLSVREAESLVKKLGAEFALTPQKPKKDKSRDLKRVEE
FT                   ELSDLLMAEVEVRVKKRVKRGSRVEEMGELAIQFGSLEALNGLIERLRGG"
FT   gene            33694..34491
FT                   /locus_tag="Ajs_0032"
FT   CDS_pept        33694..34491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0032"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: rfr:Rfer_0054
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40288"
FT                   /db_xref="GOA:A1W213"
FT                   /db_xref="InterPro:IPR026170"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1W213"
FT                   /protein_id="ABM40288.1"
FT                   /translation="MPRRPRRLHHLHAPPPRRIVLPWPLPAVLVWAAAWLLFAGLRGSV
FT                   APLAALGLACAVGVAGSLLAQGWWRRGLIALGFPLSAALGGAVALPAWGWLLPLALLLL
FT                   VYPLNAWRDAPLFPTPPGALHGLQDAAPLPAGAAVLDAGCGLGDGLKALRAAYPQARLH
FT                   GLEWSGPLALLCRLRCPWARVRRGDIWATDWGGYDLVYVFQRPESMARVAAKARAEMAP
FT                   GSWLVSLAFAVPGVCPSARLDSFAGHAVWIYQLPLPGDGAAPH"
FT   gene            34652..35692
FT                   /locus_tag="Ajs_0033"
FT   CDS_pept        34652..35692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0033"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   bur:Bcep18194_B2884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40289"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A1W214"
FT                   /protein_id="ABM40289.1"
FT                   /translation="MSRKPLTLLAAACAALALTGCETTNMRMGSAESKTVATGAAAGGS
FT                   AANESGQLERCQSPLGTVSLVENQDAGWYTILRNEYKLPPTANLLRLLIQQSNCFIVVE
FT                   RGAAGMRAMDRERQLMGSGEMRGGSNFGRGQMVASDYGMSPEIIFSNNDAGAIGGVLGG
FT                   LIGGGSGRALAAVGGGLKTREASAMLTLVDNRSGVQVAASEGSASKSDFAGFGSLFGGS
FT                   AGGGLGGYQNTAQGKVITAAFMDAYNQMVVALRSYKAQSVQGQGLGGGGRLGVDGGAAP
FT                   SQTRAGAAMSVREAQESLNAMGYNVGTPDGSAGPKTAKALREFQQSQGLPVTGRLDTAT
FT                   AGALSR"
FT   sig_peptide     34652..34714
FT                   /locus_tag="Ajs_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.926 at
FT                   residue 21"
FT   gene            complement(35848..36177)
FT                   /locus_tag="Ajs_0034"
FT   CDS_pept        complement(35848..36177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0034"
FT                   /product="sulfite dehydrogenase (cytochrome) subunit SorB"
FT                   /EC_number="1.8.2.1"
FT                   /note="PFAM: cytochrome c, class I; KEGG: pol:Bpro_3017
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40290"
FT                   /db_xref="GOA:A1W215"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1W215"
FT                   /protein_id="ABM40290.1"
FT                   /translation="MIQKKLPSLALSTLLLAAGPALADEAAQMALGKKLFNTATPACAV
FT                   CHTLKDAGAEGAIGPVLDELQPDADRVTRAMRNGIGSMPSFKGTLSDAEIAAVALYVSR
FT                   ASRGK"
FT   sig_peptide     complement(36106..36177)
FT                   /locus_tag="Ajs_0034"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(36284..37504)
FT                   /locus_tag="Ajs_0035"
FT   CDS_pept        complement(36284..37504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0035"
FT                   /product="sulfite dehydrogenase (cytochrome) subunit SorA
FT                   apoprotein"
FT                   /EC_number="1.8.2.1"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding; Mo-co
FT                   oxidoreductase dimerisation domain; KEGG: pol:Bpro_3018
FT                   Mo-co oxidoreductase dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40291"
FT                   /db_xref="GOA:A1W216"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A1W216"
FT                   /protein_id="ABM40291.1"
FT                   /translation="MHTQAPASLPRRRLLAGSASALAAAGLASFHQGAAAQSAAPAAAK
FT                   PLPGYAGWKNADAVIVHSSTTIETRRGAFGTSVITPSDQLYVRNNLPTPPESIVADRDA
FT                   WQVQVSGVKEPRRLSVRELKAMGLETVTMVLQCSGNGRGFFPSKPSGTPWTVGAAGCVV
FT                   WSGVPVRDVARALGGVADGMKYMTGTGGEVLPAGIDPKTVIVERSVPLEAMQDALLAWE
FT                   MNGEPIPLAHGGPLRLIVPGYTGVNNIKYIGQLAFTDKESEARIMSHGYRISPPGGKGD
FT                   PSQPSVQQMSVKSWINGPLPEDGELAPGRVQIHGVAFGGMHAVKGVEVSVDGGKTWQAA
FT                   RLVGPDMGRYAWRQFVLQADLPRGSHTLASRATDAQGNVQPEQREENQAGYNNSSWADH
FT                   AVTVKVA"
FT   sig_peptide     complement(37394..37504)
FT                   /locus_tag="Ajs_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.387 at
FT                   residue 37"
FT   gene            37587..38165
FT                   /locus_tag="Ajs_0036"
FT   CDS_pept        37587..38165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40292"
FT                   /db_xref="UniProtKB/TrEMBL:A1W217"
FT                   /protein_id="ABM40292.1"
FT                   /translation="MSRCRRCQRPAGHGQRLFFLRDEHQRAAFARARHLPVAVGPPALA
FT                   VGQGRGLVEGHDGDDAALLEEGGQVVGAAAFDLAGAQQLGEAGQGLAGRQVQVAGDFGL
FT                   GHEAAAQRTFVVLVLDGRAHQRGRAHGEHGRRRSAAGQQRGQQPPHAAACMPGRVSEQM
FT                   RGRLGGGKGQGHLGACAQVEIGLLQRLRE"
FT   gene            complement(38189..38761)
FT                   /locus_tag="Ajs_0037"
FT   CDS_pept        complement(38189..38761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0037"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   dar:Daro_0521 sigma-70 region 2:sigma-70 region 4"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40293"
FT                   /db_xref="GOA:A1W218"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1W218"
FT                   /protein_id="ABM40293.1"
FT                   /translation="MAWNGSRRRPLLVPMISTAESRYNQWVRDHYRFLLRSAWALTGSR
FT                   ALAEDVVQDCFTSAWRHRDQLRDASLARAWLFQIMRRHALRHLLPQQPLQYSADDPAHD
FT                   VPAPPSPIDDRLDVVKALARIAPIHREVLVLYYFDDMSTAQMAEALDIAPGTVLSRLAR
FT                   ARDALKAALGPAPAASAGVIPLRKASR"
FT   gene            complement(38883..39749)
FT                   /locus_tag="Ajs_0038"
FT   CDS_pept        complement(38883..39749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0038"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC protein, arabinose-binding/dimerisation;
FT                   Cupin 2, conserved barrel domain protein; KEGG:
FT                   bpm:BURPS1710b_2619 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40294"
FT                   /db_xref="GOA:A1W219"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A1W219"
FT                   /protein_id="ABM40294.1"
FT                   /translation="MPSIAAAGPGRALSYVESLTPHLFVPGPARPVRAKYRQLGAATQV
FT                   RPHSHPWAQVAISTSGALRLTVPGGTFIVPPSRALWIPPGVEHAVTMVEDADLRTLYFH
FT                   QPPGHCGPGVARADEAPWRQCRVLEVSQLLRALVREMPTAADGEPLPPEQLRRERHLSA
FT                   LILDELRRAASVPLGIDLPHDKRLRQLCEAVLADPTRHETLAEWARGTGASPRTVARLF
FT                   RQELSSTFTQWRQQVILAQALALAARRRPINQIAAELGYSSPSAFSAMVRRAVGMSPGR
FT                   FLGSPQS"
FT   gene            39815..41077
FT                   /locus_tag="Ajs_0039"
FT   CDS_pept        39815..41077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0039"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   reu:Reut_A1964 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40295"
FT                   /db_xref="GOA:A1W220"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1W220"
FT                   /protein_id="ABM40295.1"
FT                   /translation="MQPTPNASAPASLREDARTIGLIGLAHGSSHFFHMLLPPLFPFLI
FT                   ADFGFSYSELGLLLSVFFVVSGVGQALAGFVVDRVGARPVLFFALACFATAGLTAASAS
FT                   GYAGLVAAAVLAGLGNAPFHPVDFTILNKRVSPARLGHGFSVHGISGNLGWATAPVFMA
FT                   GIATAAGSWRVACASGAVLALVVLAIMVINRDALDDRHGARGTQPAATGTAGAAPEHPL
FT                   AFLRLPAVWLCFSFFFWSTCSLSAIQSFAGPALQKLYGIPLTTTALVVTGYMLCGAAGM
FT                   VLGGFLVGRVQRLEKTISVCLLASAALLTLVGLGVLPGMVALAVAALAGAGIGIAGPSR
FT                   DMLIKRAAPPGATGRVYGTVYSGLDLGFSVAAPVFGALLDGGMNAAIFYGSATALVLSV
FT                   VSAGFVGVGVAARRRAVPAAA"
FT   gene            complement(41155..42579)
FT                   /locus_tag="Ajs_0040"
FT   CDS_pept        complement(41155..42579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0040"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   pol:Bpro_0111 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40296"
FT                   /db_xref="GOA:A1W221"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1W221"
FT                   /protein_id="ABM40296.1"
FT                   /translation="MNAPATTAHLQPLTTPRPVPQAMLDALAARFGAQYSAAQAVCEQH
FT                   GRDEGSLQAPPPAAVVFAESTQDVQDAVRLAAQYGVPVIPYGAGSSLEGHLLAVQGGIS
FT                   IDMGRMNRVLSVDADDLTVTVQPGITRKQLNEAIKDTGLFFPIDPGADASIGGMAATRA
FT                   SGTNAVRYGTMRENVLALEVVTARGEVIRTGTRAKKSSAGYDLTRLMVGSEGTLGLFTE
FT                   VTVRLYPLPEAVSAAICSFPTIEAAVRTVIQTIQLGVPIARVELIDANSVRMVNAHSKL
FT                   RLREEPLLLMEFHGSPAGVQEQAEVVQDIARQWDGNAFEWATTPEERTRLWTARHNAYF
FT                   AAVQSRPGCKAISTDTCVPISRLADCLLDSVAEADASGIPYFLVGHVGDGNFHFGYLLD
FT                   PAVPAERETAERLNHQLVARALRLGGTCTGEHGVGVHKMGFLVDEAGEGAVEMMRAIKR
FT                   ALDPQNILNPGKIFAL"
FT   gene            complement(42717..43796)
FT                   /locus_tag="Ajs_0041"
FT   CDS_pept        complement(42717..43796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0041"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bxe:Bxe_A3516 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40297"
FT                   /db_xref="GOA:A1W222"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A1W222"
FT                   /protein_id="ABM40297.1"
FT                   /translation="MAHPGRPATKLQITDAERAELHARLRVRKAPEDEKLRMRIVLGCA
FT                   DGESGTMIAQRLGTTVQTVSKWRRRYRAYRLAGLTDAPRAGRPRSVGDEQVQLIVDKVR
FT                   QSKPDNATHWSVRQMSRHAGVSPATVQRIWHAFGLKPHLQETFKLSTDPHFVDKVRDVV
FT                   GLYMAPPDRALVLCVDEKSQIQALDRTQPGLPLTFGKPSTRTHDYKRHGTTSLFAALDV
FT                   ATGKVIGQLKRRHRSVEFLQFLKAIDAAVPGEQDIHLIMDNYGTHKTQAVRAWLAAHPR
FT                   YHVHFTPTSASWLNLVERFFSQISEQWIKRSAHTSVAQLEQSIREYIDRHNEDPKPFVW
FT                   HKSADTILASVARAASTII"
FT   gene            complement(44043..44423)
FT                   /locus_tag="Ajs_0042"
FT   CDS_pept        complement(44043..44423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0042"
FT                   /product="Calcium-binding EF-hand-containing protein"
FT                   /note="PFAM: Calcium-binding EF-hand-containing protein;
FT                   KEGG: pol:Bpro_0112 acid shock protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40298"
FT                   /db_xref="GOA:A1W223"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A1W223"
FT                   /protein_id="ABM40298.1"
FT                   /translation="MPHTPQRRTLPSFDARSVMLFAALTVGGAAAQAQTPSAPSAQPQY
FT                   QTGPGPATTQPKATFGGSSTATPSDSSASASAFERADANRDGQLSSAEAGQLPAIANRF
FT                   QALDKDKNGSLSRTEFEAGSRS"
FT   sig_peptide     complement(44322..44423)
FT                   /locus_tag="Ajs_0042"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 34"
FT   gene            44579..45151
FT                   /locus_tag="Ajs_0043"
FT   CDS_pept        44579..45151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0043"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP--cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: pol:Bpro_0113
FT                   ATP--cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40299"
FT                   /db_xref="GOA:A1W224"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A1W224"
FT                   /protein_id="ABM40299.1"
FT                   /translation="MGNRLTQIATRTGDDGSTGLGDNTRVSKASGRPQAMGDVDELNSH
FT                   IGLLLCEPLPADMRELLIDVQHQLFNLGGELSMPGYELLKDDALLQLDNALARYNAELP
FT                   RLLEFILPAGTRAACQAHVCRTVARRAERAVVALQQQETMRPAPRQYLNRLSDLLFVLA
FT                   RVLNRMDGGSEVYWKSERLARQNHATE"
FT   gene            complement(45521..45943)
FT                   /locus_tag="Ajs_0044"
FT   CDS_pept        complement(45521..45943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0044"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: rfr:Rfer_0061
FT                   phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40300"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1W225"
FT                   /protein_id="ABM40300.1"
FT                   /translation="MSLWKKPTTLALITASSANTAVSHLGIEFTEVGDDFLRARVPVDE
FT                   RTRQPFGLLHGGVSVVLAETLGSVGAYHASPEGWLAVGLDINANHLRAARSGWVTGTAR
FT                   PVHIGKTTQVWQIDMVNDAGELTCVSRITMAMLAPK"
FT   sig_peptide     complement(45872..45943)
FT                   /locus_tag="Ajs_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.518 at
FT                   residue 24"
FT   gene            46167..47324
FT                   /locus_tag="Ajs_0045"
FT   CDS_pept        46167..47324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0045"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: dar:Daro_3540 extracellular ligand-binding
FT                   receptor; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40301"
FT                   /db_xref="GOA:A1W226"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1W226"
FT                   /protein_id="ABM40301.1"
FT                   /translation="MQRRQFVLQAGRAAALAAAPAFVLPARAQDAPGVSAKALSIGCSA
FT                   AMSGPLLGFGTDIQLGAGAAFAQANARGGVHGRTLQLQMVDDAYDPERTLANVKQIIGQ
FT                   GSALALLSCVGTPNNAAIVPLVEEAGIPYVAPITGASSLRKSTRNVFHVRASYTDEVQR
FT                   LIQRLAGMGLKGIGVVYLDNGYGREMLEDATRALAALNMKPAVQVAVATDGKNLPQVLQ
FT                   AVAAARPSAVLLATAGTVSVGLVRGIKKESPGVLMAGLSVTLPSASLGQLGEDGSGLAL
FT                   SMIVPDPNRAKLQLVRDYQSAMRAQGKSEFSQGSLEAYVNARVLIEGLDRAGKDVTQPK
FT                   LRAALAGIRNLDLGGFVVDYSGQAPYVGSRFIDLGVLGSTGRFIA"
FT   sig_peptide     46167..46253
FT                   /locus_tag="Ajs_0045"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(47449..48969)
FT                   /locus_tag="Ajs_0046"
FT   CDS_pept        complement(47449..48969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0046"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /EC_number="3.1.2.1"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   dar:Daro_2807 acetyl-CoA hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40302"
FT                   /db_xref="GOA:A1W227"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A1W227"
FT                   /protein_id="ABM40302.1"
FT                   /translation="MSTSSSPRIQHPGLAQKIMSAAEAAALIPAGANIGMSGFTGAGYP
FT                   KQVPQALAARIEAEHAAGRPFQVNVWTGASTAPELDGALAKVNGIHQRLPFQSDPICRD
FT                   KINAGEVHYLDIHLSHVAQHAWFGFLGPMQVAVVEVLGILPDGRLIPSSAVGNNKTWLE
FT                   IADKVILEVNSLPPIEMEGMHDIYYGTAIPPRRQPIHLTQATERIGEPYLRVDPSKVIA
FT                   VVQTHQRDRDTAFAKPDAVSNQIAAHIIDFLAHEVKVGRLPKNMLPLQSGVGNVANAVL
FT                   AGLLDGPFDELLGFTEVLQDGMLELIKRGKMTAASATAISLSSEALKDFNEHIAFYRDR
FT                   IVLRPQEISNHPELVRRLGVIAMNAMIEADIYGNINSTHVMGSAMMNGIGGSGDYARNG
FT                   YLSFFVTPSVAKGGKVSCIVPMVSHVDHTEHDTQIIVTEQGLADLRGLSPRQRAQVIID
FT                   KCAHPDFRPLLQDYFDRARSKGAQHTPHILGEALSWHERCLATGSMLP"
FT   gene            49169..49909
FT                   /locus_tag="Ajs_0047"
FT   CDS_pept        49169..49909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1795 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40303"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:A1W228"
FT                   /protein_id="ABM40303.1"
FT                   /translation="MPFTPRCPSCRQPTEIRRFTASTGGTLELDLCFACQGMWFDPQEN
FT                   TRLAPAAVLELFELLHQHRGDAHRPLADRLRCPRCSQALAKGYDVAQGGRYVTYRCAAR
FT                   HGRFSTFGSFMVEKGFVRHLSTMEIEALAERVGTINCTSCGGTVDIRHDHACPYCRSAL
FT                   SLLDPQAVDKALARHGSAARQTAPADAASPDALADALVALVALERNRAREERARQRERL
FT                   EGTRSDEFDLLTAGIEMVWSLLRR"
FT   gene            complement(50045..51331)
FT                   /locus_tag="Ajs_0048"
FT   CDS_pept        complement(50045..51331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0048"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: pol:Bpro_0117
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40304"
FT                   /db_xref="GOA:A1W229"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A1W229"
FT                   /protein_id="ABM40304.1"
FT                   /translation="MALLQWNERPAQVLQGGGVIGPDERLPWAQTGLMGIQHVIAMFGA
FT                   TVLAPILMGFDPNVAVLMSGIGTLIFFLITGGKVPSYLGSSFAFIGVVIAATAYAGKGP
FT                   NANIGVALGGIIACGLVYTLVGVVVHLVGTGWIERFMPPVVTGAVVAVIGLNLAGIPIK
FT                   NMAANNFEAWMQALTFVCVALVAVFTSGMLQRLLILVGLIIASLLYALLTNGMGLGKPI
FT                   DVSGIANAAWFGLPQFHAPVFSAPAMLLIVPVVIILVAENLGHIKAVTAMTGKNLDQYM
FT                   GRAFIGDGVATMVSGAVGGTGVTTYAENIGVMAATRIYSTAVFLVAALLAVLLGFSPKF
FT                   GALIQAIPLPVMGGVSIVVFGLIAIAGAKIWVDNRVDFSQNKNLIVAAITLILGTGEFT
FT                   LKFGDFALGGIGTATFGAIVLYAALNRGK"
FT   gene            complement(51534..52832)
FT                   /locus_tag="Ajs_0049"
FT   CDS_pept        complement(51534..52832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0049"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: pfo:Pfl_4308 chemotaxis sensory transducer,
FT                   PAS/Pac sensor; TIGRFAM: PAS sensor protein; PFAM:
FT                   chemotaxis sensory transducer; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; PAC repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40305"
FT                   /db_xref="GOA:A1W230"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1W230"
FT                   /protein_id="ABM40305.1"
FT                   /translation="MWWQQQRFSAQGRWQAIAEQTAVVEVDVQGAVREVNARFCDLLGY
FT                   QRAELIGQPPTIFYPPEYVASPAFQANWRRLCGGEFVQGTAQRRCKNGTVVWVQGMFYP
FT                   VRDARGRVERIVGLVYDVTATQEQTQRAHAILEAIERSMAVIEFDLQGHVLRANDHFLH
FT                   TMGYTRQNLVGQHHRILCPPAFAQSSDYPRFWDDLRAGVYSKGKIERVDARGRTVWLEA
FT                   TYNPVLDPDGVVSHIVKFATDITARVQQAQAREQGVNTAFAVAQETQQLSEEGTQTIVD
FT                   ATARIQSIAQLFEDTAARVHELGRKTESIAASVQGIRRVADQTNLLALNAAVEAARAGV
FT                   AGRGFAVVAEEVRKLAGDSRTATNDIHQTIQAVLQEMRAMIDHIQGGVAAVEQGAQLSR
FT                   QARDAIERIREDAHKVVDVVQELHALETGKPGR"
FT   gene            complement(52711..54834)
FT                   /locus_tag="Ajs_0050"
FT   CDS_pept        complement(52711..54834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0050"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: eba:ebA5328 conserved
FT                   hypothetical protein, predicted radical-SAM emzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40306"
FT                   /db_xref="GOA:A1W231"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A1W231"
FT                   /protein_id="ABM40306.1"
FT                   /translation="MPAALPRVLSVIPPMTQLNTPYPSTAYLTGFLRSRGVPAWQEDLA
FT                   IALVLRLLSRDGLAQVAERARALPANAQSPAVQSFLAQQERYLATIGPAMAFLQGRDNT
FT                   LAHRIVGRHYLPEGPRFAALDVYEDDGSGDPLGWAFGALGLTDKAKHLATLYLNDLADV
FT                   LQGAVDARFEFVRYAEQLAGSQPTFDPLADALAQAPTFVDEVLQQLTHEAVARHQPGVV
FT                   LLSVPFPGSVYGAFRIAQAIKAQHPHIVTVLGGGFVNTELRELADPRVFDFFDYVTLDA
FT                   GERPLLALLEHLQGQRGRQRLVRTFVRNDDGAVQYVHLAEPDVAFAEIGTPTWDGLPLQ
FT                   RYLSLLDMLNPMHRLWSDGRWNKLTVAHGCYWKKCSFCDVNLDYIGRYEGASAQVLADR
FT                   IAAIVAETGQTGFHFVDEAAPPKALKALAQELIARGTGISWWGNVRFEKTFTPELAELL
FT                   ADAGCIAISGGLEVASDRLLGLMKKGVSVDQVARVTRAFSDAGILVHAYLMYGFPTQTV
FT                   QDTVDALEYVRQLFENGCIQSGFFHRFACTVHSPVGQSPEEYGVTLAPLPPGGFAKNDV
FT                   AFIDPTGVDHDALGAGLKKAIYNYMHGIGLEQDVRMWFPFHVPKTTVRPGRIARPGGAI
FT                   AIVLIASRAFPAKRCAHRAYTTCPVFLSNEVSYVVAAATFFGTRALAGHCRADGRGRSG
FT                   CPRRGARSERAVL"
FT   gene            complement(54914..55921)
FT                   /pseudo
FT                   /locus_tag="Ajs_0051"
FT   gene            complement(56009..57274)
FT                   /locus_tag="Ajs_0052"
FT   CDS_pept        complement(56009..57274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0052"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase,
FT                   FAD-binding; FAD dependent oxidoreductase; KEGG:
FT                   xcc:XCC2647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40307"
FT                   /db_xref="GOA:A1W232"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1W232"
FT                   /protein_id="ABM40307.1"
FT                   /translation="MTTQDVSSQRSDVLIVGAGPAGLSLAASLAQAGMQVTVLEQQPAS
FT                   TLAAPPADGREIALTHPSVATLQRIGSWQRLAAHEVGLLREAQVHDGPVGQRGAMQLHA
FT                   GGSGVQHLGWIVPNHALRRTAYEVAAHTPGVRLVTEARVTRVAVTPAHAELEYTDTRNL
FT                   DAAPLRLQAPLLVAADSRFSATRRQLGIGAAMHDFGRTVIVCRLRHELPHHEVAHECFG
FT                   YEQTLAILPLPGDLVDGAPMCSAVVTTGAAHAQELLALPPEAFAARVQAQFKDRLGAMR
FT                   LVGERHAYPLVAVYAHRFAAARCALLGDAAVGMHPVTAHGFNMGLAGVDSLTRTLTQAR
FT                   ERGADIGAASVLEGYARGHHRHAWPLYQGTNAIVRLYTDDRPLPRLLRQVVLAGANRLP
FT                   PLKGAIVSQLTGRRPAWPSAAP"
FT   sig_peptide     complement(57176..57274)
FT                   /locus_tag="Ajs_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.826 at
FT                   residue 33"
FT   gene            57396..57686
FT                   /locus_tag="Ajs_0053"
FT   CDS_pept        57396..57686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40308"
FT                   /db_xref="UniProtKB/TrEMBL:A1W233"
FT                   /protein_id="ABM40308.1"
FT                   /translation="MVSLQWRTLQPASKGPDMRVDIYRRSEAEGRYSHLAVPEGKPIPQ
FT                   EAINTDWNCEHRAVERDETQAHWNDLGIPEPGRQLRDKGYAITSVTEQPRR"
FT   gene            57800..60064
FT                   /locus_tag="Ajs_0054"
FT   CDS_pept        57800..60064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0054"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: pol:Bpro_0120
FT                   acetoacetyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40309"
FT                   /db_xref="GOA:A1W234"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1W234"
FT                   /protein_id="ABM40309.1"
FT                   /translation="METHHNIPPTHPPYAPQIRRYQDWLQAQHGLRFDDYDALWRWSTT
FT                   DLDAFWQSVWDYFDLQSPTPHSAVLAKNVMPGAQWFPGAQVNYARQVLRHVDAAQAAGQ
FT                   PALIGRNERGERRELSWPALRRQVAALALHMRAQGVQPGDRVAAYLPNIPETIVAFLAC
FT                   ASIGAVWSLCAPDMGTHAVLDRFRQIAPTVLLAVDGVTYGRRDHDRCDVLAELRAQLPT
FT                   LRHVVLVNNLNASKIVADTACYASVIARNDAETAAFEPAWLPFDHPLWIVYSSGTTGLP
FT                   KPIVHGHGGMLLVMLQLAVLHNDIGCSYAPNSLGERFHWYSSTGWIMWNAQVGGLLGGT
FT                   TCVLYDGNPGGNKERPDWAVLWRMAAEERVTFFGAGAAFYGHCMKAGITPAACGDLSAI
FT                   RVLGSTGSPLSAEVQQWGTDFFRQVSAGAAVVAAPGRPRQGATPSGGSDPHAAAKRGGD
FT                   MSTAGPPQSAKAPLGGSDPHAVGERGGDIWWCNISGGTDFAGAFIGGNRELPQTPGRMQ
FT                   CRMLGAAVEAWDERGRPVLDAVGELVCTQPIPSMPLFLWGDADGARYRASYFDMYPPGH
FT                   GRRPGGGDLGPEAGAVWRHGDWIEIGSSARPGCVIYGRSDATINRHGLRMGTSEIYSAV
FT                   EALPEVLDSLVVDLEYLGRASYMPLFVVLRSGLVLDDGLRARINDAIRASLSPRFLPDE
FT                   IVQVAEVPRTLSGKKQELPVKKLLLGQSMDKVVNPDAMANPGCLAWYVDFARHRATAVA
FT                   S"
FT   gene            complement(60098..61027)
FT                   /locus_tag="Ajs_0055"
FT   CDS_pept        complement(60098..61027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0055"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: reu:Reut_B3561 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40310"
FT                   /db_xref="GOA:A1W235"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W235"
FT                   /protein_id="ABM40310.1"
FT                   /translation="MNLRQLSQFVALAETGNFHRAAERLHMAQPPLSVSIRKLEEELGS
FT                   PLFERTTTGVVLTPAGEAMLGDARRALFHAQQCRQAVQDAREGEGGLLRLGIIGSATYA
FT                   LLPQLIPSLRQRYPQIELELSEATSSEILEGLVSRRFDAGLLRYPVLDPSGFELLPLDR
FT                   DDFVLAVAESSPLAQRDAIALAEAAHEPFIMYPQHKVPSLSALAMMRCQFSGFSPRVAQ
FT                   EAMQVQTIMSLVASGLGVGLVASVARQVVPRGVKCLALTDNPPGFHVGIALARLASGTS
FT                   RVVERFTEHALRFASVPRVEGENWDKPG"
FT   gene            61158..62144
FT                   /locus_tag="Ajs_0056"
FT   CDS_pept        61158..62144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0056"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   bpa:BPP3809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40311"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W236"
FT                   /protein_id="ABM40311.1"
FT                   /translation="MAFHRRTTLRALAGASLVALGTTLAPAVQAQAFPSKTLKFVVPFG
FT                   PGSGTDTSARYFARKLQDLTGQSVVVENKPGANGFIAVKQVLSAPADGYTVFIGSNSTL
FT                   AVNAALFKELPYDPVKDFAPLTMMMRSPAMLATAPQAPFADLKGLVSYAKAHPGKVNFG
FT                   AGSAGYQLMGELLNDSAGVQTVHVPFKGAGETMTALAAGTVDYAFAEVTAVQELAKGGR
FT                   VKVLAVAADKRVATSPDVPTASEAGLPGFEAYTWVGAMVSSKTPPAETAKLAELFTTIS
FT                   KMDETRAFYERLGATPMTGGPAQMHEFQKNEIALWKRIVTQAKVPLQ"
FT   sig_peptide     61158..61250
FT                   /locus_tag="Ajs_0056"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.856 at
FT                   residue 31"
FT   gene            62141..63388
FT                   /locus_tag="Ajs_0057"
FT   CDS_pept        62141..63388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0057"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: pfo:Pfl_0118 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40312"
FT                   /db_xref="GOA:A1W237"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1W237"
FT                   /protein_id="ABM40312.1"
FT                   /translation="MTQPAALQPGALQHVKVLDLSRVLAGPWAAQTLGDLGAEVIKVER
FT                   PGSGDDTRAWGPPYVTDPAGQPTGESAYYMCTNRNKQSVTIDFIRPEGQELVRRLAQQC
FT                   DVLVENFKTGGLAQYGLDYASLSALNPRLVYCSITGFGQSGPYAHRAGYDFLIQGMGGL
FT                   MSVTGRPDGEDGGGPMKVGVALTNILTGLYASTAILAALQAREHTGRGQHIDLALLDVG
FT                   VACLANQGMNYLYGGKVPQRMGNAHPNTVPYQDFPTADGHMILAVGNDGQFARLCHAVG
FT                   QPGWAQDARFATNAARVAHRDELVALIRGVTVGKPTRDWIALLEQHAVPCGPINTVREV
FT                   FEDPQVRARGLQIRMEHPRAGAVPLVASPMRLSDTPVTYRHTPPQLGQHTDTVLREHLG
FT                   LAPEAIDALRAQGVVA"
FT   gene            63385..64581
FT                   /locus_tag="Ajs_0058"
FT   CDS_pept        63385..64581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0058"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: reu:Reut_B3560 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40313"
FT                   /db_xref="GOA:A1W238"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1W238"
FT                   /protein_id="ABM40313.1"
FT                   /translation="MSGFQGPLAGVRVLDLSSVVFGPLASQVLADYGAEVIKIEPPAGD
FT                   STRHTGPAVEPGMAAVFMGCNRSKKSVVLDLKQPAAQQALHALLATADVFMHSMRPQKL
FT                   GKLGLAPEQLRARYPRLVFAGLHGFAEDGPYAGLPAYDDVIQGMSGLADLMQRQTGESR
FT                   YLPTIAADKTCALVAAHAILAALFARERTGQGSFVEIPMFETMVGFNLVEHFYGMHFTP
FT                   KLSGAGYPRVMAPWRKPYRTLDGHVCMMPYTDAHWRRFFSAVGQPQLADDPRFANQASR
FT                   TRHIAELLEILSEHVARHDTQHWLRTCAQLEIPAAPVARMDELPQDPHLVATGFFATVR
FT                   DPAMGEVRFPRSSVRFDGAQVPIGMPPRLGQHTEELLRAAGLDDAQLAALQPSEPSTA"
FT   gene            64578..65045
FT                   /locus_tag="Ajs_0059"
FT   CDS_pept        64578..65045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B3559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40314"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A1W239"
FT                   /protein_id="ABM40314.1"
FT                   /translation="MNQDIPRMGQGLYWQDLKVGLRWRTFRRTITEADLVNFISTTGML
FT                   EAIFIEEGYEGGAIQGRPVPGALTYTFIEGFILQSMIQGTGLAMLELRQKILAPVVVGD
FT                   SIGAVVEVTDIRPTSKNNRAVVTSLITVTNQRGEPVMEYTATRLLAGREAT"
FT   gene            65113..66081
FT                   /locus_tag="Ajs_0060"
FT   CDS_pept        65113..66081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0060"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   rme:Rmet_4073 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40315"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W240"
FT                   /protein_id="ABM40315.1"
FT                   /translation="MTARITRRLAVLAGAALLAGAAHAAWPDKPITLVVPFPPGGPTDM
FT                   VARVLAQAVGEQLGQSVVVDNKPGANGNIGNAFVAKAAPDGYTVLYNTSSLALSPALYK
FT                   KMSYDPRKDLAPVALTAVVPLGLVVNPQLPVKTVAELVDYAKKNPGKLSYGSAGNGNVT
FT                   HLTAFQVTQHYGIAATHVPYKGSAPADVDLVAGQIHFMTDTINSVAPFIKDGKLRLLAV
FT                   STAKRLPNFPEAPTLAESGMNGFEAGAWQGVMVPAGTPAPIIERLNQAFLQALKNPTVL
FT                   EKLRIQGTEPLGSTPAEYGAYIEKELARWASVVKSTGVSLD"
FT   sig_peptide     65113..65187
FT                   /locus_tag="Ajs_0060"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            66104..67261
FT                   /locus_tag="Ajs_0061"
FT   CDS_pept        66104..67261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0061"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   eba:p2A7 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40316"
FT                   /db_xref="GOA:A1W241"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1W241"
FT                   /protein_id="ABM40316.1"
FT                   /translation="MSVLDSLALTRIPPEDEALRAEVRAFLAEAVRDLPAHVRARSWGG
FT                   YSTQLSRRLGERGWIGITLPREYGGGGRSAFARYVLVEEYLNCGAPVGSHWIADRQSAP
FT                   LILKYGTEAQKQFYLPRVCKGEAFFCIGMSEPNSGSDLASVKTRAVPNDQGFVLNGQKI
FT                   WTTNAHHCQYMIALVRTSGTAEDRHKGLSQVIVDLSLPGVTVRPIEDLSGDSHFCEVFF
FT                   DNVQLGPDALIGAEGQGWEQVTAELAFERSGPERLFSSIVLFDQWLDYVRTPQGRSESA
FT                   VRLAGKVLTQLAPLRAMSVAVQEKLVQGASPVVEAALVKELGTTLEQMIPAAIADDLFA
FT                   REAEDVPVELLMTLKYVTEASPSFSLRGGTRDILRGMIARGLGLR"
FT   gene            67276..68307
FT                   /locus_tag="Ajs_0062"
FT   CDS_pept        67276..68307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0062"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   reu:Reut_B3556 acyl-CoA dehydrogenase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40317"
FT                   /db_xref="GOA:A1W242"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1W242"
FT                   /protein_id="ABM40317.1"
FT                   /translation="MSQDNDLFADAARQVLADQCTPPVVRAIESGGRAAPATQLLWAQL
FT                   EATGLADALLPEDDGGAGLGLTQVFGVLEQCGAHALPLPLGETMVARALLAQAGVARPA
FT                   GSITLARGERLPDDGVRSALVRGGQVADHVLVQAGSAWHLLATADAQAAPQALALDAAL
FT                   AWSAAQVEAAPGVPVDAAQDARTLQAAVVAPQMAGALGDVFRRTLQYANERQQFGRPIG
FT                   KFQAIQHQLAVMSEHVFAARMAAQLGCNGAGVLPDRLRVATAKARCSEAALAVAEFAHA
FT                   IHGAIGFTAEYDLQLFTRRLHAWRQTAGSESYWHGVAGEALLAHGGLTLDLVRRITDVE
FT                   MTL"
FT   gene            68417..69205
FT                   /locus_tag="Ajs_0063"
FT   CDS_pept        68417..69205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0063"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bbr:BB0750 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40318"
FT                   /db_xref="GOA:A1W243"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1W243"
FT                   /protein_id="ABM40318.1"
FT                   /translation="MAFLTIERDGGILTATMNQPETRNALTGNTAVQEFVQLCDTVRKD
FT                   ASVKVLILTGAGPIFSSGGNVKDMKRFFDDALTPDLIREEYRQGIQQIPNALYQLDVPV
FT                   ICAVNGPAIGAGLDLTCMCDIRIAADNATFAESFVRVGIVPGDGGAWLLPRAVGMAKAS
FT                   EMAFTGEAISAQEALACGLVSRVVPADQLLPTARALAEKIAANPGAVMRMTKRLLREGE
FT                   HASLASLLEISAGYQAIAHKTADHREAVTAFIEKRAPRFQ"
FT   gene            69263..69886
FT                   /locus_tag="Ajs_0064"
FT   CDS_pept        69263..69886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0064"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="TIGRFAM: CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: rfr:Rfer_2496
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40319"
FT                   /db_xref="GOA:A1W244"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:A1W244"
FT                   /protein_id="ABM40319.1"
FT                   /translation="MASPHKRFSMIREFHLADWFTLGNAVCGVGALFSSMTYLETSDVR
FT                   HVYFACALVLAALVFDVLDGRIARWRQKSSAMGRELDSLADVISFGVAPAIIAYACGMQ
FT                   GLYDRVVLAFFVACGVSRLARFNITAETLAEGPSGKVKYFEGTPIPTSIVLVGLMAVAA
FT                   SVGAVRGQLWLGSVTIGGFTLHPLVLLFALSGSLMISRIRIPKF"
FT   gene            70118..70885
FT                   /locus_tag="Ajs_0065"
FT   CDS_pept        70118..70885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0065"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; KEGG: rfr:Rfer_0036 septum
FT                   site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40320"
FT                   /db_xref="GOA:A1W245"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:A1W245"
FT                   /protein_id="ABM40320.1"
FT                   /translation="MAVDTAGQARTHLDLKSAQLPVVAMVLKTTDVASIAAELAARRAD
FT                   DPEFFDNDPVLIDLSAVQDEPQPIDFAALVKTLRSHRTQPVAVRGGSSAQRQDAHDAGL
FT                   IAAPDAPPPRMQAPRENTPREVVHEVIREVEVVREVPVPAPAPGTVVVDKPLRSGQQVY
FT                   ARGSDLVVMAVVSFGAEVIADGNIHVYAPLRGRAIAGARGDTSARIFSTCMEPQLVSVA
FT                   GIYRTTETELPDNVRGKPAQVRLDGEKLLIEPL"
FT   gene            70937..71752
FT                   /locus_tag="Ajs_0066"
FT   CDS_pept        70937..71752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0066"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase; KEGG: pol:Bpro_0019
FT                   septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40321"
FT                   /db_xref="GOA:A1W246"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W246"
FT                   /protein_id="ABM40321.1"
FT                   /translation="MAKIVVVTSGKGGVGKTTTSAAFASGLALAGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIQGEANLNQALIKDKQCENLFVLAASQTRDKDALTQDGVGK
FT                   VLKDLADMGFDYIVCDSPAGIESGALMAMHFADEALLVTNPEVSSVRDSDRILGMLSSK
FT                   TKRAIEGGEPVKEHLLITRYNPHRVEDGQMLSLEDIQDILRIKLIGVIPESESVLQASN
FT                   QGLPAIHLSGTDVSEAYKDVVARFLGEDKPLRFIEAAKPGFFKRIFGGR"
FT   gene            71758..72024
FT                   /locus_tag="Ajs_0067"
FT   CDS_pept        71758..72024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0067"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: rfr:Rfer_0034 cell division topological
FT                   specificity factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40322"
FT                   /db_xref="GOA:A1W247"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W247"
FT                   /protein_id="ABM40322.1"
FT                   /translation="MSLLSFLLGEKKKTASVAKERLQIILAHERSGRSAGQPDYLPALQ
FT                   RELVAVISKYVKINADDLKVHFERQDDLEVLEVKIELPEATAK"
FT   gene            complement(72101..72661)
FT                   /locus_tag="Ajs_0068"
FT   CDS_pept        complement(72101..72661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0068"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: rfr:Rfer_4057 flavin reductase-like, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40323"
FT                   /db_xref="GOA:A1W248"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1W248"
FT                   /protein_id="ABM40323.1"
FT                   /translation="MNSRLPHPPSSQPPVFTPREFRDALGMFATGVTIVTARGEGGALI
FT                   GMTANSFNSVSLEPPLVLWSLGHKTSSLPAFSRATHYAINVLTVEQRALAEQFATRGID
FT                   RFAGVAYRLGLSGVPVLDGAAAVFECFNRSQYVEGDHTIFVGQVERCSHQEGASPLLYH
FT                   GGVFYTEHPLGSLSATVARPMEK"
FT   gene            72768..73550
FT                   /locus_tag="Ajs_0069"
FT   CDS_pept        72768..73550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0069"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bja:blr6083
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40324"
FT                   /db_xref="GOA:A1W249"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1W249"
FT                   /protein_id="ABM40324.1"
FT                   /translation="MSLLPRFSLLGSGPTVLLLHDADSDHLGFAPTLETLAAAGYRAVA
FT                   WDMPGYGGSAPVEPYNFKGLAQRALLLLDALRCEQVVLVGHGLGAMLALEIAVRAPLRV
FT                   RRLVLCAGGPALDEAATAVWVAPRLAGLDDGRDMARLADPTVARDAGPGALPEGLQLAR
FT                   HAMGRVPPATYRRALEALTAFARRAPELVRLQVPALLVGGEYDRCTPPEALLALAHVLP
FT                   DARAVLLPGVGHWPQLEDPEGFEAALLDFLAGPAPVLH"
FT   gene            73689..74879
FT                   /locus_tag="Ajs_0070"
FT   CDS_pept        73689..74879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0070"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pol:Bpro_0150 extracellular ligand-binding receptor; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40325"
FT                   /db_xref="GOA:A1W250"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1W250"
FT                   /protein_id="ABM40325.1"
FT                   /translation="MMAMRPRHWAGALALWALAGMAGAQPVKVGVIGPFSGPSSDFGTP
FT                   MLQGIQLAVEQFNAVGGYLGRPVELVVKDDQGSPDTGRQRSQELAREGVVAALGFCNTG
FT                   VAMKSLDVFQQAKLPLIVPCATGTPVTRTYPAAQSFIFRTSAPDNIQAPFVVEDILRRG
FT                   WTRVALFADDTGYGQAGRKDVEAALAAHQLTPVYATNFPLGVKSLAPQLQAARDAGAQV
FT                   IFSYTVGPENAVIAQGRKELGWKVPQVGGWTLSFPFFIQGGKDAAEGALTAQTFIAEPS
FT                   NERRASFLSTYARAFKGRPAVPMAAAQGYDAAYLLMYALLGIRDGQVNGTALKHSLENL
FT                   QRVYYGVVATYERPFSAEEKEAITPNMLVMGKVQAGAVTFAYPEDAKRNLLVQRKR"
FT   sig_peptide     73689..73763
FT                   /locus_tag="Ajs_0070"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 25"
FT   gene            complement(74892..76256)
FT                   /locus_tag="Ajs_0071"
FT   CDS_pept        complement(74892..76256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0071"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pol:Bpro_0148 D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40326"
FT                   /db_xref="GOA:A1W251"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1W251"
FT                   /protein_id="ABM40326.1"
FT                   /translation="MGRSTLRAMKTIVLGAGIIGISTAWHLRERGHEVTVVDRQPDAAL
FT                   ETSFANAAQISVSYCEPWANREAPWKALKWMFDKEAPLLFRPQLDWEQWRWCLKFLAQC
FT                   NDTAFARNVQQIVALGAYSHAALKDIVRATGIEYHRLERGIAHFYTDQKSFDDAAHAVE
FT                   LMRRFGVQRRVVSRDELLAIEPAFRAYGDRITGGTYTSTDESGDARVFTQALARRCAER
FT                   GVQFLYGHDVLRLNRSGDAIESIAIRARQESATGQKDQILKADAVVVACGSYSAPLLRG
FT                   VGVHLPIYPGKGYSATFPLLKPEGAPMVSTIDDGKKIAMSRLGNVLRVAGTIELGGYDL
FT                   SLDSPVARARCHMLSRRIETILPGVCDTRTPEEGGDPQYWTGLRPATPTNIPFIGRTPL
FT                   HGLWVNAGHGTLGWTHGAGSGKAMAELLSGERPAMDFAFLGDDTPAAAYGAPRLA"
FT   gene            76320..77231
FT                   /locus_tag="Ajs_0072"
FT   CDS_pept        76320..77231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0072"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_0149 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40327"
FT                   /db_xref="GOA:A1W252"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W252"
FT                   /protein_id="ABM40327.1"
FT                   /translation="MSTFDPAALECLAAIVEEGGFERAARRLNITQSAVSQRLRALEAQ
FT                   VGSVLIVRSRPLKPTSAGQLLLKHTKQLRLLRADLERDLQDLMPSGRGGGREEERIAIA
FT                   INADSIATWAVDALGDLVRQRLPLEIIADDQDFTQEWLRSGQVMGCVTTLKSALRGCRM
FT                   VPLGAMQYVAVAAPELARRQLPQGLTAHNFRDVPFVSFNRKDDMQAEFVTRTFGLKRVS
FT                   LSRVFVPSSEGQVRAVAAGWGVSVVPELLARPWLQQGRLVDLAPGHTLPIQLYWHSWNL
FT                   ESEVLDALADALTSAAAQYLSA"
FT   gene            77302..77934
FT                   /locus_tag="Ajs_0073"
FT   CDS_pept        77302..77934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0073"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: pol:Bpro_0153
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40328"
FT                   /db_xref="GOA:A1W253"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1W253"
FT                   /protein_id="ABM40328.1"
FT                   /translation="MNTLQPPRPSFKEQMLRAREDAIVEAASRLLGEKGFETMTVDEVA
FT                   AAVGIAKASLYKHFAGKDDLCSAAMVHVVERLQRFLAALPAELGAMQRLHALLCWTLQL
FT                   QLADEVPLLPSRNSALAQALRACDAYRASMQEVHACILGWIVEAQAQGQLRRELPPDVI
FT                   LCALLARNADPMLGMLRDRGYADECIIDWAADTCLSGLASGPAMRVA"
FT   gene            complement(77935..78357)
FT                   /locus_tag="Ajs_0074"
FT   CDS_pept        complement(77935..78357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0074"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rfr:Rfer_0401 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40329"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1W254"
FT                   /protein_id="ABM40329.1"
FT                   /translation="MNILLAVDGSTYTKKMLAYLAAHDEMLGSSHTYTAITVQPQLPPR
FT                   ARAALGKEVVDKYHAEEGEKVLSPVVKFMARHGVQLKTMTKVGPAGETIAKVAESGKYD
FT                   LVVMGTHGHGSLGKLVMGSVSTQVLANCQVPVLLVR"
FT   gene            complement(78477..79322)
FT                   /locus_tag="Ajs_0075"
FT   CDS_pept        complement(78477..79322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0075"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pol:Bpro_0155
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40330"
FT                   /db_xref="GOA:A1W255"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:A1W255"
FT                   /protein_id="ABM40330.1"
FT                   /translation="MKLQLLSDLHLEAHPHFTPSPAVGADVLVLAGDIGSYQAGSLLSD
FT                   DDFGLARFSPLPQYAGWPTPVVFVPGNHEYDMQDFDAAHARLRRICDRLGLIWLERESM
FT                   VLQGVRFVGTTLWSDFDALADHAAITDPGQRLQRREKAFRAANFYLSKTGSTRQGVPFL
FT                   AAEVREQALVCQAWLRNALAQPFAGTTVAVTHFAPSLLSADPRYGLVPGTAGFCNALDD
FT                   CLPHAQLWLHGHLHAPSDYLVRGARADGAPWSCRIVANPLGYARKGEQATFQPHCVLTV
FT                   "
FT   gene            complement(79339..80310)
FT                   /locus_tag="Ajs_0076"
FT   CDS_pept        complement(79339..80310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0076"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_0158 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40331"
FT                   /db_xref="GOA:A1W256"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A1W256"
FT                   /protein_id="ABM40331.1"
FT                   /translation="MQPLNFRTLDLNLLRVFDEVMAERNLTRAAEKLAITQPAVSNALR
FT                   RLREVLGDELVTRRGHGVEPTPRALALWPAVRHALAQLQETLSPGRFDPASAQTTFVLA
FT                   MADATGATLIPPLIEIVEREAPGVSLRVVPLTTRDPRRLLDEESADMAVGYFPAVLADL
FT                   TARAQSDNVVAHESTRLYDSQYVCVMRADHPLAAVPMTLDLYCAARHLLVSFSGKPFGF
FT                   IDGALAALGRERRIVLTVNQFFTAGRVVATTDLLTVLPRHFVGVASVRDELVWRPLPMT
FT                   LPPVHVDALWHRRRNHDPAHRWLREAIARAARNTPAPIHRQD"
FT   gene            80434..80874
FT                   /locus_tag="Ajs_0077"
FT   CDS_pept        80434..80874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40332"
FT                   /db_xref="GOA:A1W257"
FT                   /db_xref="UniProtKB/TrEMBL:A1W257"
FT                   /protein_id="ABM40332.1"
FT                   /translation="MTKFVHIDLPVQHHGIARIEEAASHLKQTAARFDGTRGATSLLLA
FT                   ALVAALLVVANQVMDTWNDGHMLAGWMVMWVIAFAGMALLAAPARSAVLGLRAAAKAWS
FT                   DAHRRAAEDERTWNAALRDARIMADLSRAMNGIAVDDLRRYR"
FT   gene            complement(81052..82923)
FT                   /locus_tag="Ajs_0078"
FT   CDS_pept        complement(81052..82923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0078"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   pol:Bpro_0160 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40333"
FT                   /db_xref="GOA:A1W258"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:A1W258"
FT                   /protein_id="ABM40333.1"
FT                   /translation="MNAPTMPVLDIQAPAYVKNAKLIAWVAEMAALCKPARIHWCDGSQ
FT                   QEYEQLCQQLVDAGTFKKLNPAKRPGSYLAWSDPSDVARVEDRTYICSEKKEDAGPTNN
FT                   WMAPAEMRATLQPLFDGCMAGRTMYVVPFSMGPLGSHIAHIGIELTDSAYVAVNQKLMT
FT                   RMGKAVYDVLGTDGEFVPCMHTVGAPLAAGQKDTTSWPCNPQVKYIVHYPETREIWSYG
FT                   SGYGGNALLGKKCLALRIASTMGRDQGWLAEHMLILGVTNPEGKKYHVAAAFPSACGKT
FT                   NFSMLVPPEAGFAGWKVTTIGDDIAWIKPHADGKMYAINPEAGYFGVAPGTNMHTNPNC
FT                   MRSLDKDVIFTNVALTDDGDVWWEGMEKDTGKLPDHLIDWQGKDWTPQIAKETGAKAAH
FT                   PNSRFTVAATNNPALDPEWDNPAGVAIDAFIFGGRRSTTVPLVTEARSWMEGVYMAATM
FT                   GSETTAAAFGAQGVVRRDPFAMLPFCGYNMSDYFQHWLDMEHKLEESGHQLPKIFCVNW
FT                   FRKGEDGKFVWPGYGDNMRVLKWMLDRIEGTAQGEPTMFGIAPQYAEINWTGLDFSTEQ
FT                   FKTVTSIDKAAWAEELKLHTEHFDKLAYHLPQELLATKAALEKRLAA"
FT   gene            complement(83258..83491)
FT                   /locus_tag="Ajs_0079"
FT   CDS_pept        complement(83258..83491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40334"
FT                   /db_xref="GOA:A1W259"
FT                   /db_xref="UniProtKB/TrEMBL:A1W259"
FT                   /protein_id="ABM40334.1"
FT                   /translation="MHARGRCGYTCPPSRHQTPQETEPMAHDHPIAPNAADVEAATATD
FT                   AAESVVHLIPVVIPAVGAAMIFLLAFIAVYMA"
FT   gene            complement(83527..84726)
FT                   /locus_tag="Ajs_0080"
FT   CDS_pept        complement(83527..84726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0080"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="TIGRFAM: threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   amino acid-binding ACT domain protein; KEGG: rfr:Rfer_0344
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40335"
FT                   /db_xref="GOA:A1W260"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A1W260"
FT                   /protein_id="ABM40335.1"
FT                   /translation="MLTFQDIQHAAERLRGQVLETPCVESRTLSQIVGAQVFLKFENLQ
FT                   FTASFKERGACNKLSQLTPQERERGVVAMSAGNHAQGVAYHAQRLGLRAVIVMPRFTPG
FT                   VKVERTRGFGAEVVLHGDTLEEARQHAYQLAEQQGLTFVHPYDDEAVAAGQGTLVLEML
FT                   AAQPDLDALVVSVGGGGLLAGMATAARAIKPNLEIIGVQTARFPAMVNAIKGTHHAQGA
FT                   STIAEGIAVGQPGKMTQEVIGRLVDDLLLVDEGDIEQAVLMLLEIEKTLVEGAGAAGLA
FT                   ALVRHPERFRGKKVGLVLSGGNIDPLLLAAIIERGMVRSGRLARIMVSARDVPGVLARI
FT                   TALVAEAGANIEEVHHQRAFTVLAAQNVEIELVLQTRGKAHIQQVLDLLRAAQMEAELR
FT                   "
FT   gene            complement(84837..86492)
FT                   /locus_tag="Ajs_0081"
FT   CDS_pept        complement(84837..86492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0081"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bam:Bamb_0107 acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40336"
FT                   /db_xref="GOA:A1W261"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:A1W261"
FT                   /protein_id="ABM40336.1"
FT                   /translation="MDWTTHQVFNQYPELNDYHPLATDAALCEALERAGADWARPALDA
FT                   YAARLGMAETYALAEQANRHTPQLQRFDTRGQRIDALEFHPAWHQLMALYRGEGLISRP
FT                   FQDERPGRWSAWAAGFYLHGQVEQGTLCPATMTQAAIPLLRKEPALWQSLQSRLYSTAY
FT                   DPRDLPVADKASIWLGMGMTEKQGGSDVRANTTVATPIGTGGRGGEYRLRGHKWFFSAP
FT                   QCDAHLVVARTGEGGPFACFYVPRWRLDGSRNAVRVQRLKDKVGNRSNASSEVEFEDAW
FT                   GLLMGEEGRGIPTIIEMASYTRLNCVVGSAAILRQATVQAIHYARRRHAFGKALAEQPL
FT                   MRAVLADLALESEAALHLAMRLAQAYEHDSTPAQRAWKRVMTPAAKFWVCKRAVELTGE
FT                   AMEVLGGNGYVEDGVMARLFREAPVNSIWEGSGNVMCLDVLRALQREPEAAHALLTELH
FT                   AAAQGEPRIAAAARELQALLATPAEQLEGLGRVLTQRLVLLAQACLLRQQAPAAVADAF
FT                   IATRLADSGAGRVAGAIDTRGLDVAAVLARAFPG"
FT   gene            complement(86645..87307)
FT                   /locus_tag="Ajs_0082"
FT   CDS_pept        complement(86645..87307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40337"
FT                   /db_xref="UniProtKB/TrEMBL:A1W262"
FT                   /protein_id="ABM40337.1"
FT                   /translation="MQRTPRTSFPAPPRRATATLALCVAACLAVTGCATPPPPPVAPDP
FT                   AADARARYDADLQDCRDRAQQVGVLSETLDAVVQGALVAAFLAWGLGRSDTGVRDWALT
FT                   GGALAGGSQGLQAMERRRQLVAHCMAVRGHRISPLAVAGPQPGAAPSVPVAPEAPPRPT
FT                   GADAYSAERLAREQACHAQPVAALAAKGPGFETYSVPCSNDDALAIRCEFGNCRVLR"
FT   sig_peptide     complement(87203..87307)
FT                   /locus_tag="Ajs_0082"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.732 at
FT                   residue 35"
FT   gene            complement(87355..88455)
FT                   /locus_tag="Ajs_0083"
FT   CDS_pept        complement(87355..88455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0083"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   pol:Bpro_0172 5-methyltetrahydrofolate--homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40338"
FT                   /db_xref="GOA:A1W263"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:A1W263"
FT                   /protein_id="ABM40338.1"
FT                   /translation="MAQSPLLCARHRGRRRLPTIGPMTLPHYTRAQALPAILEQRIAIL
FT                   DGAMGTMIQRFKLTEAQYRGERFKDFARDVKGNNELLSLTRPDVIRDIHEGYLAAGADL
FT                   IETNTFGATSIAQDDYGLAELAYEMNLESAKLARAACDKFSTPDKPRFVAGALGPTPKT
FT                   ASISPDVNDPGARNVTFEQLRAAYHEQARGLIEGGADVLLVETIFDTLNAKAALFAIDE
FT                   VFEETGECLPIMISGTVTDASGRILSGQTVTAFWHSVRHARPLSVGLNCALGATLMRPY
FT                   IQELAKAAPDTFISCYPNAGLPNPMSDTGFDETPEVTSRLVHEFAAEGLVNIVGGCCGT
FT                   TPDHIGAIARAVAPVGTRRLFQTEAA"
FT   gene            88553..90424
FT                   /locus_tag="Ajs_0084"
FT   CDS_pept        88553..90424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0084"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="KEGG: rfr:Rfer_0459 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40339"
FT                   /db_xref="GOA:A1W264"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1W264"
FT                   /protein_id="ABM40339.1"
FT                   /translation="MSPAHFVLHDVFGYEQFRGPQQAIIDHVIAGGDALVLMPTGGGKS
FT                   LCYQVPAIVRRDAGLGVTVVVSPLIALMHDQVGALHEAGVEAAFLNSTLDWQQTQDVER
FT                   RLARGEITLLYAAPERVTTDRFLTLLDGLHARGQLGLFAIDEAHCVSQWGHDFRPEYRA
FT                   LTLLHERYPQVPRIALTATADALTREDIIERLQLQDARLFISSFDRPNIRYTIVEKKDA
FT                   TTQLLRFIEREHSGEAGVVYCQSRKRVEELAATLQDAGINALPYHAGLDTKVRQNHQDR
FT                   FLREEGIVMVATIAFGMGIDKPDVRFVAHVDMPKNIEGYYQETGRAGRDGLNADAWMAY
FT                   GLQDVVNQRRMIDESPAGEEFKAVMRGKLDALLALAEATDCRRVRLLGYFGEASEPCGN
FT                   CDNCLNPPAVWDGTDAARKLLSTIYRVHEASGLTFGTGHIMDILRGKATDKVQQFGHEK
FT                   LSTFGLGAQYSEAQLRGVLRQLLAAGAVGLHKVTTEGGHSFDTLALTEGSRPVLRGEQS
FT                   VLLREATAAAGPKKPRRASAPPVAAANLGQDAQVRFINLKAWRAEVAREHNLPAYVIFH
FT                   DATLAAIAERNPSTLEDLQGISGMGAKKLEAYGAEVLRVCGAGAAAG"
FT   gene            complement(90425..91111)
FT                   /locus_tag="Ajs_0085"
FT   CDS_pept        complement(90425..91111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0085"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; PFAM: Radical SAM domain
FT                   protein; KEGG: rme:Rmet_5137 ribonucleoside-triphosphate
FT                   reductase, anaerobic-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40340"
FT                   /db_xref="GOA:A1W265"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A1W265"
FT                   /protein_id="ABM40340.1"
FT                   /translation="MPARTSHTAAEALRIGGITPLTTIDFPGRLAAVVFCQGCPWRCGY
FT                   CHNAGLLDAAAPAPHRWGEVEQLLHTRRGLLDGVVFSGGEPTLQAALPDALARVRALGF
FT                   ATGLHTAGMYPERLQALLPLLDWVGLDIKGPLAHYDAITRTPGSGDRAWESLRCVQASG
FT                   VDYECRTTWHAGLFDTAALQALAEDLAAQGVRQWVLQECSTPASVPWARTAPPTQWPLP
FT                   TSLRCA"
FT   gene            complement(91101..91292)
FT                   /locus_tag="Ajs_0086"
FT   CDS_pept        complement(91101..91292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_5138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40341"
FT                   /db_xref="GOA:A1W266"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:A1W266"
FT                   /protein_id="ABM40341.1"
FT                   /translation="MTHFSATENTALATAVQLTDAERQPCEVWTRVMGYHRPVASFNTG
FT                   KQGEHNERQFFAEPGRAC"
FT   gene            complement(91374..93410)
FT                   /locus_tag="Ajs_0087"
FT   CDS_pept        complement(91374..93410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0087"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; PFAM: ATP-cone domain protein; KEGG:
FT                   tbd:Tbd_2171 ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40342"
FT                   /db_xref="GOA:A1W267"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:A1W267"
FT                   /protein_id="ABM40342.1"
FT                   /translation="MTPPSPIVASLPRDVIQRNGERTPFDAVRIQSAIARAGQATGEFG
FT                   EDEARLLTAQATKVLIHRFHGEAPTIEQIQDVVEQTLIAANHLQTARAYMAYRQRHATL
FT                   RADRQTLVHVESSINEYLTRADWRVNANANQGYSLGGLILNVAGKVTANYWLSHVYAPE
FT                   IGEAHRNGDIHIHDLDMLSGYCAGWSLRTLLHEGLNGVPGKVEAGPPKHMSSAVGQIVN
FT                   FLGTLQNEWAGAQAFSSFDTYMAPFVRKDGMDYAAVRQCIQELVYNLNVPSRWGTQTPF
FT                   TNLTFDWTCPEDLREQVPVIGGVEMPFCYGELQAEMDVINRAYIDVMTTGDAKGRVFTF
FT                   PIPTYNITPDFPWESENAVALFDMTAKYGLPYFQNFINSELSPNMVRSMCCRLQLDLRE
FT                   LLKRGNGLFGSAEQTGSLGVVTVNCARLGYLHAGDEAALLAALDRLLELGKQSLEVKRK
FT                   LIQRLMDQGLFPYTKRYLGTLRNHFSTLGVNGINEMVRNFTGGAHDITSDWGHQFALRL
FT                   LDHVRARIVQFQEETCHLYNLEATPAEGTTYRFAKEDKKRWPAILQAGTEAQPYYTNSS
FT                   QLPVGFTDDPFEALQRQEALQGKYTGGTVLHLYMGERISSGAACRELVKRALTHFRLPY
FT                   ITVTPTFSICPTHGYLAGEHKFCPRCDEERLAAKRARLAARFE"
FT   gene            complement(93706..97032)
FT                   /locus_tag="Ajs_0088"
FT   CDS_pept        complement(93706..97032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0088"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: rfr:Rfer_0458 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40343"
FT                   /db_xref="GOA:A1W268"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033425"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1W268"
FT                   /protein_id="ABM40343.1"
FT                   /translation="MHPAHRQEFRQSLIWFAVLLVSLWMLKTLPAPDAARGMAGYLPLH
FT                   TAMEVVSIGVAAMVFSISWATQKYRPNGRVLVLGLGLLGVAVLDLTHSLSYAGMPDFVT
FT                   PSDPEKAINFWLAARALAALALLWAALWPHRWNEWLGRRSRYAGLLWVALLVGAVHYVL
FT                   LGHPQWLPRTFTPEAGLTPFKVRFEYALATAYVLAGVGFLTQLRHAREFGLSHLALASF
FT                   TMAMSEIFFTLYANVTDVYNVAGHFYKILAYGFLYRGLFVETVQIPYLDLRAAEARQRA
FT                   TLNTLPDLLFEVDRKGVYLAVHANETSKLLTPLPQLLGKTLDEALPPAAAAQCFEALAE
FT                   AERTGMSRGQRITLPLPLGERHFELSVSRKSAVAGQPDTFLMLSRDITPTVENEERIRS
FT                   EAGLNAVLLDLQQHDIHQPEADLLRRGLAHAQTLTGSALAVLYFVHDDARGTSLAACLH
FT                   ENAPPDMPPWETALRERRAVVTNAPHDAAAGRAPGGATARWACVPVVEGGRPRLLLGVA
FT                   GKARDYHPRDAQALQTVADALWKHTAQRRQEAVIHRLSEALDQSPSPVVITDIDASIVY
FT                   VNKAFSEVSGYGAQEVLGRNPRVLQSGLTPRTTYADMWTKLPRGLPWQGELINRRKNGQ
FT                   VYTENASLYPVRDVFGEVTHYVAHMEDITQRREAEERIRALSNYDTLTGLLNKKAFDEQ
FT                   LTQAIDRADASHERVSVLWFDLDNFKLVNETLGHAAGDELLLEMGNRLRACLAPHIPVA
FT                   RYSGDAFTAIVPLADQAAVALLAQDALAQLQTTLQIHGHAVSVSASAGIAVYPDDARTA
FT                   STLASAAEVAMYRVKQDGRNGLRFFAPEMQAHTQRSLELAAGLKDAAHRGELFLVFQPQ
FT                   RTLGSGALAGAEALLRWRHPRWGLVSPAEFIPIAEQSGSIVAIDFWVVEQVAQQLRAWD
FT                   AAGLPPLVVAVNVSAAQFARPHFVEELVRILQRMDISPQRIEVELTEAVALKNPEQAET
FT                   TIRRLHEVGFRVALDDFGTGYSSMSYLKRYAIDKLKIDQSFVRELAHQASDQAIVTAII
FT                   KMAHSLRMATIAEGVETAEQAALLQACGCDEMQGYWYSRPLEPAAFEAFVRNAQAGVEL
FT                   A"
FT   gene            complement(97384..98472)
FT                   /locus_tag="Ajs_0089"
FT   CDS_pept        complement(97384..98472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0089"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   mca:MCA2964 ISMca1, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40344"
FT                   /db_xref="GOA:A1W269"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A1W269"
FT                   /protein_id="ABM40344.1"
FT                   /translation="MRGSQDFQGAMFSYISLEERVPQAHPLRKLRAVVDALLATMNREF
FT                   EAVYARRGRPSVPPEMLLKALLLQILFSIRSERQLVEAINYNLLYRWFVGLNIEDKVWD
FT                   HSTFSANRERLFNEDLARAFFERVKLSAQWGKLASDEHFSVDGTLIDAWASHKSFKRKD
FT                   DDSGTPPGRNPEVDFKGQERCNDTHESTTDADARLFKKSQGDKSRLCHMGHILMENRNG
FT                   LIVDVEITHASGTAEREAALAMLERRGNRNKRATVGADKGYDSKAFIKGCRKLKVTPHV
FT                   AAKDKHSAVDARVTRHEGYKTSLKVRKRIEEAFGWIKTVGGLAKTKLIGQAKLTGQALL
FT                   CFATYNLVRMGSIGGWWDAHHA"
FT   gene            98635..99714
FT                   /locus_tag="Ajs_0090"
FT   CDS_pept        98635..99714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0090"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bxe:Bxe_A3516 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40345"
FT                   /db_xref="GOA:A1W222"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A1W222"
FT                   /protein_id="ABM40345.1"
FT                   /translation="MAHPGRPATKLQITDAERAELHARLRVRKAPEDEKLRMRIVLGCA
FT                   DGESGTMIAQRLGTTVQTVSKWRRRYRAYRLAGLTDAPRAGRPRSVGDEQVQLIVDKVR
FT                   QSKPDNATHWSVRQMSRHAGVSPATVQRIWHAFGLKPHLQETFKLSTDPHFVDKVRDVV
FT                   GLYMAPPDRALVLCVDEKSQIQALDRTQPGLPLTFGKPSTRTHDYKRHGTTSLFAALDV
FT                   ATGKVIGQLKRRHRSVEFLQFLKAIDAAVPGEQDIHLIMDNYGTHKTQAVRAWLAAHPR
FT                   YHVHFTPTSASWLNLVERFFSQISEQWIKRSAHTSVAQLEQSIREYIDRHNEDPKPFVW
FT                   HKSADTILASVARAASTII"
FT   gene            complement(99819..100244)
FT                   /locus_tag="Ajs_0091"
FT   CDS_pept        complement(99819..100244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0091"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: rfr:Rfer_0892 hemerythrin HHE cation binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40346"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:A1W271"
FT                   /protein_id="ABM40346.1"
FT                   /translation="MNIDRFKHEHRDILGQIATLRQLAHSGGEHNATAIAQGIVAMSST
FT                   IKLHLAVEDRLLYPALRQGADAELARLGEQFQREMGAIAAAYMDFARRWNTPERVRTDA
FT                   EGFRADANTVLRHVYERMQRENRDFYPRIEAEETLAH"
FT   gene            complement(100319..102625)
FT                   /locus_tag="Ajs_0092"
FT   CDS_pept        complement(100319..102625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0092"
FT                   /product="nitric oxide reductase, NorZ apoprotein"
FT                   /note="KEGG: reu:Reut_B5055 nitric oxide reductase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40347"
FT                   /db_xref="GOA:A1W272"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A1W272"
FT                   /protein_id="ABM40347.1"
FT                   /translation="MGKYAKHWYTLIGVLIVTFSLLGYYGAEVYRTAPPIPGKVLVQGS
FT                   DKPLYTKDSILDGQTAWQSVGGMQLGSILGHGAYQAPDWTADWLHRELTAWLDLAAQKD
FT                   YGKAFADLDVGQKAVLRDRLKTEYRANTYDKAADTVTITPLRAQAIAGTAAYYDKLFSD
FT                   DPSLHQSREHFAMKENTLPGAERRAQMAGFFFWTAWVAATERPADAGGHGATYSNNWPH
FT                   EPLVGNQPTGENMVWSIVSVVVMMAGVSFLVWGWAFLRKHDEQDPVPPQHDPLSRVALT
FT                   PSQHALGKYLFLVVALFCAQVFLGGFTAHYTVEGQTFYGIDVSRWFPYALVRTWHLQAA
FT                   LFWIATGFLAMGLFLAPVINGGKDPKYQKLGVDVLFWALVVVCVGSFIGNYFAIAQIMP
FT                   PEWNFWLGHQGYEYLDLGRLWQIGKFAGLAFWLVLMARAIFPALLAPNGQDKNLLALLT
FT                   CSVVCIGLFYGSGLFYGERTHISVMEYWRWWVVHLWVEGFFEVFATTALAFLFSTLGLV
FT                   SYRMATAASLASASLFMLGGVPGTFHHMYFAGTTTPVMAVGASFSALEVVPLVVLGHEA
FT                   WEHWSMQHKAEWMKRLRWPIMCFVAVAFWNMLGAGVFGFMVNTPISLYYIQGLNTTPVH
FT                   AHAALFGVYGFLALGFILLVLRYVRPQMVFNERLMKTGFWWLNAGLVLMIATSLLPIGL
FT                   FQFHASVTEGMWYARGEEFLQQPLLQTLRWVRTFGDLVFITGALCVTWQVVSGVLFAPR
FT                   APAAPSTGALAGANR"
FT   gene            102763..104385
FT                   /locus_tag="Ajs_0093"
FT   CDS_pept        102763..104385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0093"
FT                   /product="transcriptional regulator, NifA subfamily, Fis
FT                   Family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: GAF domain
FT                   protein; AAA ATPase; KEGG: rme:Rmet_3166 transcriptional
FT                   regulator, NifA subfamily, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40348"
FT                   /db_xref="GOA:A1W273"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A1W273"
FT                   /protein_id="ABM40348.1"
FT                   /translation="MVVMTINMLALSSAPEGLLPLCADMAAELPQAVRLQRLVDLLRTQ
FT                   FGCGAVALLRLEEERLRPVAVTGLVSDALGRRFAVGQHPRLAAILTRREVTCFEHDSQL
FT                   PDPYDGLLDTLVGEPLPVHDCMGVALHVEGRPWGVLTLDALATGTFGPAARQRLGQWVP
FT                   LVEAVVRVARLEQELRTLRMAATGPAEGDLALATPERGGAGELEIVGESPALKRLLHEL
FT                   SVVAASELPVLLLGETGVGKELFARLLHHQSPRRARPLVHVNCAALPESLAESELFGHV
FT                   RGAFSGAVSDRAGRFEAAEGGTLFLDEVGELPLSVQAKLLRTLQNGEIQRLGADRPRSV
FT                   HVRVIAATNRNLREQVASGAFRADLYHRLSVYPVPIPPLRERGNDVLVLAGRFLELNRA
FT                   RLGLRSLRLSPDAQAALRRYRWPGNVRELEHVISRAALKALSRGVDRNEIVTLEAGLLD
FT                   LDALDEPVATPRSDAPMAPAAGGALSLAAPTGTLRDAVDACQRQVLNAALVAHGGNWAQ
FT                   AARTLDVDPSNLHKLARRLGLKG"
FT   gene            104530..105579
FT                   /locus_tag="Ajs_0094"
FT   CDS_pept        104530..105579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0094"
FT                   /product="conserved hypothetical protein, conserved"
FT                   /note="KEGG: lma:LmjF35.0290 hypothetical protein,
FT                   conserved"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40349"
FT                   /db_xref="UniProtKB/TrEMBL:A1W274"
FT                   /protein_id="ABM40349.1"
FT                   /translation="MASSIDPPRPPLAPAVRVLAEAALQRQNWLLAAPAAPTPAGAAPA
FT                   GSAPTDAPPVPFSPNLLPPALPPIPAEPAGRERVSLSDQARQGLQAMAGGAVAPSRAPA
FT                   ASHGPAALSADAVADEGASARAAAIPAPWPAQGVGAPLLRLLNTLVQQLGPAGGAAPRV
FT                   LAAQPWPAGTDPAAGGTGLPALQIARVAQGMVYTPDGARGFTLTLRLPAAAMPALPSAP
FT                   TAPAALSVGFAGPPQALAPGLFALVLQGPGAAGQRTSGWLSLDLAPAPGAAAVVYGRDP
FT                   LQARTDPWLALAALQASGQSRVQEHDRAAEPPCSAPGCPYEGRAPCVQPFCLALRVQPA
FT                   PLAAPTGPG"
FT   gene            105662..107050
FT                   /locus_tag="Ajs_0095"
FT   CDS_pept        105662..107050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0095"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: pol:Bpro_4369 L-serine dehydratase 1; TIGRFAM:
FT                   L-serine dehydratase 1; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40350"
FT                   /db_xref="GOA:A1W275"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A1W275"
FT                   /protein_id="ABM40350.1"
FT                   /translation="MAVSVFDLFKIGIGPSSSHTVGPMRAARLFAQRLAREGVLAQVAR
FT                   VRSTLYGSLGATGRGHASDRAVLLGLAGHAPDTVEVDAIEPLIARIRSRRRLPLADGPE
FT                   VAFDEAADLLLVPDVTLPLHANGMRFEAFDAAGGTLAAQVYYSVGGGFIVSEEAAADAQ
FT                   RQAAIAPDTEVLPLPFHSGEQLLAQAAAQGGSIAQVMRVNERHWRTDAEIDAGLLTIWR
FT                   AMQDCVARGCSVGGVLPGGFQVRRRAPALHRALQNAPDTQQDPLQVIDWVNLFALAVNE
FT                   ENAAGGRVVTAPTNGAAGIVPAVLHYYWRFIPGATEGGVVDFLLTAGAIGILYKENASI
FT                   SGAEVGCQGEVGVACSMAAAGLCAVLGGTPAQVENAAEIGMEHHLGLTCDPVGGLVQIP
FT                   CIERNALASVKAINAARMALHGDGTHHVSLDQVIKTMRETGADMMTKYKETSRGGLAVN
FT                   IVEC"
FT   gene            107110..108318
FT                   /locus_tag="Ajs_0096"
FT   CDS_pept        107110..108318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0096"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   bam:Bamb_1377 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40351"
FT                   /db_xref="GOA:A1W276"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1W276"
FT                   /protein_id="ABM40351.1"
FT                   /translation="MHNPASPTDTLLPALARPAIQSLGGSLIREVANTDMGRADVLPFW
FT                   FGESDQPTPQFIRDAAAQSLGSGETFYSQNLGRPYLREAIAQYLSDLHGREVSPQRIGA
FT                   VASGDAGLMLTCQMLLSPGDRVVAVTPLWPNLLEMPRILGAQVERVPLAVRGGRWTLAL
FT                   DRLLDALTPGTRMLILNSPNNPTGWTIDEESLVAILAHCRRHGIWILSDDVYERLVYDP
FT                   QLASAPSFLRHYAPGDRIISVNSCSKAWCMTGWRAGWMVVPEALEADLGKVIEYNFSCI
FT                   FEPVQRAATVALQQGEAHVAQLRAGLVESRRLLVQALRAVPGVEVPDAGGAMYVFFRLA
FT                   GFDDSLALAKHLVSEVGLGLAPGAAFGPEGEGWLRWCHAVSDGARLREGVERLARFVQR
FT                   ATA"
FT   gene            108498..109448
FT                   /locus_tag="Ajs_0097"
FT   CDS_pept        108498..109448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0097"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   rme:Rmet_5058 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40352"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W277"
FT                   /protein_id="ABM40352.1"
FT                   /translation="MPLRSHLLALCLTALPLATWAAWPERPITIVVPAAAGGTTDIAAR
FT                   VLAEKMAKDLGTSIVVENKGGGGGSIGTAQVARAKPDGYTLLMGNIGPVAINFSLYKQL
FT                   SYKESDLRGITNVISVPNILVVHADSPVRSAQELVSLAKTRRLNVSTSGVGQSPHMSSE
FT                   MFRQKSGIEVTLVPYPGAAPAVTALLGQQVDFMIDNLPSSMPHIKAGKFRALAITSAER
FT                   SAQLPDVPTMAEAGVPMQVTAWFGLLAPTGTPDAVVERLQQSARKAMQTPEVRQRFAEM
FT                   GGVPGGETPAEYDAFIAQERKSWAQIVKAAGLSLE"
FT   sig_peptide     108498..108563
FT                   /locus_tag="Ajs_0097"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            109495..111063
FT                   /locus_tag="Ajs_0098"
FT   CDS_pept        109495..111063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0098"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   reu:Reut_A1913 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40353"
FT                   /db_xref="GOA:A1W278"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1W278"
FT                   /protein_id="ABM40353.1"
FT                   /translation="MHPDIEHLLAQPFGSLPELIERQAAHRPGHTALVLEGQRLDYAAL
FT                   HAGMDRVARSLQRDGMQPGDVVAICAGTSVEYVLAYLGALRAGVAVAPLAPSATAEHLS
FT                   AMLDNCGARLVLRDREVAAQWPLHAGAALRCVALDDAPEAGEPWSQWLVQGDGAPAPIT
FT                   PAPDWPFNVIYSSGTTGVPKGIVQSWAMRWAHVRRAVTNGYGPDAVSLCATPLYSNTTL
FT                   VAALPTLALGGTLVLMRKFDATRYLALAQQHGATHTMLVPVQYQRLMACPDFDRTDLSR
FT                   LQHKFCTSAPFSAALKAEVLRRWPGRLIEYYGMTEGGVRCELHCHDFPHKLHTVGRPGE
FT                   GADIRFIDEQGRELPAGEQGEIVGRSAGMMSGYYRLPDKTREAEWFDAEGRRYIRSGDV
FT                   GRLDADGFIVLGDRKKDMIITGGFNVYPSDVEAVLCQHPQVAECAVVGVPSEQWGETPV
FT                   AYVVGRSGSQPTAEELREWLNTRVGKTQRVADLRLVERLPRSEIGKVLKRTLREQYLQA
FT                   EPIAG"
FT   gene            111091..112086
FT                   /locus_tag="Ajs_0099"
FT   CDS_pept        111091..112086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0099"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   rme:Rmet_5061 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40354"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W279"
FT                   /protein_id="ABM40354.1"
FT                   /translation="MSLPRPSRLRRALLASMALTASALLAPVAYAADAWPAKPIQLVIP
FT                   YPPGGSADLLGRPLAMQLQQQLGQPVVLEYKPGAGGTLASQYVARAKPDGYTVFMVLAA
FT                   HAINDSLYPKLPYDTRKDFAPVSLVANLPMVVAASGKLPAKNIHELIQAAKAAPGKLTF
FT                   GSAGNGNTGHLAAEYFSSIAGVKMTHVPYKGSAGVVNAMLAGDIDLTFDSISTSMPHIR
FT                   GGRMHALAVTSPQRSALAPEVPTVQEQGIAGFDVTGWYALIAPAGTPPEITQRLSREIA
FT                   AALRQPQLQSQLAAGGYEPVGSTPEALQAHIEREITRWAAVVKSTGARVD"
FT   sig_peptide     111091..111186
FT                   /locus_tag="Ajs_0099"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            112249..112716
FT                   /locus_tag="Ajs_0100"
FT   CDS_pept        112249..112716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0100"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: reu:Reut_A0210
FT                   phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40355"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1W280"
FT                   /protein_id="ABM40355.1"
FT                   /translation="MQQPSSITANIPLSPFAGEAPDMFFGLPMAMARAMALRGERIGHD
FT                   MAQVRMRFQADQANSRGEVHGGSIATLLDCTLASAARAHDPAAYGVATIDLTLHYVAAG
FT                   RGDLIATARCERRGRSISFVRGEVRAEDGTLVAMATGSFKLIARSTASASA"
FT   gene            complement(112744..113763)
FT                   /locus_tag="Ajs_0101"
FT   CDS_pept        complement(112744..113763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0101"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   reu:Reut_A0242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40356"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W281"
FT                   /protein_id="ABM40356.1"
FT                   /translation="MKHEAHPLGWNRRHLLALAAATAAAGPLGARAQAAPAGFATRPVR
FT                   VVVPFAAGGATDVIARILGERMAQRFGQSVVVDNKPGAAGLIAGEMVAKAPPDGMTALL
FT                   GTTSSMLTNKYLYKKTPYDPLTELTPLVRVCLAPIALVVTADTPAQNLQDFMAWIRSQK
FT                   GKLTYGSYGIGSHGQLACTTLSEVAGADMTHVAYKGEAPMVQDLLGGQIKIGMGSLLSL
FT                   KAHVDAGKLRALAVTGPRRVPLLPEVPTFTEAGYPQDALSIVGWLAIAGPKAMPADVAR
FT                   QWAQAANHAVASREGLARIIAAGFVPVDDDTPEKFARLWAQEAPVWGRLLQAAGVQPS"
FT   sig_peptide     complement(113665..113763)
FT                   /locus_tag="Ajs_0101"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.752 at
FT                   residue 33"
FT   gene            complement(114003..114989)
FT                   /locus_tag="Ajs_0102"
FT   CDS_pept        complement(114003..114989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0102"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   rme:Rmet_4501 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40357"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W282"
FT                   /protein_id="ABM40357.1"
FT                   /translation="MAFTRRKTLGQWLPLIALAATCGVGAAQAQDHYPSKPIRVIVPYP
FT                   AGGGTDIIARLIGTQLSQRLGQAVVVENKPGASGILGNDTVAKAPGDGYTVLMGITTVV
FT                   QIPALYKKVPYKLSDLAPVSQVAKSADLLMVPRSSGVTTLQQFVDKAKAAPGTLNFGSY
FT                   GNATSSHMNGERFKQKAGIDITHIPYQGSGPEMAAMLGGQLSLAFVDATAAYPHIKSDK
FT                   INILAITGAQRHPALPQVPTMTEAGYPGLEANGWFGMFVPAATPKTIVDKLGSEVSSIV
FT                   KSPELNKRLTEMGLIPVGSLPDDFKAQIDKDAAHWKAVAEAAKISMD"
FT   sig_peptide     complement(114900..114989)
FT                   /locus_tag="Ajs_0102"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 30"
FT   gene            complement(115034..116188)
FT                   /locus_tag="Ajs_0103"
FT   CDS_pept        complement(115034..116188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0103"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bxe:Bxe_C0602 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40358"
FT                   /db_xref="GOA:A1W283"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1W283"
FT                   /protein_id="ABM40358.1"
FT                   /translation="MQDLIQRTVYREDHEHFREQVRRFFEKEVVPFHADWERQGIVPKE
FT                   VWRKAGREGLLNTMLPEPYGGGGDFGHAAVLIEEVGRTNATGLGFPLHSDIVAPYINTY
FT                   GTKAQKDRWLPRMAAGELIGAIAMTEPGAGSDLKSVRTTATLVKSSEGDHYVINGSKTF
FT                   ITNGINSELVIVVAKTAPELGAKGVSLIVVEEGTPGFSKGRKLEKIGLMAQDTSELFFD
FT                   NVRVPVDNLLGEPNMGFKYLMHELAQERLVVAVRAASCIETFLQKTIDYTRERKAFGQP
FT                   VFDFQNSRFKLAEAKAQATMLRTFVDECMKLHMQRKLTPERAAMVKLNATALQNKLLDE
FT                   FLQLHGGYGYMTEYQVGRAWTDARIGRIYGGSDEIMKEIIARTL"
FT   gene            complement(116267..117841)
FT                   /locus_tag="Ajs_0104"
FT   CDS_pept        complement(116267..117841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0104"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rme:Rmet_5158 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40359"
FT                   /db_xref="GOA:A1W284"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1W284"
FT                   /protein_id="ABM40359.1"
FT                   /translation="MQDFFGRAAAAPDRVVLVMAETGARFTAGEVAQRALAMAQWLHTQ
FT                   GLQAGERFAVVLENRVEILALALAARQAGLYAAVLSTHLTPAEVAYIVQDCGARLVVAS
FT                   AKTLPQLAELQAHHPLPCWTVDEAPAQVTSVQAPSLQAALDALQGPPADFADRPLGRDL
FT                   LYSSGTTGRPKGVLKPLWPAHLRGQTDPEALGTARIMGMGEDTVYLSPAPLYHAAPLRY
FT                   TLRVLELGGQAVIMERFDTETALALIERYRVTHSQWVPTMFGRMLKLPGAVRRRYDLSS
FT                   HRVAIHAAAPCPVDVKHAMLDWWGDILMEYYAGSEGCGTTMINSSEWRQRPGSVGRPTT
FT                   GRLHIVGDDGQELPAGEIGQVYFSGGGQFSYLNDEEKTRQAINERGWITYGDIGHVDAE
FT                   GYLYLSDRRADLILSGGVNLYPQEIENALARHPGAQEVAVVGVPHPDFGEVPMAAVVLR
FT                   PGADESPQTARAIAEQAAEVLARMKLPQRMVFVDALPRLETGKLLRRKLKERFRDEPQA
FT                   GFALRSS"
FT   gene            118051..119229
FT                   /locus_tag="Ajs_0105"
FT   CDS_pept        118051..119229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0105"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: rme:Rmet_5156 thiolase; TIGRFAM: acetyl-CoA
FT                   acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40360"
FT                   /db_xref="GOA:A1W285"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1W285"
FT                   /protein_id="ABM40360.1"
FT                   /translation="MNIPVIVDAIRSPMARAKPDGALAEVHPVDLLSQVLEQLVARNQL
FT                   DPGTVDDVICGCVSQAGEQAGTPGRLAWLAAGLPAHVPSTTIDRKCGSSQQAVHFAAQA
FT                   IMAGTQDIVIACGVESMSRVPMGSSRMGKNTTGPRFDARYAPGLVGQGVSADLVAAQWG
FT                   LDRTALDTYAARSHQRAHAAQSSGGFAREIVGIDTPAGRVTADETIRAGTTVEKLAGLK
FT                   AVFENEELSARFPQIQWATTAGNASQMTDGASAMLIMSEERAQQLGLRPRARFVAFDVV
FT                   GDDPLYMLTAPIPATQRVLAKAKMKLDDIHHYEINEAFASVPLAWQKELKADGERLNPR
FT                   GGAIALGHPLGASGLRLMTTMLHALEDSGQRYGLQSMCEAGGMANATIIERL"
FT   gene            119295..120062
FT                   /locus_tag="Ajs_0106"
FT   CDS_pept        119295..120062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0106"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   reu:Reut_A1668 NAD-dependent
FT                   epimerase/dehydratase:short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40361"
FT                   /db_xref="GOA:A1W286"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W286"
FT                   /protein_id="ABM40361.1"
FT                   /translation="MKLQQGMTALVTGGVSGLGEASAVALLERGLNVVAVDLNDERGQA
FT                   MEQQYAGRLRYVKADVSDEGQMQQAIAAAEAFGNFRALVHCAGIGGPVRLIEKDGSPGS
FT                   LEKYINIIRVNQIGTFNTLRLAAVAMAKNEPIDGERGVCVLTASVAGYEGQIGQIPYAS
FT                   SKAGVIGMTIVAARDLASKFIRVCTIAPGLFDTPILAKLPEAVRQSLAASVPHPARLGH
FT                   PSEYALTALHILENPMLNGETIRLDGAIRMAPR"
FT   sig_peptide     119295..119366
FT                   /locus_tag="Ajs_0106"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.685) with cleavage site probability 0.334 at
FT                   residue 24"
FT   gene            120249..121013
FT                   /locus_tag="Ajs_0107"
FT   CDS_pept        120249..121013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0107"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   reu:Reut_A1667 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40362"
FT                   /db_xref="GOA:A1W287"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1W287"
FT                   /protein_id="ABM40362.1"
FT                   /translation="MTSTVLVEVRGNVQIMTLSNPEARNAATLEMAEAMVAALDALDSN
FT                   PALQVGIVTGAGGTFCAGMDLKGFLQGKRPSIAGRGFCGLTQKPPRKPLIAAVEGYALA
FT                   GGFELVLACDLIVAARTAKFGLPEVKRGLAATAGGLLRLPKRLPYHVAMECILTGDMFG
FT                   AERAQAHGLVNRLVEPGQALDAALELAQTVAANGPLALIASKRVAQESADWPQAEMFDR
FT                   QAVITAPVFASQDAREGATAFAEKRPPVWQGV"
FT   gene            121113..122111
FT                   /locus_tag="Ajs_0108"
FT   CDS_pept        121113..122111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0108"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   rme:Rmet_5153 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40363"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W288"
FT                   /protein_id="ABM40363.1"
FT                   /translation="MPFHHHRQALRLAGASALLGLAALTASHPARADAAWPTRPITFVV
FT                   PGAAGGTTDTPVRFMAQKLSERLGQPIVVDNKPGAGGSLGSSLVARAPADGYTVLVGNT
FT                   GSNAINYTAYQKLPYKAEDFVALTDMISFANVLVVPVKSPIKSLKELVTTAKREPGKLA
FT                   FSSAGVGQTTHLMGELLRQSAGVDVVHVPYKGSAPATMAIVAGETQFMFDNLTGSLGHV
FT                   KDGKLRALAVTGATREPELPDVPTMTELGMKDFDKVGWMGFFVPAKTPPAVVKKLTDNL
FT                   IAVLQDPAVVQRYRELGGRPGGMPPEQFSQMVERDRQEWGALIRSQKLQLD"
FT   sig_peptide     121113..121211
FT                   /locus_tag="Ajs_0108"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 33"
FT   gene            122124..122930
FT                   /locus_tag="Ajs_0109"
FT   CDS_pept        122124..122930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0109"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: sde:Sde_2377 oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40364"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W289"
FT                   /protein_id="ABM40364.1"
FT                   /translation="MAESSSFAGRHVFVAGGTSGINLGIAQAFARAGAHVVVMSRSPDK
FT                   VQQAAEGLRALGAQALGISADVRDPAAVDAALRQAHAQFGDIDVLISGAAGNFIAPAAD
FT                   LSPNGFKTVIDIDLNGSFHVLRLAYPMLKKPGASVINISAPQGVNPTMYQVHACAAKAG
FT                   IDMMTRVLAMEWGEVGVRVNAIAPGPIGDTEGMRRLAPTPEALANAVATVPLQRMGTLD
FT                   DIANMALFLSSPQAGYVTGAVIPVDGGSSLRGGRDMRASYVPRSAA"
FT   gene            122927..123721
FT                   /locus_tag="Ajs_0110"
FT   CDS_pept        122927..123721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0110"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   reu:Reut_B3551 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40365"
FT                   /db_xref="GOA:A1W290"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1W290"
FT                   /protein_id="ABM40365.1"
FT                   /translation="MSQVYERIVFEVQDGVATLTLSNPTKRNAFDPAMRVEMAAVVRQV
FT                   QADPAIRALVLTGAGAHFCSGGDLSNIAASGLDNGGWRQRLSCLHDWLKDLMLLDKPVI
FT                   AAVDGAAYGAGFSLALAADFIIASTRARFAMSFIRVGVVPDCAAFYTLPRVVGVQRARE
FT                   LMLSGREVQADEAMRLGIATELVEPEALQARAQAIARSFVGASPVALSLIKRSLALAAS
FT                   DLPSLLEQEANAQALAMGTPEHREAVRCFLEKRPMPFQWPQT"
FT   gene            123762..124550
FT                   /locus_tag="Ajs_0111"
FT   CDS_pept        123762..124550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0111"
FT                   /product="regulatory protein, IclR"
FT                   /note="SMART: regulatory proteins, IclR; KEGG:
FT                   rme:Rmet_5157 transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40366"
FT                   /db_xref="GOA:A1W291"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W291"
FT                   /protein_id="ABM40366.1"
FT                   /translation="MNVNADPDGKLVSALVRGVSILRCFSNKTQELSAKELMDLTGLPK
FT                   PTLFRLTDTLCELGLLRYSERLSKYVPGLGLLQLSSPVLTRMALRQFARPHMQALADLT
FT                   EGQVQLAVGHKRRLCMVELANGMGNTVFRQEIGVPISLSRTATGRAYLLGMAEDERKAY
FT                   LQDLQRNEPQRAAWLEQRLTDARDDFARHGFCRSHGDLHREIESIAVPMSQPQDGELWV
FT                   FAASVPVFSPMYARLETDLGPRLRTLVRSVESVLGASGLT"
FT   gene            124594..125706
FT                   /locus_tag="Ajs_0112"
FT   CDS_pept        124594..125706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0112"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rme:Rmet_2536 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40367"
FT                   /db_xref="GOA:A1W292"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1W292"
FT                   /protein_id="ABM40367.1"
FT                   /translation="MKVLDSVRVLEIGGLGPGPFCAMHLADLGADVISVVRETKGRETT
FT                   GALLNRGKRSVFADLKTEEGRQLVLALVAEADALIEGMRPGVMERLGLGPEECMAVNPR
FT                   LVYGRMTGWGQSGPLAPRAGHDTNYAAVSGALWGCSPADARPVSPFAVLGDIGGGAMYL
FT                   MTGLLSGIVQARATGRGTVVDAAIVDGSAHMLNLMLSARQSGLVADVRGQSIHDSAPFY
FT                   DTYVCADGHYVTVGAIEPQFYTLLLQVLGLAEDPDFTGSQWDKAAWPVRRARLAALFLA
FT                   QPRAHWQALLEPTDACFGVVLSPVEAAQHPHMRARGVYSERQGVLQAAPAPRFDGAAYE
FT                   PGEACAPGAHTQSVMEGLGQSGARAVWRQR"
FT   gene            complement(125743..126966)
FT                   /locus_tag="Ajs_0113"
FT   CDS_pept        complement(125743..126966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0113"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:bll2700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40368"
FT                   /db_xref="GOA:A1W293"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1W293"
FT                   /protein_id="ABM40368.1"
FT                   /translation="MRLSRTQPLWVMLLTLLSGFALSQAYRTTTAIVAQGLQADFGLQA
FT                   SSLGAFAGLFGLSFGIAQLLMGIALDRYGLRRTVLVAAPLGIAGAALSALAPSYGWLMV
FT                   GQVLIGVGYSPAFVACTLFIARYFAADRFAFFSGLSMGLGGLGLLFTGTPLAWVVQHWG
FT                   WRAGFGLLAGLSLLSWLLIYALVHEPARADTAHRPASSWGEALTGMGRLFTVPHTWGIV
FT                   ILGMSCYAAFLSLRGLWLGPLLIDRYGFSLVDSGNVALVLSLIALFTPAAFGRMDPGPA
FT                   RRRTWVGRASLSMAGLFAIMAWVNNAHAMVALMIAMGLLSGYSILQYADVRSSYPNEQT
FT                   GRALSLYTMAMFLGVALMQSLTGAVAAWATSAGLEPYRAVLLCIAAWLALASLAFRLLP
FT                   ASALLQQR"
FT   sig_peptide     complement(126895..126966)
FT                   /locus_tag="Ajs_0113"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.760 at
FT                   residue 24"
FT   gene            complement(127049..127918)
FT                   /locus_tag="Ajs_0114"
FT   CDS_pept        complement(127049..127918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0114"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: pol:Bpro_0580
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40369"
FT                   /db_xref="GOA:A1W294"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1W294"
FT                   /protein_id="ABM40369.1"
FT                   /translation="MSDPVQQACSFLFVPATQPERLPKALASGADLVIADWEDAVAPAD
FT                   KERARTALADALATLPAPQRARLLVRINSEATPWFAADLQALAQLTAQGLAGAVVPKAE
FT                   RAQTLQAVAQAAGLHAALVPLVESVAGLAAADALATAPQVARLAFGHLDFQVDAGMACA
FT                   EDEQELLPVRMALVLASRRAGLAAPIDGVTVDTRNPERMGRDAERARRMGFGGKLCIHP
FT                   AQVPVLHAAFDPDEAAVTHAQRVRQALEQAGGGVCVLDGRMVDAPVLAQAEQTLLRHAR
FT                   ALQRLARV"
FT   gene            complement(128112..129119)
FT                   /locus_tag="Ajs_0115"
FT   CDS_pept        complement(128112..129119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0115"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_0579 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40370"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W295"
FT                   /protein_id="ABM40370.1"
FT                   /translation="MTAPFTPTSRRAAFGAIAAACAALALGGNALANTWPEKNITLVVP
FT                   YSAGGPTDVVARLLAVPMGQSLGQTVVVENTVGAGGTLAPARIVRSKPDGYTILIHHMG
FT                   MATAPALYKKLPYDPLKDFEYVGQVLDVPMTLLSRKDFPANNFQELQDYVKKNQDKVSL
FT                   ANAGIGAVSQLCGMLFMHQLGVKLTTIPYKGAGPAMNDLMGGQVDLLCDQTTQTAPVIQ
FT                   DGKRVKVFGVTTPQRLSSMPNIPTLDEQGLKGFDVKVWHGMYAPKGTPKDVIEKLNKAL
FT                   NVAIKDENVKKRIAELSSDLVSPDKATPEGLRKHLAAEVARWDKVIKAAGVSAE"
FT   sig_peptide     complement(129021..129119)
FT                   /locus_tag="Ajs_0115"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 33"
FT   gene            complement(129285..130649)
FT                   /locus_tag="Ajs_0116"
FT   CDS_pept        complement(129285..130649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0116"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: pol:Bpro_0581
FT                   MmgE/PrpD"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40371"
FT                   /db_xref="GOA:A1W296"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A1W296"
FT                   /protein_id="ABM40371.1"
FT                   /translation="MKQETQAAIHPLAQFAATLQWSDVPAPVQRRTEDLWVDWFGSVLA
FT                   GCRARPVASITRFALSQGPASGPAEVIGHGATSSPMMAALANAAASHVAEQDDVHNGSV
FT                   FHPAAVVFPPALAVAQSIGASGAQLMAACVAGYEVGIRVGEFLGRSHYKVFHTTATAGT
FT                   LAAAAAVGRLLELTPAQMQHAFGSAGTQSAGLWEFLRTAADSKQLHTAHAAAAGLMAAY
FT                   LAQDGFTGAQDIFTGPQGLAAGMSSDANPAKLTEGLGTRWATAETSFKWHASCRHTHPA
FT                   ADALQQVMREHGLAPADIAQVTCHVHQGAIDVLGPVVSPTTVHQSKFSMGTVLALAARF
FT                   GHAGLTEFDEQFLAPDTVTLREKVRMVLDPEVDAAYPQRWIGKVTVQTTDGRTLAGRVE
FT                   EPKGDPGNTLSREELTAKALRLAAYGGAVPAAQAQAAVQRLWQVQDWPRTPHLLG"
FT   gene            complement(130700..131890)
FT                   /locus_tag="Ajs_0117"
FT   CDS_pept        complement(130700..131890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0117"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: pol:Bpro_0582 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40372"
FT                   /db_xref="GOA:A1W297"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1W297"
FT                   /protein_id="ABM40372.1"
FT                   /translation="MNPNIRPLDGITVVSLEHAVAAPFCTRQLADLGARVIKVERPGSG
FT                   DFARGYDQRVRGQSSHFTWINRSKESLALDVKQPQAKAALLQLLKTADVLVQNLAPGAA
FT                   ARMGLSYEALKAHNPKLIVCDISGYGADGPYRDKKAYDLLIQSEAGFLSVTGTPETPSK
FT                   SGISVADIAAGMYAYTNILSALLLRGKTGEGSHIDVSMLEAMGEWMGYPMYYAHDGAPP
FT                   PPRTGASHASIYPYGPFAAGDGKTVMLGLQNEREWKAFCDTVLQRPEVATDARFCSNAQ
FT                   RNAHRDALQALILQEFSTLSAAQVVERLEAAGIANARVNDMADLWAHPQLAARQRWRTV
FT                   GTPAGAVPALLPPGVNSAFDYRMDAVPAVGQHNAAILAALGWSAEQIDALQAPQSV"
FT   gene            complement(132084..133244)
FT                   /locus_tag="Ajs_0118"
FT   CDS_pept        complement(132084..133244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0118"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bur:Bcep18194_C7297 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40373"
FT                   /db_xref="GOA:A1W298"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1W298"
FT                   /protein_id="ABM40373.1"
FT                   /translation="MIHQPDQYQEIRDAVRALCAQYPDEYFRKVDEARAYPEAFVDALT
FT                   QAGWMAALIPQEYGGSGLTMAEASVIMEEINRSGGNSGACHGQMYVMNAIVRSGSEAQK
FT                   QKYLPKIASGELRIQSMGVTEPTTGSDTTKLKTSAVKKDGRWVINGQKVWISRIQHSDL
FT                   MILLARTTPADQVKKRSDGLSCFLIDLHQAIGNGLTVRPILNMVNHETNELFFDNLEIP
FT                   EDALLGEEGKGFKTLLDGLNAERTLIAAECIGDGYWFIDRASKYAKERVVFNRPIGQNQ
FT                   GVQFPIADAFIELEAANLMRWKACEKIDAHQNAGAEANMAKYLAAKASWEAANVCLQTH
FT                   GGFGFACEYDIERKFRETRLYQVAPISTNMIYSYVAEHILGLPRSF"
FT   gene            complement(133316..134221)
FT                   /locus_tag="Ajs_0119"
FT   CDS_pept        complement(133316..134221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40374"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A1W299"
FT                   /protein_id="ABM40374.1"
FT                   /translation="MATMTEPTIDTAQLAHLQTWQGQSETLSDTLTATPIAALSATLDR
FT                   DDPAPAPGTTVPPLWHWLYFLPHARQSEIGPDGHPKRGGFLPPVPLPRRMWAGGRLRWE
FT                   MQGDGANPLQVGQQVQRTSTIQSVKHKAGRSGELLFVLVEHQYRNAQGLALTEEHDIVY
FT                   RSAAQPGDPAPTPQKPPLEGQAAWSRTIVPDAVLLFRYSALTFNGHRIHYDRKYVTEVE
FT                   GYPGLIVHGPLIATLLLDLLRRSLPGAQVLTFDFRAVRPTFDLHPFSVHGRPSSDGKSV
FT                   ELWAQDHEGWLTMQGTATLA"
FT   gene            134415..135332
FT                   /locus_tag="Ajs_0120"
FT   CDS_pept        134415..135332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0120"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: bja:bll6372 probable short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40375"
FT                   /db_xref="GOA:A1W2A0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2A0"
FT                   /protein_id="ABM40375.1"
FT                   /translation="MAQKMVQDKVVVVTGAGGGIGRDMALALAAAGAKVVVNDIGTSTT
FT                   GEGTDAGPAQKVVEEIKAAGGQAVANMDSVAEAAAAGRIIQCALDHFGRIDGVVNNAGI
FT                   LRDRFFHKMSLDEWDAVLKVHLYGSYYMSRAAANHFKEQESGAFVHMTSTSGLIGNFGQ
FT                   ANYSAAKLGLVALSKSIALDMQKFHVRSNCIAPFAWSRMIGSIPTDTPEQQARVAKIQQ
FT                   MTPNKIAPLAVYLLSDQAQDVNAQVFAVRNNEIFLMSQPRPLRSVHRSEGWTPEFIAEH
FT                   GMPALKASFVPMERSGDVFSWDPV"
FT   gene            135595..136488
FT                   /locus_tag="Ajs_0121"
FT   CDS_pept        135595..136488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0121"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   rme:Rmet_3807 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40376"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2A1"
FT                   /protein_id="ABM40376.1"
FT                   /translation="MAIDYQHLKSRVFTPVRQHYTERDTMLYALSLGLGNDPLNASALP
FT                   FVYEGLEGGLRALPSQAVVLGYPGFWAREPDTGIDWVKLLHGEQRMRLHRPLPASGEVV
FT                   GHNRITHLTDKGEGKGAIMVTERRLETAAGELLATVQQVTFLRGDGGYSQQGGGQPSDA
FT                   PLPALQPTPQDRAPDFTDTQPTRPEAALLYRLMGDYNPLHADPAVAAKAGFERPILHGL
FT                   ASYGLVAHALLRQCCGGDPARLKALDIRFAAPVYPGETLVTEIWRVPGQPTQVQLRARV
FT                   LERDKVVLSHGFAELA"
FT   gene            136567..137361
FT                   /locus_tag="Ajs_0122"
FT   CDS_pept        136567..137361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0122"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bbr:BB4711 probable enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40377"
FT                   /db_xref="GOA:A1W2A2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2A2"
FT                   /protein_id="ABM40377.1"
FT                   /translation="MSAPPVLTSVQDGIGTITLNRPEARNALNQAMRPALAAAIAQMRD
FT                   DAQVHAVILTGAGGAFCSGGDISAMLDTSRTGLAFRKGMRELHQWFPELVNLEKPVIAA
FT                   VDGPAFGAGLSLALAADFVLATRRAKFCAVFGRIGLIPDLGAMHLLPRIVGQQKAKELV
FT                   FTARTVDAEEAKQLGMVFDIVDDATALTEAALALAQRFGEASTAAIGMAKTIMNQSFES
FT                   DARTIAELESYAQSVCRGSDYHQDAVRRFKDKQPLRFDWDRK"
FT   gene            137494..138819
FT                   /locus_tag="Ajs_0123"
FT   CDS_pept        137494..138819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0123"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   bpa:BPP0600 acetyl-CoA hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40378"
FT                   /db_xref="GOA:A1W2A3"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2A3"
FT                   /protein_id="ABM40378.1"
FT                   /translation="MGCGWRAAPWMTDMSALAERLQALIRPGDTLWWGQATAEPLTLTR
FT                   AVVQQRHALAQGGRLRVFVGIGASDTLQPGQADAIDFFGYAAGGPHRALAQAGVLDILP
FT                   SHYSHLPGLIRAGVLPADVVLLQVSPPDAQGRYSLGLVQEYLPAAIERARVVIAEVHPD
FT                   VPWTHGGLHLQASDFALLIDAEHPPLDQSRSAPGPVEQAIARHVAGWVEDGATLQLGIG
FT                   NLPEAVLAALHGHRDLGLHSGAVGDGIAALAEAGVLTNARKSLDTGVGIGGILMGGEKL
FT                   RRWAHRNPQIELRGTDYTHDPEVLAASHKLTAINAAIEVDLTGQINAEVAAGCYVGAVG
FT                   GAVDFLRGAARSKGGLPIVALPATAKGKTRIVAQLSGPVSTPRSDAGLIVTEHGVADLR
FT                   GQTLSRRVRRLIDIAAPEHREDLERQAHETLRHCGAAFSQTL"
FT   gene            138883..140091
FT                   /locus_tag="Ajs_0124"
FT   CDS_pept        138883..140091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0124"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: bbr:BB0614 putative thiolase; TIGRFAM:
FT                   acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40379"
FT                   /db_xref="GOA:A1W2A4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2A4"
FT                   /protein_id="ABM40379.1"
FT                   /translation="MRRAAIVTPVRTPVGTFGGSLRPVPVEELAATTVRAVVERSGIDP
FT                   ARIDDVVMAQSYANSEVPCVGRWAALQAGLPVSVPGMQLDRRCGGGLQAIVTASMMVQS
FT                   GAADVVIAGGVESMSNIEYYSTDMRWGARSGNVRFYDRLDRGRERSQPVERFGKISGMI
FT                   ETAENLARDYGITREEADAFALRSHQRAAAAWEAGRFADEIVPVQVPQRKGEPVTFARD
FT                   EGFRADVTPESLGKLRVLMPNGTVTAGNASQQNDASAACLIVAEDKLAELGLTPMATLV
FT                   GWAAAGCEPSHMGIGPVPAVKKLLARLNLRIDDMDLVELNEAFACQVLAVLKGWEWQDQ
FT                   DAIAHKLNVNGSGISLGHPIGATGVRILATLLHELQRRKGRYGLETMCIGGGQGIAAVF
FT                   ERV"
FT   gene            140351..141325
FT                   /locus_tag="Ajs_0125"
FT   CDS_pept        140351..141325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0125"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   rme:Rmet_3797 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40380"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2A5"
FT                   /protein_id="ABM40380.1"
FT                   /translation="MPASRRLATAALALAPFAFALPAAAQDGQPVRLIVGYAAGGPVDQ
FT                   GARLFAPALSKELGMPVMVENKTGANATIAGSEVVRSKPDGMTLWFAASPTITISPNVM
FT                   TKMPFDPAKDLTPVAPILSYYNVLVVNNNEPYKSVRELVATAKSNPGKLAYGSAGVGGS
FT                   NHLGALLFAKRSGIEMNHIPYKGNAPAMTDVIGGQLNMMLDIISTASAYIHSGKVRAVA
FT                   VTSPQRNASLPDVPTFAESGIDGLKGFDVGGWYGVYGPKGMSPELVAKLNKAVNAALQQ
FT                   PELKKRYKELGYDEWTGSPQKLAERAAKERAMWATVTQGITVD"
FT   sig_peptide     140351..140428
FT                   /locus_tag="Ajs_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            141327..142841
FT                   /locus_tag="Ajs_0126"
FT   CDS_pept        141327..142841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0126"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rme:Rmet_3802 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40381"
FT                   /db_xref="GOA:A1W2A6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2A6"
FT                   /protein_id="ABM40381.1"
FT                   /translation="MAERIHHLLDRWLAEAPARPFIHLPDGRSLSFADLGALTDTAEAE
FT                   LRALDVRPGDRVLVVAENCPEHAALILACSRVGAWSCGVNARMAPAEIDAFVGKADARV
FT                   VFFTAAASRSAAAHAQRFAAVDSALPGMQHGAVLQDAQPEAGALRDTVASLIFTSGTTG
FT                   QPKGVMLTHDALIHFARVSGASRALGPQDRSYAFVPMTHIFGLGTVLISSLLAAAQLVM
FT                   RPQFDPDDLLDALVHHGVSQLQGPPALFSRLLAHLQERGIQRPEAPALRYLYTGAGPLD
FT                   LALKQRVEAAFGQALHHGYGLSEYAGSVHLTRLGEQRPDTSAGYAVAEAEVRVTDPATG
FT                   EPLPLGERGELWIRGRGLMPGYFRDPSATAAVMREGGWYASGDLGEMHADGALFVVGRL
FT                   KEMIIRSGFNVYPAEVETALNTHPSVQRSAVVGRTVEDGNEEIVAFVELRPGAALDADA
FT                   MQSHLRELLAPYKRPSYIVALSELPTNTNGKVLKRTLKDQALGLTT"
FT   gene            142859..143836
FT                   /locus_tag="Ajs_0127"
FT   CDS_pept        142859..143836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0127"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   rme:Rmet_3801 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40382"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2A7"
FT                   /protein_id="ABM40382.1"
FT                   /translation="MHSTPSRRSFIAGSLLAAAHPLAALAADPWPSKPVRFIVPFPPGG
FT                   PVDTTARVFSHRLSEIWKTPTVIDNRAGAGGVVGATAAAKEAPDGYGLFVGAIHHSVNP
FT                   SLMGKLPYDIEKDFAPISFAAMFPVFIVAHPSVPANTIQELIALAKKGTPLAYGSSGNG
FT                   GGTHLAGELFNMEAGTKLQHIPYKGSAPAMNDLLGGQVQLMFSDAPTALQHIKSGRVKV
FT                   LGVASRQRSAMLPDVPTGVESGLPGYEAYSWAALFAPAKTPQAVLDKINADFNTAMKDP
FT                   AVRQRLLDAGAEADPGTQEQMRQRLRGELDKWAKVIKTAGITPG"
FT   sig_peptide     142859..142939
FT                   /locus_tag="Ajs_0127"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            143932..144315
FT                   /locus_tag="Ajs_0128"
FT   CDS_pept        143932..144315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0128"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   reu:Reut_B3511 protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40383"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2A8"
FT                   /protein_id="ABM40383.1"
FT                   /translation="MHLSAQTHYQAELDAGRFCLQHCPQCQNHVFTPRELCPHCGASPL
FT                   RWVRASGLGTVYSATTIARKADAGGNYNVALIDLDEGVRMMSRVEGVAPEDVRIGQRVQ
FT                   ARVAQKDGRGLVLFQPAAQGGAA"
FT   gene            144312..145520
FT                   /locus_tag="Ajs_0129"
FT   CDS_pept        144312..145520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0129"
FT                   /product="thiolase"
FT                   /note="KEGG: reu:Reut_B3512 thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40384"
FT                   /db_xref="GOA:A1W2A9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2A9"
FT                   /protein_id="ABM40384.1"
FT                   /translation="MSRVPQSPLDAAAVNRPLRGRAAIVGAATYGCGEAPGMDDMTLLV
FT                   RAAHAAVADAGLTMQDIDGLATCSVNASMWTMPVIEHLGINPTYVDGTMIGGSSFIAHL
FT                   LPAIRALEAGQCKAVLVCYGSAQRSATFGRKESVAARRFLDPQPYEFPYEPVLPVSAYA
FT                   LAAARHMHEFGTTREQLAEVAVAARAWAQQNPEAFMRDPLTIEDVLAARPIASPLTVRD
FT                   CCLVTDGGGALVLTRAERARDLPNPPVYVLGNATAIWNRQISCMPDLTTTAAAQSGAQA
FT                   FAMAGLQAKDMDMAQVYDAFTINTLLFLEDLGFCAKGEGGAFVQNGGIAPGGRLAVNTN
FT                   GGGLSCVHPGMYGIFALIEAVRQLRGEAGVRQLQRHRTAVVHGNGGTLSSQSTAVLGTA
FT                   DTL"
FT   gene            145547..146704
FT                   /locus_tag="Ajs_0130"
FT   CDS_pept        145547..146704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0130"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bur:Bcep18194_C7329 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40385"
FT                   /db_xref="GOA:A1W2B0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2B0"
FT                   /protein_id="ABM40385.1"
FT                   /translation="MIRDPDILEALLDSVRRFVRERLVPAENEVAETDEIPEAIVQEMR
FT                   ELGLFGMTIPEKFGGLELTMEEECRVLFELCQTAPAFRSIIGTTVGIGSQGILMDGTPE
FT                   QQAQWLPKLATGEVIASFALTEPEAGSDAASLRTTAIKDGDHYIVNGTKRYITNAPHAG
FT                   MFTLMARTNPADKGAGGVSSFIVDAKTPGISFGKYDKKMGQRGAHTCDVIFDNVKVPAA
FT                   NLIGLQEGRGFKTAMKVLEKGRIHIAAVAVGVAQRILRDALAYALERKQFGQPICDFQL
FT                   VQAMLADSQAELYAAECMTIDAARRRDDGHNVSTEASCAKMFATEMCGRVADRAVQILG
FT                   GAGYMAEYGIERFYRDVRLFRLYEGTTQIQQIIIARNMVREARAA"
FT   gene            146701..147123
FT                   /locus_tag="Ajs_0131"
FT   CDS_pept        146701..147123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0131"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: bam:Bamb_1837
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40386"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2B1"
FT                   /protein_id="ABM40386.1"
FT                   /translation="MSGAPPLVDRSAFMRLIGAAQVPAPPGKVQVRLPHLREELLNQLP
FT                   AAHGGVVMALLDSVMSRAAGELPEAPSQTAVTVEMSSRFHRPGRGALLAEGWVVHATRS
FT                   LCSCAGQLLDEDGQLVATAHGTFKYWLAPTTLDSKK"
FT   gene            complement(147200..148108)
FT                   /locus_tag="Ajs_0132"
FT   CDS_pept        complement(147200..148108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0132"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bbr:BB2959 probable
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40387"
FT                   /db_xref="GOA:A1W2B2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2B2"
FT                   /protein_id="ABM40387.1"
FT                   /translation="MHFDLVDLRLMVHIADANSMTRGAELSFISLPAASTRIKNLEESI
FT                   GTKLLYRTSQGVTLTPPGQAFVSHARMVLGQIEHLRGDMQEYVRGIKGHVRVFANTTSL
FT                   GEFLPPVLRHFLRRNPDVNIDLRERLSHDIVRAVTEGQTDIGIVAGLVRTENLETLPYR
FT                   RDRLVLVVPRGHALDGEMQIDFADTLELDYVGLHESSAIHAFLRHASDQLHRPIKLRIQ
FT                   VGNFETACRMIEAGVGVGVLPESAASRHAQAMDIAIVPLSDAWSVREMQICVRSMEALP
FT                   SFAQELVDLLVADAQGRLQLE"
FT   gene            148245..149531
FT                   /locus_tag="Ajs_0133"
FT   CDS_pept        148245..149531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0133"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rme:Rmet_3808 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40388"
FT                   /db_xref="GOA:A1W2B3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2B3"
FT                   /protein_id="ABM40388.1"
FT                   /translation="MTTPDSSSSPGAGRAGALGHLRVLDLSRVLAGPWCTQNLADMGAD
FT                   VIKIEKPGDGDDTRHWGPPFFPDADGQPSEHACYFAACNRNKRSVTVDMATPEGQRLIR
FT                   ELAQQSDVVVENFKTGGLKRYGLDYESLSALNPRLIYCSVTGFGHTGPYAPRAGYDLLI
FT                   QAMSGLMSITGHADGEPGGGPMRVGVAVIDLFTGMYATTAILGALEVRHRTGRGQHIDM
FT                   ALLDVATAVLANQGAGFLNAGNIPKRQGNTHPSVVPYQDFPTQDGNMLLAIGNDGQFAR
FT                   FCEAAGTDWAGDERFATNAGRVTHRETLIPLMAALTRTRPTAAWIALLEDKAVPCGPIN
FT                   HVGQAFDDAQVRARGLRVEQQRYPGAQPPAGEVVNRVVTTASPLRLSDTPVTLRYAPPA
FT                   LGQHTDEVLRERLGLDAAQLQALRAQRVL"
FT   gene            complement(149539..150513)
FT                   /locus_tag="Ajs_0134"
FT   CDS_pept        complement(149539..150513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0134"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: bcn:Bcen_4125
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40389"
FT                   /db_xref="GOA:A1W2B4"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2B4"
FT                   /protein_id="ABM40389.1"
FT                   /translation="MSQSLPLSFATLAALALPAAAQSQVTISGYLDTGVFRDYDKTRKL
FT                   GTIQRSHLAVAGTEDLGGGLKANFRLSTRFELDTGQSEGAGSKPFWHDESTVGLQGGWG
FT                   QLRLGRALSAMWSQEWKFDAFSNFNRIASTAWHMAHYYTPTDRASNNGAAEYGRMTNGV
FT                   YYDSPTWDGFSFNASASTERTQAPGRDGRGGSVALNYDQGPVAAMVGYERNGSGDKDLF
FT                   LGGLYRLGAATLMMAYDHSRAGSSPATSRMVSVGGSYALGVTTLRASYGRQRLNDGVTH
FT                   HMASLGTEYHLSKRTMLYASLGHQRYEHNPSRTAFGVGVAHAF"
FT   sig_peptide     complement(150448..150513)
FT                   /locus_tag="Ajs_0134"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.807 at
FT                   residue 22"
FT   gene            complement(150871..152175)
FT                   /locus_tag="Ajs_0135"
FT   CDS_pept        complement(150871..152175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0135"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase, C terminal"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase, C terminal;
FT                   Glu/Leu/Phe/Val dehydrogenase, dimerisation region; KEGG:
FT                   pol:Bpro_3239 Glu/Leu/Phe/Val dehydrogenase, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40390"
FT                   /db_xref="GOA:A1W2B5"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2B5"
FT                   /protein_id="ABM40390.1"
FT                   /translation="MSNTPNPPLPTHALPSYLDPNHLGPWGVYLQQIDRVTPYLGSLAR
FT                   WVETLKRPKRALIVDVPIELDNGTIAHFEGYRVQHNVSRGPGKGGVRFHQDVTLSEVMA
FT                   LSAWMSIKNAAVNVPYGGAKGGIRVDPKTLSKAELERLTRRYTSEIGIIIGPSKDIPAP
FT                   DVNTNAQVMAWMMDTYSMNVGTTATGVVTGKPVDLGGSLGRVEATGRGVFTVGVEAARL
FT                   TGMAIEGARVAVQGFGNVGGTAGKLFAEAGAKVVAVQDHTGSIHNDKGLDVPALLAHVQ
FT                   RTGGVGGFAGAEPMANDAFWGVACDILIPAALESQITKDNAGRIQAKMVIEGANGPTTP
FT                   EADDILNDKGVLVLPDVISNAGGVTVSYFEWVQDFSSFFWTEDEINARLVRIMKEAFAG
FT                   VWQVAQENKVTLRTATFIVACKRILHAREMRGLYP"
FT   gene            complement(152356..153273)
FT                   /locus_tag="Ajs_0136"
FT   CDS_pept        complement(152356..153273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0136"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   pol:Bpro_4050 protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40391"
FT                   /db_xref="GOA:A1W2B6"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2B6"
FT                   /protein_id="ABM40391.1"
FT                   /translation="MPTYLPPFDIADDALAKQWRQWQPKDFAPNGGNGKNDKNGKHADK
FT                   DNGALHLKDYDPGAKPFSCGDKALDKARVEELALELDALQDLLYADRRYKLLVVLQGMD
FT                   TAGKDGTVRGVFGRMSALGVHAVGWKAPTELERAHDYLWRIHRQVPGAGELTVFNRSHY
FT                   EDVLVPVVNGWITPEQQRQRYAHINDFERLLAETGTVVMKFMLHISKDEQRQRLQERLD
FT                   DPTKHWKFDMGDIQVREQWDAYQRAYEAFLPATHTPWAPWTIVPADSKTHRNLMIASVL
FT                   RGVLQRLELRYPPGDPALENFTVK"
FT   gene            complement(153303..154226)
FT                   /locus_tag="Ajs_0137"
FT   CDS_pept        complement(153303..154226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0137"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: mfa:Mfla_0402 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40392"
FT                   /db_xref="GOA:A1W2B7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2B7"
FT                   /protein_id="ABM40392.1"
FT                   /translation="MAFTSDNVLVFLAVLDRGSFSAAARALSRVPSAVSMAIAQLEAEL
FT                   DMPLFDRSSREPRPTAAARALEPQARALAAQLQQLNTQALALTQGLEERLTLAIAPELL
FT                   AARWHGPLATLAQDYPLLQVEVLAAPQADALALLHAGRAQLALVFERPSLDGREDFQEV
FT                   GSETLVAVIAPQHPLLAPRAAGAGPAGLREEHLAGTRQIVVAGRDLGQTDARFVYARHH
FT                   WRTDSHLAALGLIEAGLGWGWQPRALVAPRIAAGTLVELPLENLSNGAQLWVDVVWSRE
FT                   RPLGLGARRFVELMARQRPGSSPAPQ"
FT   gene            154298..154786
FT                   /locus_tag="Ajs_0138"
FT   CDS_pept        154298..154786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0138"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   bte:BTH_II1937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40393"
FT                   /db_xref="GOA:A1W2B8"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2B8"
FT                   /protein_id="ABM40393.1"
FT                   /translation="MSATSHAVGLQGPKRRVVFVTLYEIIAIIVSSLLFMAIRQGAGAS
FT                   GVMAVVASALAIAWNVTFNALFERWEARQRVKGRSVLRRVVHAVGFEGGLALVLIPLMA
FT                   WWFGVSLWQATVMEAGLLLFFLVYTYAFNWAFDRIFGLPASAQAMPAAAPAGVVVGAP"
FT   gene            complement(154831..155757)
FT                   /locus_tag="Ajs_0139"
FT   CDS_pept        complement(154831..155757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0139"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bam:Bamb_5949 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40394"
FT                   /db_xref="GOA:A1W2B9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2B9"
FT                   /protein_id="ABM40394.1"
FT                   /translation="MELRQLRYFLSVAETEHLTRSADVLFVTQSTLSHGLRQLEAELGV
FT                   PLFDRLGRGLRLSQAGHAFRDHAARALQELEARRQAVADMSALQTGTLQVGVIPTFLTR
FT                   FVPDAVAAFSARYPGVQLTVRDLRSGQIEELLIAGRLDLGIAFHPASREEIEAEPLFEE
FT                   RMHLVVHQGHPLARRQRLRLAELAGVPLALLPASFATRRLIDAAFAQAGVTPLVRVEME
FT                   SVDALLQACRSGPLATIAAEHAALHAGPDMRAAVLTEPRTVRRAGLLWRRGASRSAAAR
FT                   EFVALLRPAIARTAAPPSLQGGAAQQE"
FT   gene            155906..157108
FT                   /locus_tag="Ajs_0140"
FT   CDS_pept        155906..157108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0140"
FT                   /product="muconate cycloisomerase"
FT                   /EC_number="5.5.1.1"
FT                   /note="KEGG: reu:Reut_B4400 mandelate racemase/muconate
FT                   lactonizing enzyme; TIGRFAM: muconate and chloromuconate
FT                   cycloisomerases; PFAM: Mandelate racemase/muconate
FT                   lactonizing enzyme, N-terminal domain protein; Mandelate
FT                   racemase/muconate lactonizing enzyme, C-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40395"
FT                   /db_xref="GOA:A1W2C0"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR013370"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2C0"
FT                   /protein_id="ABM40395.1"
FT                   /translation="MTTSPSASVLRIERIQARILDIPTIRPHKLSFGAIQRQSPVIVQL
FT                   WLSDGASGFGEAATIGGPSWNEESPESIRHAIDSYLAPAVIGQDAGRFEQLLQRMDLAC
FT                   KGNRFAKSAVEQAAIDAVARSLGLPVWQLLGGKQRESLPLAWTLASGDSAKDIEEAEKM
FT                   LAARRHRIFKLKIGARAPQDDVAHVARIARALDGRASMTVDVNQAWDGATARRYLPEMI
FT                   DAGVGLIEQPVAQWNEEALRQLTATLPHTALVMADETVCTPQDAMRLARHNACHVFSLK
FT                   IAKHGGLLRTRAVADVARAADIGWYGGTMLETSVGSAASAHVFATLGGTHHNCELFGPQ
FT                   LLVDDIVEQQMVLSDFALQLPDGPGFGLTVVPERLERFDRARQGLAPVHVDLGRASAQP
FT                   A"
FT   gene            157137..157433
FT                   /locus_tag="Ajs_0141"
FT   CDS_pept        157137..157433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0141"
FT                   /product="muconolactone delta-isomerase"
FT                   /EC_number="5.3.3.4"
FT                   /note="PFAM: Muconolactone delta-isomerase; KEGG:
FT                   rme:Rmet_4877 muconolactone delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40396"
FT                   /db_xref="GOA:A1W2C1"
FT                   /db_xref="InterPro:IPR003464"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2C1"
FT                   /protein_id="ABM40396.1"
FT                   /translation="MLFLVRMDVKIPHDLPAAQADEIKAREKKYSQDLQRDGRWRHIWR
FT                   VVGEYANYSVFDVQSNDELHQLLSQLPLFPYMDIHVTPLANHPSAIVQEGAAG"
FT   gene            157479..158402
FT                   /locus_tag="Ajs_0142"
FT   CDS_pept        157479..158402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0142"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; Catechol
FT                   dioxygenase, N-terminal domain protein; KEGG: rme:Rmet_1781
FT                   catechol 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40397"
FT                   /db_xref="GOA:A1W2C2"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2C2"
FT                   /protein_id="ABM40397.1"
FT                   /translation="MAEYTAQQLLDIVNTVHVAEGNARVRQITQRIVTDLFRTIEDLEV
FT                   TPDEFWAGVSWLTRLGASGQTGLITAGLGFDRLIDIRMDEADERAQRAAGTPRAIEGPL
FT                   FVAGAPLSEREVRLDEGEEPPRGEVVVMEGRVLDTDGQPVAGALVDVWHANELGRYSHF
FT                   DPGQAPYHLRRKIRTGADGSYRFRSFIPPGYAIPPGSPTAELFNALGRHGNRPAHIHFL
FT                   VVADGLRTLTTQVNIPGDSFLDDDFAFATRDGLVVTLEPGTPAAGYESLGISAPFTRVR
FT                   FDFVLQKALSADEQRPEARMDRVAAA"
FT   gene            158429..159421
FT                   /locus_tag="Ajs_0143"
FT   CDS_pept        158429..159421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0143"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   rme:Rmet_4876 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40398"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2C3"
FT                   /protein_id="ABM40398.1"
FT                   /translation="MTFSRRIALLGACTLAAAGLLPAAAMAQPDANWPSKPIKWVVPFP
FT                   PGGAMDVIARTLGEKAGRTLGQPFVIENRPGAGGNIGADAVAKSPADGYTIMITSIGMA
FT                   TNKALYPRLSYDPVKDFAPISLLAIVPNVLVVNTAKTTDKSVADVIAHAKRDPGKLTYA
FT                   SAGNGTSIHLAGEVFASMAGLNLLHVPYKGSGPAVTDMLGGQVDLMFDSITSARPHILS
FT                   GKLRALGVTSAKRSATLPGVPTIAEAGVPGYEVSPWFAVFAPAGTPAAIVNKINAALID
FT                   AMKQPDTVAKFETIGAEPIGTTPQQLATHLDKELARWGALIKERNIRMD"
FT   sig_peptide     158429..158512
FT                   /locus_tag="Ajs_0143"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 28"
FT   gene            complement(159508..160920)
FT                   /locus_tag="Ajs_0144"
FT   CDS_pept        complement(159508..160920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0144"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: pol:Bpro_4301 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40399"
FT                   /db_xref="GOA:A1W2C4"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2C4"
FT                   /protein_id="ABM40399.1"
FT                   /translation="MPAPQTQPPAAERDVYVDLYEAKKKIYPRAIGGVFTRWRWALVLL
FT                   TQGVFYGLPWWQWGERQMVLFDLGARRFYLFGLVLYPQDFIYLTGLLIMSALSLFLFTA
FT                   VAGRLWCGFACPQTVYTELFLWLERLTEGDRSARMRLDKGPWTFEKLWRKTLKQLAWVT
FT                   VALWTGFTFVGYFVPIRQLGGELLALHGTWQIFWVGFYSFATYGFAGYMREQVCKYMCP
FT                   YARFQSAMFDKDTLIVTYDTQRGEPRAARSKKVDAKAAGLGDCIDCSLCVQVCPTGIDI
FT                   RKGLQYECIGCGMCVDACNTVMDKVQYPRGLIRYATQNGMQNRWSSAQMLRRVLRPRVL
FT                   FYSAVLLALCTAMLASLVTRTPLKVDVVRDRAALSRVVAGGQLENIYRVQVMNATEQPQ
FT                   RYRITASGLQGLQVASEPEVEIGPAESRWVAVRLQVPYGAVPAGSHTVHLDVQALGDRA
FT                   QVSEKTVFLVPR"
FT   gene            complement(160964..161578)
FT                   /locus_tag="Ajs_0145"
FT   CDS_pept        complement(160964..161578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0145"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="KEGG: eba:ebA1198 iron-sulfur subunit of cytochrome
FT                   bc1; TIGRFAM: ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit; PFAM: Rieske [2Fe-2S] domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40400"
FT                   /db_xref="GOA:A1W2C5"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2C5"
FT                   /protein_id="ABM40400.1"
FT                   /translation="MTALPASCTCAAPDAERRTLIHATAAAGGLAAVGAAVPLVSSLAP
FT                   SERARSLGAAVEVDIAGLPPGGMLTVEWRGKPVWIVRRTPEMLQSLQGLEAQLADPASA
FT                   KDQQPDYARNTHRSIQPEVFVAIGICTHLGCSPTAVAPGAPQSGLGAGWPGGFFCPCHG
FT                   STFDNAGRVYRNKPAPTNLEVPPHRFLSATRLLIGEDSASA"
FT   gene            161755..163134
FT                   /locus_tag="Ajs_0146"
FT   CDS_pept        161755..163134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0146"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; PAS fold-4 domain
FT                   protein; SMART: AAA ATPase; KEGG: bxe:Bxe_B0676 sigma54
FT                   specific transcriptional regulator with PAS sensor, fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40401"
FT                   /db_xref="GOA:A1W2C6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2C6"
FT                   /protein_id="ABM40401.1"
FT                   /translation="MPFVTPYVTMADIPDLSPTPAQAAQTALLASWLEGLPEPHILFDR
FT                   GYRIVAANGAYRRQFGQGAPVVGRTCHAVSHHSPVPCDQAGETCPLARSLFSGQRERVL
FT                   HLHHTPAGEEYVQIELVPLRDEAGQPQYFLEKMEPLRIAQGQPGAPGMIGRAPAFQAVL
FT                   ELIARVGPSQASVLLLGESGTGKELAARAVHEASPRAGRPLVVVDCASLPETLFESELF
FT                   GHERGAFTGAHAARAGLVEAAHGGTLFLDEVGDIPLTMQVKLLRLLESGTYRRVGHTEL
FT                   RRADIRLVAATHRDLRAMVREGRFRQDLYYRLSTFPIQLPALRERPQDIPLLAESLLQR
FT                   VAGGRGLVLAPAALRRLAQHPFPGNVRELRNVLDRAALLTDGAVVAAHTIERALSFDAP
FT                   AAAPARAAQQPDHATLRDIESEALRAALAGGAASRRELARALGVSTRTLYRKLRLLREQ
FT                   G"
FT   gene            163503..166241
FT                   /locus_tag="Ajs_0147"
FT   CDS_pept        163503..166241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0147"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /note="KEGG: rfr:Rfer_0466
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase;
FT                   TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase, DHPS; Methionine synthase, B12-binding module,
FT                   cap domain protein; Vitamin B12 dependent methionine
FT                   synthase, activation region; cobalamin B12-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40402"
FT                   /db_xref="GOA:A1W2C7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2C7"
FT                   /protein_id="ABM40402.1"
FT                   /translation="MRLSGLEPVFIGEGSLFVNVGERTNVTGSKAFARMILNDQYEQAL
FT                   SVARQQVENGAQIIDVNMDEAMLDSKAAMVRFLNLIASEPDIARVPVMVDSSKWEVIEA
FT                   GLRCLQGKGIVNSISMKEGVEEFKRQAKLIRRYGAAAVVMAFDEKGQADTFARKTEICE
FT                   RAYRILVDEVGMAPEDIIFDPNIFAIATGIEEHANYAVDFIEAVRWIKQHLPGAKVSGG
FT                   VSNVSFSFRGNEPVREAIHTVFLYHAIKAGMDMGIVNAGMVGVYDDLDPELRERVEDVV
FT                   LNRRPDAAERLLEIAEAAKGAAKDDSKKLEWRGTPEHPKTVGERLSHALVHGITDFIVE
FT                   DTEEAYQQIVVQGGGRPLHVIEGPLMDGMNIVGDLFGAGKMFLPQVVKSARVMKQAVAH
FT                   LIPYIEEEKRQQEAAGLDVSSKGKIVIATVKGDVHDIGKNIVTVVLQCNNFEVINMGVM
FT                   VPCHEILARAKAEGADIIGLSGLITPSLEEMQYVAGEMDKDEYFRIKKIPLLIGGATCS
FT                   RVHTAVKIAPQYQGPVVYVPDASRSVSVAQSLLGEQKDSYLAEVQADYDHVRHLHANKK
FT                   KTPVWPLAQCRANKTRIDWAHYQPPAPKFIGRRVIKNIDLAELVPFIDWAPYFQTWDLA
FT                   GKYPDILQDEVVGEEATRVFRDAQAMLKKIVEGRWLTAHAVVGFWPANTVRDDDIELYA
FT                   DAARDKVVLTWYGLRQQAEKQPDAEGRMRPSRCLADFIAPRLEGGAPTQADHIGAFAVT
FT                   AGIGVDAKVAEFMADHDDYSAITLKALADRLAEAGAEWLHHRVRTDWWGYQAGERLSND
FT                   ELIAEKYVGIRPAPGYPACPDHRVKKPLFALLGTADVDMDITDSYAMTPAASVSGFYFS
FT                   HPESTYFSVGKIDDAQVQDMAQRSGVPLAEVERALAPNLGL"
FT   gene            166277..167878
FT                   /locus_tag="Ajs_0148"
FT   CDS_pept        166277..167878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0148"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   rme:Rmet_3815 peptidoglycan-binding domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40403"
FT                   /db_xref="GOA:A1W2C8"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2C8"
FT                   /protein_id="ABM40403.1"
FT                   /translation="MNLRLLTHHTAPLLLAASMPLAAWANPSWLTADGRPLPAAHEAVR
FT                   WLNEAAADGLEPADYGAQHLSDALAAAAARGLDAACAVALDQELTQAVERYLYELHGGR
FT                   IDPARLNERYDHSRRPQPDLRAALQTALADGQIQQARDAAIPRVPMYPALRALLAQYRA
FT                   MGAHPAWAQPLPALPGRKLTPGQPWEGLGVLAERLVALGDLPPQPTGEPPAASAPAQYA
FT                   PALVEAVTAFQRRHGLEADGVLGATTLAALNVPPAARAEQIALQMERLRWTPVLQGPRM
FT                   IAVNVPEYRLRAYEYAGGRITLRLSMAVIVGKALDTRTPLFDEDMQSIEFSPYWNIPPS
FT                   IARGEIVPRLRRDPGYLARQGMEFVSAAGVSTDATPEMLGAVLAGQARIRQRPGPLNAL
FT                   GDIKFVLPNNDNIYLHHTSAPTLFGRSRRDLSHGCVRVEEPVALAQFVLQDDPTWTVER
FT                   IRAAMAQPKPVFVRLPHPVPVIITHITVVVQDGRPHFYGDLYGHDRKLASLLRQHSAKP
FT                   YDAVRAGSAAGVIGPK"
FT   sig_peptide     166277..166354
FT                   /locus_tag="Ajs_0148"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            167912..168484
FT                   /locus_tag="Ajs_0149"
FT   CDS_pept        167912..168484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0149"
FT                   /product="protein of unknown function DUF882"
FT                   /note="PFAM: protein of unknown function DUF882; Peptidase
FT                   M15A; KEGG: reu:Reut_B3941 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40404"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2C9"
FT                   /protein_id="ABM40404.1"
FT                   /translation="MAPPHNPHRRLFLGRGAAVAHAAAAAVLLPKAALASLSEEQDLAR
FT                   RLAFNHLHTHERLALVYAQGEQFVPAALPTLNHFLRDHYSGDVGVMDPDLFHLLHRVRQ
FT                   TLQTQRPFEVISGYRSPHTNETLRTTRGGGVARRSLHMDGKAIDVRLPGVSLSDLRDAA
FT                   ISLRAGGVGYYAREQFVHIDTGRVRSW"
FT   sig_peptide     167912..167989
FT                   /locus_tag="Ajs_0149"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.851 at
FT                   residue 26"
FT   gene            complement(168554..169090)
FT                   /locus_tag="Ajs_0150"
FT   CDS_pept        complement(168554..169090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0150"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: pol:Bpro_0786
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40405"
FT                   /db_xref="GOA:A1W2D0"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2D0"
FT                   /protein_id="ABM40405.1"
FT                   /translation="MQTRCALVGMPGSGKSTVGRQLARRLGLPFVDLDQRLEQWLGTSI
FT                   RDYFDQHGEAAFRDHEAALLAELAAQPGGMVLSTGGGAVLREDNRATLRRSFPHVMYLR
FT                   ASPDEIFKRIKHDRTRPLLQVDDPLARLRDLYRARDPLYREAAHYVIETGRPTVHTLVN
FT                   IIMMQLEMAAPGDPV"
FT   gene            169220..170137
FT                   /locus_tag="Ajs_0151"
FT   CDS_pept        169220..170137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0151"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: pol:Bpro_1517
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40406"
FT                   /db_xref="GOA:A1W2D1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2D1"
FT                   /protein_id="ABM40406.1"
FT                   /translation="MPMTLQSLKSIAQPLLQRVLQPIAPLVRAVQMWLDADGLRMSAAM
FT                   SFYGMLSLAPLLLLLVGVLGWWIDQAYLESNLIAQVRGVMGERGAEVVRLALASAQEPA
FT                   EGRLASMAGFVLLLSGATGVFVELQSALERLWAHGQPAPERKAWWRMASLRLRGLAYVL
FT                   AIGFLLLVSLVLSTAINVLATWASARLPFGSGTLLQIVNEAVAFAVAVALFLGLMRIGS
FT                   GPKPPTHCLVFGAVVGATLFTVGKQLLALYLSTAAVVSAYGAAGSLVVLLMWIYFSSAV
FT                   LLFSAASARALHETRTAASAPAGR"
FT   gene            170221..171105
FT                   /locus_tag="Ajs_0152"
FT   CDS_pept        170221..171105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0152"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: pol:Bpro_0175 17
FT                   kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40407"
FT                   /db_xref="GOA:A1W2D2"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2D2"
FT                   /protein_id="ABM40407.1"
FT                   /translation="MRSPRLFLWQPNEHMHSTSASPAAAPSAASLKWLWAAVGVLGVSV
FT                   LALGGTLLAQNLRGGSPAGDSAAGGPAATLAATAPRTPEAEMLNEKAPPAQSQQAMAAL
FT                   DSGANPTARRAAAPPSPQAYPQDDPQTYAQGYPQPAASPSPVPTQRGEPLQRAVAQRSA
FT                   APVCTTCGRVESVRAVEQAAPATGVGAVAGGVLGGVLGNQIGKGSGRTAATVLGAVGGG
FT                   YVGHKVEQRARTTTVYQMRVRMDDGSVRSFTRAQPLAEGTAVRVQGKSLRVDTGADADR
FT                   AGVEPVRVVDRGY"
FT   gene            complement(171275..172048)
FT                   /locus_tag="Ajs_0153"
FT   CDS_pept        complement(171275..172048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0153"
FT                   /product="Ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   rfr:Rfer_0084 ferredoxin--NADP(+) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40408"
FT                   /db_xref="GOA:A1W2D3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2D3"
FT                   /protein_id="ABM40408.1"
FT                   /translation="MSAFHEERVLTVHHWTDRLFSFTTTRDPALRFSNGHFTMIGLKVD
FT                   GKPLLRAYSIVSANYEEHLEFLSIKVPDGPLTSRLQHIQVGDSIIVGKKPTGTLLIDYL
FT                   LPAKRLYLMSTGTGLAPFLSVIRDPETYEKFEQVILIHGVRQVAELAYHDYITKELPQH
FT                   EFLGELITKQLKYYPTVTREPFRNQGRMPNLIDSGKLAADLGLPELNPLEDRVMLCGSP
FT                   EMLASLKELLEKRDFEEGNTTRPGDFVIERAFVEK"
FT   gene            172308..173495
FT                   /locus_tag="Ajs_0154"
FT   CDS_pept        172308..173495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0154"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pol:Bpro_4064 extracellular ligand-binding receptor; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40409"
FT                   /db_xref="GOA:A1W2D4"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2D4"
FT                   /protein_id="ABM40409.1"
FT                   /translation="MHKPFTPLLVLLFAGGAYAQGAYTIGEINSYKAQPAFLEPYKKGM
FT                   ELAVEQINAAGGIQGKQLRLVTRDDNATPGDAVRAAEELIAREKVDVLMGSFLSHVGLA
FT                   LTDFAQQKKRFFLAAEPLTDKIVWEHGNRYTFRLRPSTYMQVAMLVPEAVALKKKRWAI
FT                   VYPNYEYGQSAVATFKQLLKAAQPDVEFVAEQATPLGKVDAGSVAQALEDAKPDAIFNV
FT                   LFAADLAKFVREGNTRGLFAGRSVVSLLSGEPEYLDTLKSETPEGWIVTGYPWYAIQTP
FT                   EHKAFLDAYMKRFKDYPRAGSVVGYNAVQSVAAGLAKAGSADTEKLITAFRGLQVATPF
FT                   GPITYRPQDHQSTMGAYVGKTALRMGKGVMVDFTYRDGAKYQPSDAEVKRLRKDE"
FT   sig_peptide     172308..172367
FT                   /locus_tag="Ajs_0154"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 20"
FT   gene            173568..175535
FT                   /locus_tag="Ajs_0155"
FT   CDS_pept        173568..175535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0155"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family / amino acid/amide ABC transporter membrane
FT                   protein 2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   pol:Bpro_4063 inner-membrane translocator; TC 3.A.1.4.-;
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40410"
FT                   /db_xref="GOA:A1W2D5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2D5"
FT                   /protein_id="ABM40410.1"
FT                   /translation="MAAGFNRAGCGGPVRQWTTDMDISGLLAQLLNGLAGASTLFLVAA
FT                   GLSLIFGVMRIVNFAHGSFYMLGLYLAYALVERLGEALGFWPALLWAPLAVGLLGAAVE
FT                   VLLLRRIYRAPELLQLLATFALVLVIKDAALWLWGPEELFGPRAPGLEGAVDLLGRRFP
FT                   AYDLFLIAVGPLVLVLLTLLLTRTRWGTLVRAATQDREMVGALGVNQAWLFTSVFALGA
FT                   LLAGLGGALQLPREPASLELDMLTIGAAFVVVVVGGMGSLPGAFVAALVIAELKAVCIW
FT                   LGVVEVAGVEVAFPQLTLVVEFLVMAAVLIWRPWGLMGRPQAVARGVGAPEAPLRQAGQ
FT                   GATAAWCALVLGLALLPLAVEPGSYATVLLTDIAIAALFAASLHCILGPGGLHSFGHAA
FT                   YFGLGAYGAALLVRWLDWPMGTALLLGPLVAAAGALVYGWFCVRLSGVSLTMLTLAFAQ
FT                   ITWAIAYQWDGFTGGSNGITGVWPPQWAAQGAGFYWLVLALAVAGIYLLRRMLFAPLGW
FT                   ALRAARDSALRADAIGIDVRGVQWAAFVAAGLLAGLAGALYVFSKGSVAPDALGVSRSV
FT                   DGLVMVLLGGMQQLAGPVVGAGVFTWLHDTVARSTDYWRALLGGIMLLLVLLFPQGISG
FT                   FAQIWQARAAIKNKAQEGAP"
FT   gene            175532..176290
FT                   /locus_tag="Ajs_0156"
FT   CDS_pept        175532..176290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0156"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_4062 ABC transporter related; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40411"
FT                   /db_xref="GOA:A1W2D6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2D6"
FT                   /protein_id="ABM40411.1"
FT                   /translation="MSLLQVQGLRKSFGGVQAVQGVSFALQAGELLALIGPNGAGKSTT
FT                   FNLVGGQLLPDAGRVLLQGQDITGLAPRAVWRRGVGRTFQIAQTFASFTVLQNVQMALL
FT                   SHDRQAWRWWRRADAHRPHDALALLEQVGMAAQAQRPCSALAYGDVKRVELAMALAHAP
FT                   ALLLMDEPTAGMAPAERLALMQLVQRIARERRMGVLFTEHSMDVVFGLADRVAVLVRGQ
FT                   LLAEGTPQQIQDDARVQAAYLGTGLALESA"
FT   gene            176287..177066
FT                   /locus_tag="Ajs_0157"
FT   CDS_pept        176287..177066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0157"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_4061 ABC transporter related; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40412"
FT                   /db_xref="GOA:A1W2D7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2D7"
FT                   /protein_id="ABM40412.1"
FT                   /translation="MTNQNDSALHLPSKVLEAKTPLLEVADLHAWYGAAHILHGVSLSV
FT                   GHGEVVALMGRNGAGKSTTLKGIAGLLERRSGRIEFLGQRIDRQPPHAIARRGLGYVPE
FT                   DRRIFTDLTVLENLEVGRQKPRHWPDGTPAPLWTPERLFTLFPNLGEMPDRPGGRMSGG
FT                   EQQMLTVARTLMGQPLLVLLDEPSEGVAPVIVQQMARTIRALKAQGIGILLSEQNLPFA
FT                   EAVADRACVLEQGRIVYSAGMAQLAGDAAARRQYLGV"
FT   gene            complement(177097..178014)
FT                   /locus_tag="Ajs_0158"
FT   CDS_pept        complement(177097..178014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0158"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rfr:Rfer_0910 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40413"
FT                   /db_xref="GOA:A1W2D8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2D8"
FT                   /protein_id="ABM40413.1"
FT                   /translation="MSPFDRMHIFVRVAELASFTQAAEALGIPKASASTAVQQLETQLG
FT                   TRLLHRTTRRVQLTQDGQAYYERCKDLLADVDELQSMFQHPAGAGLKGRVRIDMSTGMA
FT                   RNVVVPRLPELLAPHPGLELELSSTERRVDVVREGFDCVLRTGAVVDSSLVARPLGLAR
FT                   LVNCASPAYLRAHGTPRSLADLPGHRLVHFVNTLGARSAGFEAVVDGALVLTPMQGALT
FT                   VNNAEAYMAGCLAGLGLIQVPHLGVVDLLARGDLVEVLPQLAAPPMPLTLMYANRRNLP
FT                   RRVRTVMDWLAQVVAEHLAQVTAA"
FT   gene            178123..178932
FT                   /locus_tag="Ajs_0159"
FT   CDS_pept        178123..178932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0159"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: rso:RSc1730 probable dehydrogenase/reductase
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40414"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2D9"
FT                   /protein_id="ABM40414.1"
FT                   /translation="MTHAASSSSSTATAGMAARPAIALITGGSRGLGRNAALHVARSGT
FT                   DVILTYRSQAAEAQAVVAEIEALGRRAVALPLDVAASATFTAFAGQVRDVLARHWQRER
FT                   FDFLVNNAGVGGYASFMETTEAQFDDMVNIHLKGVFFLTQKLLPLMNDGGRILNVSSGL
FT                   ARFALPGYAAYAAMKGGVEVLTRYLAKELGARGIAVNVVAPGAIETDFGGGAVRDNAQL
FT                   NAFIAGQTALGRVGLPDDIGGVIAALLQPGTGWVNAQRIEASGGMFV"
FT   sig_peptide     178123..178194
FT                   /locus_tag="Ajs_0159"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.941 at
FT                   residue 24"
FT   gene            complement(179061..180800)
FT                   /locus_tag="Ajs_0160"
FT   CDS_pept        complement(179061..180800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0160"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rme:Rmet_5612
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40415"
FT                   /db_xref="GOA:A1W2E0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2E0"
FT                   /protein_id="ABM40415.1"
FT                   /translation="MKNLSIGTRLGGGFALVLLLMALMTAFGVWRLQTVAQATNEMTQQ
FT                   PLAVERMISDWYRYVYSAARRTSAIVKSTDPSLGQFFAADTATSTRESAELQKRIETLL
FT                   TSDEEKALWADIQKARVTYLSSRDQAVKAKAEGQLEEAERLLTQVYLPATDQYVALIQR
FT                   LLDMQRARIDATAQGINVTYGQSRLWLIVLGVLGLGAGALCAWWLTRGITRPLAQAVQV
FT                   ARAVAANDLTSRVQVDSRDETGQLLQALQEMNASLSQVVARVRSGTDGIATASSQLDAG
FT                   NQDLSSRTEEQASSLQETAASMEQLTSTVRQNADNARQANQLASSAAQTATQGGQVVAG
FT                   VVQTMGAINASSRKISDIIGVIDSIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRA
FT                   LAQRSAAAAKDIKGLIGDSVAKVEEGSHQVEEAGRTMDAIVQSVQRVSDLVAEITAASQ
FT                   EQSAGIEQVHQAITQMDQVTQQNAALVEEATAATGSLKAQAGQLAQAVSVFRVEGLQAA
FT                   QTATAAAAAAPAPFRRPAPATTTTTTKPPAAARTLAAPARPPAAAKAAPATARHSDDDW
FT                   EAF"
FT   sig_peptide     complement(180690..180800)
FT                   /locus_tag="Ajs_0160"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.538 at
FT                   residue 37"
FT   gene            complement(180846..182384)
FT                   /locus_tag="Ajs_0161"
FT   CDS_pept        complement(180846..182384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0161"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: rfr:Rfer_0471 Mg chelatase-related protein;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase, ChlI subunit; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40416"
FT                   /db_xref="GOA:A1W2E1"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2E1"
FT                   /protein_id="ABM40416.1"
FT                   /translation="MSLALVQSRALLGLHAPAVTVEVHLANGLPSFALVGLADVEVKEA
FT                   RERVRSALQNAGLEFPANKKITVNLAPADLPKDSGRFDLPIALGILAASGQIDAARLDG
FT                   WEFAGELSLSGLLRPVRGALATSLALRALAQPVRTVLPPGSAEEAALVPGTEIYRAHHL
FT                   LDVVRQFVPVPPPNDDGADDGGWQRLQPAPPAPATDGPDLADVKGQAAAKRALEIAAAG
FT                   GHGLLLVGPPGSGKSMLAQRFAGLLPPMGVEQALESAAIASLAGRFSPAQWMQRTTASP
FT                   HHSCSAIALVGGGSPPRPGEISLAHEGVLFLDEFPEFARSALEALREPLESGRITIARA
FT                   AQRAEFPARFQLVAAMNPCPCGFAGSHQRACRCTPDQIARYQGKLSGPLLDRIDLHVEV
FT                   PALPPEELLGAPPGEPSGAVRERVARAHERALQRQGKANQALQGQELEQMAALDAPAAR
FT                   FLQAAAARLAWSARSTHRALKVARTIADLSGCGTVGAAHVAEAVQYRRVLRAPA"
FT   gene            182604..183335
FT                   /locus_tag="Ajs_0162"
FT   CDS_pept        182604..183335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40417"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2E2"
FT                   /protein_id="ABM40417.1"
FT                   /translation="MHRFSLKTLTLAFAAVAAPGLASAQLTANVSLTSNYKFRGQDQDV
FT                   NRIKAVNPAIQGGFDYSFGDSGFYVGNWNSSVDWLSGNSIEADFYGGYKFKAGEVDLDV
FT                   GALTYVYPGNTSGNTTELYGAATYGPFTAKYSHTVSKDYFGWAGAKTSSNRGRNTGYLN
FT                   LAFAQEVAPSVTLKASVGYTRFASDIKDLGVPNYVDYSVGGAYDFGAGLSLSAAVAGAN
FT                   KKGFFGDANKARLIVSLTKTL"
FT   sig_peptide     182604..182678
FT                   /locus_tag="Ajs_0162"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 25"
FT   gene            183356..183694
FT                   /locus_tag="Ajs_0163"
FT   CDS_pept        183356..183694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0163"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   rfr:Rfer_0472 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40418"
FT                   /db_xref="GOA:A1W2E3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2E3"
FT                   /protein_id="ABM40418.1"
FT                   /translation="MKMVTAIIKPFKLDEVRESLSDIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVADELVERVIEAIEGAARTGKIGDGKIFVAHLEQVVRIRT
FT                   GETGQEAL"
FT   gene            183741..185168
FT                   /locus_tag="Ajs_0164"
FT   CDS_pept        183741..185168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0164"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: rfr:Rfer_0473 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40419"
FT                   /db_xref="GOA:A1W2E4"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2E4"
FT                   /protein_id="ABM40419.1"
FT                   /translation="MKKLFASLLIGASLLAGGAGALAQTPDAAAAASEPVAVAPAPAPA
FT                   AEPVAAPAAAPAPAPAAAAPAAPKVDSGDTAWMLTSTLLVILMIIPGLALFYGGLGRTK
FT                   NMLSVLMQVFVIFALVSLLWSIYGYSLAFSGEGQFVGDLSKLFLKGVSQETFGALATIP
FT                   EYVFIAFQGTFAAITVALIVGSFAERMRFAAVLIFALLWFTFSYVPMAHIVWGGGLLAA
FT                   DGALDFAGGTVVHINAGIAGLVGAYMVGKRIGFGKEAFTPHSLTLTMVGASLLWVGWFG
FT                   FNAGSAGAANAVAGLAFVNTVLATSAATLSWIAGEALHKGKASMLGAASGAVAGLVAVT
FT                   PAAGFVGPMGSIAIGLIAGLVCLWGVGGLKKMLNVDDAFDVFGVHGVGGIVGAILTGVF
FT                   AAQGLGGTGGLTPDTFSMGAQVWVQVKSVLFTIVWSGVVSFIAYKVADLLVGLRVSEEA
FT                   EREGLDITSHGETAYHR"
FT   sig_peptide     183741..183812
FT                   /locus_tag="Ajs_0164"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 24"
FT   gene            185308..186258
FT                   /locus_tag="Ajs_0165"
FT   CDS_pept        185308..186258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0165"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: rfr:Rfer_0479 senescence marker protein-30 (SMP-30)"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40420"
FT                   /db_xref="GOA:A1W2E5"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2E5"
FT                   /protein_id="ABM40420.1"
FT                   /translation="MNTAWTPLAAAPAQLGESPFWHPLESRLYWVDIAGRALWRSGAHG
FT                   SDAQCWPLPAEPGCIAPARQGGTPAGLVVALRDRICHAPRWGGPLLTLAHLPIDPATER
FT                   ANDGKCDALGRLWVGTVHEPAQGPRQPVAALYCIDLRGGDQDSPDAPTVRRMLDGVATA
FT                   NGLAWAPDGRTLYWSDTPSHTIRAWDCNAQLEPIGAPRVLHRFATRDEAVPYGGRPDGA
FT                   AVDVEGAYWCALYEGARVLRLSPRGEVLAELPTPLSCPTMPCVGGPDGHTLFVTSARKG
FT                   RSADELARWPQSGQVLSTRVAVAGLPVAWCEVGQR"
FT   gene            186362..187471
FT                   /locus_tag="Ajs_0166"
FT   CDS_pept        186362..187471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0166"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   rfr:Rfer_0480 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40421"
FT                   /db_xref="GOA:A1W2E6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2E6"
FT                   /protein_id="ABM40421.1"
FT                   /translation="MDAALRQIIDRVRDSADRRSAVRICGGGTKDFHGPGAPQHAGEPL
FT                   DMRPLAGIVSYEPSELVVTALAGTPLAELEALLARHGQSLPFEPPRFAEGGTVGGMVAA
FT                   GLSGPARASVGAVRDYVLGVEIINGRGELLRFGGQVMKNVAGYDVSRLMAGAWGQLGVI
FT                   TEVSLKVLPVPPAEATLRFDCDQAEALRRLNAWGGQPLPLNASCWVEDAGRGQLYVRLR
FT                   GAQAAVRAACRSMGGELQDAPTVPDDWQACRDQRLPWFAARAADHALWRLSVPQTAPVL
FT                   ALPAGVAPPLVEWHGGLRWVQALPQHGDALHALAAEVGGSASLFIAASADGISARAIFD
FT                   TKSAALAAIHQRLKQAFDPAGIFNPGRLV"
FT   gene            187474..188271
FT                   /locus_tag="Ajs_0167"
FT   CDS_pept        187474..188271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0167"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   rso:RS00757 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40422"
FT                   /db_xref="GOA:A1W2E7"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2E7"
FT                   /protein_id="ABM40422.1"
FT                   /translation="MRLLRHLTGQHRTTVTNRTLGLLLAFNAGAINAGGFLVVHMYTSH
FT                   MTGFLSLVADNLVLGNMTLVLSAIGTLWAFMSGAGSTAILVNWARHQHLRSGFALPLLL
FT                   EAVLMLLFGLMGAITLGWRTPFAVPLTVLLLAYIMGLQNAVVTKMSSAQIRTTHMTGIV
FT                   TDLGIEMGKALYWNRSGTPRESQVHANQTRLRMFASLLGMFTAGGVVGAAGFKYVGFIW
FT                   VVPLASILLALSLPPLAADRHRLAQLWRARRAPAPAEDAPARR"
FT   sig_peptide     187474..187575
FT                   /locus_tag="Ajs_0167"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.756 at
FT                   residue 34"
FT   gene            188297..189535
FT                   /locus_tag="Ajs_0168"
FT   CDS_pept        188297..189535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0168"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: pol:Bpro_0188 protein of
FT                   unknown function DUF224, cysteine-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40423"
FT                   /db_xref="GOA:A1W2E8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2E8"
FT                   /protein_id="ABM40423.1"
FT                   /translation="MQTQLAPQYQGTPEGQEAEAILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQVLEGAEPTRKTQLHLDRCLTCRNCESTCPSGVQYGHLVDIGRRIVEE
FT                   KVPRPRGEAAARWMLKEGLPSPLFGPAMKVGQAVRGLLPERLRAKVPPRQDAGAWPTRS
FT                   HARKVLLLEGCVQPSMAPNINSATARVLDAAGIQTVVAREAGCCGAVKFHLNDQEGGLA
FT                   QMRANIDAWWPYVERGEVEAIVMNASGCGVTVKEYGHLLRNDAQYAEKAARVSALTRDL
FT                   SELLPDLVERLRGRIQPTAAPLAYHPPCTLQHGQKLRGGVERHLAALGFELRVARTESH
FT                   LCCGSAGTYSVLNPELSYQLRDRKLGALGEAFTEQPPAAILSANMGCITHLQSGTGIPV
FT                   KHWVEVLDAALLA"
FT   gene            189597..190466
FT                   /locus_tag="Ajs_0169"
FT   CDS_pept        189597..190466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0169"
FT                   /product="ProQ activator of osmoprotectant transporter
FT                   ProP"
FT                   /note="PFAM: ProQ activator of osmoprotectant transporter
FT                   ProP; KEGG: pol:Bpro_1033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40424"
FT                   /db_xref="GOA:A1W2E9"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2E9"
FT                   /protein_id="ABM40424.1"
FT                   /translation="MNDTVNAPAPIHEEGVPPIAAAVPAAEGHATPESPASASPAPAAD
FT                   SGAARAPRANRRGGRGRAGGRRESGAQATGDAPQAGAKGGPAAGAPRRTHPLLEQLAGW
FT                   YPHLFGAQFLPLKRGIFQDLLAAHGQAIDKDALKLALSIHTRSTRYLNAVAQGMKRHDL
FT                   QGQPVEDMAPEHVHHALLEVFRRRKPQDGEDLTAKLRRRIAQAFEASGLTREAYDALVR
FT                   GRDEKANALLDEAFAEVAERDAKAEALLRAFEASGQTPEAFADMYGLPARQAAQMLERA
FT                   RQRRAPGA"
FT   gene            190545..190955
FT                   /locus_tag="Ajs_0170"
FT   CDS_pept        190545..190955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0170"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_A4004 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40425"
FT                   /db_xref="GOA:A1W2F0"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2F0"
FT                   /protein_id="ABM40425.1"
FT                   /translation="MLSRSPSMTIPSSSQAINWFEIPCADLGRAQSFYERMLDRPMRRE
FT                   DFGGEPMALFSKDDPATGGCLVAGPQRRAAPDAGVRIYLDCEPSVEAALARVVPAGGQV
FT                   VDACTQLPQGMGYIAHVRDTEGNTIGLHAMAR"
FT   gene            191048..191518
FT                   /locus_tag="Ajs_0171"
FT   CDS_pept        191048..191518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0171"
FT                   /product="transcription activator, effector binding
FT                   protein"
FT                   /note="PFAM: transcription activator, effector binding;
FT                   KEGG: pfl:PFL_3410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40426"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2F1"
FT                   /protein_id="ABM40426.1"
FT                   /translation="MIPITVQVPAFSVAGVAVRTCNRDEAQPERARIGALWDQFFTESW
FT                   ARQLPGPGADGRLYGVYSAYESDQHGAFDVTAGVTAAVQADPPVGAARIEVQPGSYLVF
FT                   HCEGPMPQIVLDAWAAAWRYFEEHPEVRRRFDTDFECYEGPECVALHIGVLL"
FT   gene            191596..192324
FT                   /locus_tag="Ajs_0172"
FT   CDS_pept        191596..192324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0172"
FT                   /product="Helix-turn-helix, type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix, type 11 domain protein;
FT                   KEGG: rso:RSc2673 putative repressor transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40427"
FT                   /db_xref="GOA:A1W2F2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2F2"
FT                   /protein_id="ABM40427.1"
FT                   /translation="MRRADRLFQIVQLIRGRRLSTAAFLAGRLEVSLRTIYRDVADLQH
FT                   QGIPIEGEAGVGYRLGAGFELPPLMFSQGEANALVAAARLAQTWVDGGMAREIEGALGK
FT                   ILSVLPPAARAAAEAQALYAPGSGLDTLAQAALQALREAVQSCHVVRLDYADVQGRPSL
FT                   RRVRPLGCFYWGKVWTLSAWCELRDGFRGFRIDRIAAFEVLDERFRQEPGKTLADLLRQ
FT                   VEARMRHCPAEGLDGAAFPS"
FT   gene            complement(192555..193040)
FT                   /locus_tag="Ajs_0173"
FT   CDS_pept        complement(192555..193040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0173"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="PFAM: glutathione peroxidase; KEGG: rfr:Rfer_0484
FT                   glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40428"
FT                   /db_xref="GOA:A1W2F3"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2F3"
FT                   /protein_id="ABM40428.1"
FT                   /translation="MTTAYDFDATCIDGAPQPLSDFRGQVLLIVNTASACGFTPQFTGL
FT                   QALHERYGPRGLAVLGFPCNQFGHQDPGSNDAIAGFCQRNYGVQFPMMSKIDVNGSDAH
FT                   PLYRWLTGEAPGVLGTKAIKWNFTKFLVGRDGQVIRRYAPQEAPEKLTVDIEAALAA"
FT   gene            complement(193037..193978)
FT                   /locus_tag="Ajs_0174"
FT   CDS_pept        complement(193037..193978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0174"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rfr:Rfer_0486 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40429"
FT                   /db_xref="GOA:A1W2F4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2F4"
FT                   /protein_id="ABM40429.1"
FT                   /translation="MQSPLPALALLFNAFIWGLSWWPFRQMHGAGLHPLWATALMYGAI
FT                   LLVLLALRPGISAQLRQHKALWLLALCSGLNNVAFNWAITIGDVVRVILLFYLMPAWSV
FT                   LLAWRFLGERPTSQALARLLLAFSGVLLVLWPAEGGLPRLLAALTLADLLAILGGFTFA
FT                   VTNVTLRRLHAVPGQARMVAMFGGCMLMALLAAQLGRSLGLVPPFPPLNATWAWVAALL
FT                   AVVLLIGNWALQFGAARLAAGTTAIIMLSEVVFASGSSTLLGAAQLTGGTLAGGALILL
FT                   AAGWSVWRPRVHAAGTPHAPSDKVTDTRPEAP"
FT   gene            complement(194129..195406)
FT                   /locus_tag="Ajs_0175"
FT   CDS_pept        complement(194129..195406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0175"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_0192 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40430"
FT                   /db_xref="GOA:A1W2F5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2F5"
FT                   /protein_id="ABM40430.1"
FT                   /translation="MKRGFYTIMSAQFFSSLADNALFVTAVELLRTSGAPEWQRAALVP
FT                   MFALFYVVLAPWVGAFADSMPKGRVMFISNAIKVVGCLMMLFGHHPLLAYAVVGLGAAA
FT                   YSPAKYGILTELLPASQLVKANGWIEGLTIASIILGVLVGGQLVAPHIASHLLALDMPG
FT                   IDLGIDLAAEAAILALVPVYMLAAWFNLRIPHTGVEMRPLPPNPLALLPDFWTCNGRLW
FT                   RDKLGQISLSTTTLFWGVSGNLRYIVLAWSAAALGYSTTQASALVGVVAIGTAAGAVAA
FT                   SLHMRLDMATRVIPMGIAMGLLVILMNVISNIWLAIPFLILLGGLGGFLVVPMNALLQH
FT                   RGHNLMGAGRSIAVQNFNEQAAILGMGAFYSLSTKFGLSAFGAITAFGMLVAGVMWLIG
FT                   RWHAHNVRSHPEEVEHLLSIARHDHH"
FT   sig_peptide     complement(195350..195406)
FT                   /locus_tag="Ajs_0175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.678) with cleavage site probability 0.632 at
FT                   residue 19"
FT   gene            195547..196644
FT                   /locus_tag="Ajs_0176"
FT   CDS_pept        195547..196644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0176"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: pol:Bpro_0193 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40431"
FT                   /db_xref="GOA:A1W2F6"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2F6"
FT                   /protein_id="ABM40431.1"
FT                   /translation="MPRPILATIHPAAVHHNLERARRAAPDARVWAVVKANAYGHGIER
FT                   VFEGLRAADGFALLDLAEAERVRALGWRGPILLLEGVFEPRDLELCSRLGLWHAVHCDA
FT                   QIDWLAAHKTQVPHRVFLKMNSGMNRLGFTPERYRSAWARLNALPQVDEISCMTHFSDA
FT                   DGPRGIAHQVQAFQAATQDLPGERCIANSAALLRHGGDAQVRLDWVRAGIVLYGSAPDH
FT                   PERRAADWDLQPTMTLASRIIGVQQLQAGDTVGYGSRFTAQGPLGIGIVACGYADGYPR
FT                   HCDTGTPVLVNGVRTRTIGRVSMDMLAVDLTPVPGAGLGAEVTLWGRAANGAVLPIDEV
FT                   AQAGGTIGYELMCALAPRVPVVVQD"
FT   gene            196653..197204
FT                   /locus_tag="Ajs_0177"
FT   CDS_pept        196653..197204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bma:BMAA0623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40432"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2F7"
FT                   /protein_id="ABM40432.1"
FT                   /translation="MVRVRGRTGASWRGMRLPQRLQEGLRQRHALRLHGWCIGSLILGV
FT                   MWAVSHAQMALGVPSLALRYLVTLGVGYGVYLLVLRLWAAWLLRRRSDAGDAPDGLDLL
FT                   PDAGWPAGPGPQGPAPPLHGGGGDFGGAGATGRGLARGAGLFWGGLGVRPGRAAPRGAA
FT                   PCAGSARAPWETARCPRRRS"
FT   gene            complement(197107..197721)
FT                   /locus_tag="Ajs_0178"
FT   CDS_pept        complement(197107..197721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0178"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain; KEGG:
FT                   sme:SMc00036 putative glutathione S-transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40433"
FT                   /db_xref="GOA:A1W2F8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2F8"
FT                   /protein_id="ABM40433.1"
FT                   /translation="MTSLTLYFTPGTCAQAVRIALEEAQAPYTLVRVDFASQQQRSPEY
FT                   LAVNPKGRVPALVTEHGTLTETPALLAYVAQRFADARLAPADPFGFARLQEFHSYLAST
FT                   VHIAHAHRPRASRWADEPEAQAAMQRKVPANMTECFTLIERHYLGEGPWVLGEQYSVAD
FT                   GYLFTVAGWLKSDGVDIAQFPKVHAHSQRMAQRPAVQRALA"
FT   gene            complement(197869..198051)
FT                   /locus_tag="Ajs_0179"
FT   CDS_pept        complement(197869..198051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40434"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2F9"
FT                   /protein_id="ABM40434.1"
FT                   /translation="MPLPTLRALAAPLLTACALALAACDKKPADPPHLPSVPAVPKPSA
FT                   PAAPLPGAQPASVGS"
FT   sig_peptide     complement(197980..198051)
FT                   /locus_tag="Ajs_0179"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.625 at
FT                   residue 24"
FT   gene            198161..199543
FT                   /locus_tag="Ajs_0180"
FT   CDS_pept        198161..199543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0180"
FT                   /product="DNA replication and repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_0200 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40435"
FT                   /db_xref="GOA:A1W2G0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2G0"
FT                   /protein_id="ABM40435.1"
FT                   /translation="MAKEKTIFSCTECGGTSPRWLGKCPSCGAWNTLIESVPDAGPGKN
FT                   RLSGAGQYAGLAQAQAVMPLAAIEATEVARTASGIEELDRVLGGGVVEGGVVLIGGDPG
FT                   IGKSTLLLQAMDALQRAGLPTLYVTGEESGAQVALRSRRLGLDASQVNVLAEIQLEKIL
FT                   ATVEATQPAVCVIDSIQTVYSDQLTSAPGSVAQVRECAAHLTRMAKATGIAVILVGHVT
FT                   KEGALAGPRVLEHMVDTVLYFEGDTHSSFRLVRAIKNRFGAVNEIGVFAMTEKGLKGVA
FT                   NPSAIFLSQHSEPVPGSCVLVTLEGTRPMLVEIQALVDGGGPSPRRLSVGLERDRLAML
FT                   LAVLHRHAGVACADQDVFVNAVGGVRISEPAADLAVMLAITSSLRGKALPKGFIAFGEV
FT                   GLAGEVRPAPRGQERLKEAAKLGFTVAVVPKANAPKKPIAGLEIHAVERVDEAMTAVRG
FT                   LD"
FT   gene            199613..200053
FT                   /locus_tag="Ajs_0181"
FT   CDS_pept        199613..200053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40436"
FT                   /db_xref="GOA:A1W2G1"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2G1"
FT                   /protein_id="ABM40436.1"
FT                   /translation="MNLRKILIPAGIVVLVIAAYRAYGPQGILTVSGGLVMWGLLHYTR
FT                   LMNVMQKARNHPIGYVGSAVMLNAKLKAGVNLLHVVAMTRALGQQLSADGQQPELYRWT
FT                   DGTQSHVTCEFVNGRLVRWELVRPAPQEDAGPPAAANPAGQS"
FT   sig_peptide     199613..199681
FT                   /locus_tag="Ajs_0181"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.707) with cleavage site probability 0.676 at
FT                   residue 23"
FT   gene            200100..201038
FT                   /locus_tag="Ajs_0182"
FT   CDS_pept        200100..201038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0182"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase, class IV; KEGG: pol:Bpro_0203
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40437"
FT                   /db_xref="GOA:A1W2G2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2G2"
FT                   /protein_id="ABM40437.1"
FT                   /translation="MSPVVPSMADRDGKIWMDGQMVDWRDAKIHVLTHSLHYGCGAFEG
FT                   VRAYKTEQGTAIFRLEEHTNRLFNSAKILRMTIPFTKDEVNEAQKAVVRENQLESCYLR
FT                   PLTWIGSEKLGVSPKGNKIHLIVAAWAWGAYLGEEGMQRGIRVKTSSFTRHHVNITMTQ
FT                   AKASSNYTNSILANMEATDDGYDEALLLDSAGFVSEGSGKNVFIIKDGVVYTPDLSAGA
FT                   LNGITRNTVFHICKDLGLELVQKRITRDEVYIADEAFFSGTAAEITPIRELDRVQIGSG
FT                   SRGPLTEKIQSAFFDIVNGRNPKYAHWLTKV"
FT   gene            201043..201249
FT                   /locus_tag="Ajs_0183"
FT   CDS_pept        201043..201249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40438"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2G3"
FT                   /protein_id="ABM40438.1"
FT                   /translation="MSQAIVELLAKDLNLQGGVYCPSPKAGMKLWNSHPKVYLDVAHTG
FT                   EAKCPYCGTVYRLKAGEVVHSGH"
FT   gene            201358..202665
FT                   /locus_tag="Ajs_0184"
FT   CDS_pept        201358..202665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0184"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: msu:MS0243 RfaL
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40439"
FT                   /db_xref="GOA:A1W2G4"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2G4"
FT                   /protein_id="ABM40439.1"
FT                   /translation="MTIDDLLGPGPWPRRVATAAVFLVPALALTVQSGYSYGAALLLVG
FT                   ALCSLHGWPRLPQDRWTWAFAAAMSCIGVLWLVLANPLEGLGGWDRPSKFAFGIVCLLF
FT                   VSTAAPKPRAQFWGLLVGCAGAGVVALWQVYVENSPRASGFPTGRTNAIQWGNLALLMG
FT                   TMLAVQTLALREHLSRRAVAMACVGGLLALNASVLSQSRGGWLALLMATPVGLYFLWHF
FT                   YRRELWRMLAGTTIALVVLGAANHKVLAERWNVMEKEVLIYGSERAADTSVGQRLEHWR
FT                   FAWEVGLEKPLLGWGMRGYLAEKEKRVAAGQYEPSILEYIYTHNEPLDMFIKAGLVGVL
FT                   LLLLFYAVPLGMFWPTRARMAAYAGQAAEVRAQVLALRMAGVCIPLLYAGFGMTQVFFA
FT                   HNSGIMFYLFMVMTTWSAVRGMDALYAGKGSAAAAA"
FT   gene            202674..203831
FT                   /locus_tag="Ajs_0185"
FT   CDS_pept        202674..203831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0185"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   sth:STH1101 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40440"
FT                   /db_xref="GOA:A1W2G5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2G5"
FT                   /protein_id="ABM40440.1"
FT                   /translation="MVSAASAPGLPGAAGAPAMRRPRVLHFVTGGFSGATQVAVDLVRA
FT                   HAASGRCEALLVLRRKRHTRNERVQALRDQGLAVETVAGWAHVATIWQLVALCRRFQPD
FT                   VLVAHGFSEHLWGRYAGLIAGVPHLVHVEHNSRERYTAWRLRQALWLAERTDLIVGVSE
FT                   GVRQSLLARGFPAAKTVAIPNGIALGPYELARHPAWADRVPGIVMAARFARQKDHATLL
FT                   RAVALLRDRGLTPPVKLAGGGKAAAQRAARKLCTALGLDGQVEFLGHCGDVPGLLMGHR
FT                   ICVLATHYEGMPLSLIEGMAAGCAVVGSRVVGAQEVIDDGRNGLLAEHADPQSLADALA
FT                   RLLTRDDEARRLAQAARQDALRLYSLQTMTARYEDLLLQGLEAAR"
FT   gene            203828..204874
FT                   /locus_tag="Ajs_0186"
FT   CDS_pept        203828..204874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0186"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   sma:SAV5093 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40441"
FT                   /db_xref="GOA:A1W2G6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2G6"
FT                   /protein_id="ABM40441.1"
FT                   /translation="MSALAAPWLSILVPVYNVQDYLDECLTSVVDQMAALPDGGAGVEL
FT                   LVLDDRSTDGSRALMDALARRWPGRLTLMQHAVNQGLSAARNTMIDAARGEYIWFLDSD
FT                   DKLLPGALAGLQAAVRRHAPDAVLCDFAVWRERQRLKHRLRGEAHRRTFAGPAGGPFQD
FT                   RAELLAGLFLTGQLHAWSKITRRALWGADLRFPPGRYFEDMATMPLVLLRARSYCHVRA
FT                   PWVAYRQRGSSILATMTLPKALDQSRALGDLARALGTAEAAGDPPANARLHFALAHQCA
FT                   RNLVGAARFVQRAALPGAERQAAARQLRADFAAASPLPVPTLLRAYARRGWWLRAAKLL
FT                   RIYGVMDL"
FT   gene            204871..205848
FT                   /locus_tag="Ajs_0187"
FT   CDS_pept        204871..205848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmr:Mmar10_2764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40442"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2G7"
FT                   /protein_id="ABM40442.1"
FT                   /translation="MTAPVSTTAWKHRGELWLARWLRRWYKVRPLWLEGAPAPEFTLYS
FT                   TGVADVVRAPAAAIPPIIWAYWHGATPPLVRHCFDNWRRLHPHFEIRILDERTALRYLP
FT                   AIPAALDGVSAAKRADWIRLELLSRYGGIWLDASTILTRPLDWVLEQQARTGADFVGYY
FT                   LQRFTSVPDRPVVENWFMAAPPASPFIEDLRREFTQEVIARTGEQYMEHLRAQGLYQQA
FT                   VQCIDDPVYLSMHMALQVVLLRGGGYRLCLAKAEDGPFYYHVLGRWNRAALKLRLLFAR
FT                   VRGPLPPLIKLRGPDRRRLDDYLARGLYLPESVAGRWLMGDSPR"
FT   gene            complement(205909..206973)
FT                   /locus_tag="Ajs_0188"
FT   CDS_pept        complement(205909..206973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0188"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   bcn:Bcen_2830 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40443"
FT                   /db_xref="GOA:A1W2G8"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2G8"
FT                   /protein_id="ABM40443.1"
FT                   /translation="MNALLQRLQIDLPLFQGPMTGSDTPQLAAAVSQAGGLGFLGCGMR
FT                   SPQAMREAAAAVRAATAKPFGMNLFVLEQPTPDAATVQAAIDRLAPLYADLGLPPPEAP
FT                   ARWCEDFHAQFEALLEARPAVASFTFGILSAAQVRRLQDEAGCYVIGTATTLAEAQAWA
FT                   AVGADAVVASGMEAGGHRGTFLGDYDASMVGTLALVPQCVDALAIPVIAAGGIMDGRGI
FT                   AAAQALGAQAVQMGTAFLACPESAISPAQRAAMAGAQATDTRVTRIYSGRPARGIVNAM
FT                   MERLAAHEADVPAYPVQNALTGALRRAAAAQGRADYLSLWAGQGVGAARPLPAAQLVAL
FT                   LAQEWLATLQRLEV"
FT   gene            complement(206978..207880)
FT                   /locus_tag="Ajs_0189"
FT   CDS_pept        complement(206978..207880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0189"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pae:PA4203 probable
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40444"
FT                   /db_xref="GOA:A1W2G9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2G9"
FT                   /protein_id="ABM40444.1"
FT                   /translation="MDLVALEIFRTVAHEGSVTRAAERLGRAQSNVTTRVQQLEEQLGT
FT                   ALFLREGRRMVLTPAGATLQGYAERLLALAEEARQALHPGTPAGHLRIGAMESTAAARL
FT                   PAPLAQLHARWPALVLELRTAPSRQLVEQVLAHELDCALVAWPPPGLDEEAPVQRTPVW
FT                   TESLLLALPASHPPAETPADLRVHTLAAFAHGCTYRRIGEDWMRQATGQAPQVLELASY
FT                   PAILACVAGGRCAGVVPEAVVDLLHTPPALRWVPLGPCDTVLVHRTGYATPALAALQAA
FT                   LHGAQDTPSVLAPDSSLRS"
FT   gene            207960..209228
FT                   /locus_tag="Ajs_0190"
FT   CDS_pept        207960..209228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0190"
FT                   /product="protein of unknown function DUF1228"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1; KEGG: pol:Bpro_1488 protein
FT                   of unknown function DUF1228"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40445"
FT                   /db_xref="GOA:A1W2H0"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2H0"
FT                   /protein_id="ABM40445.1"
FT                   /translation="MEPQATPSIDVPAPRGPALHWSERPHAVALAGMMALAVAMGVGRF
FT                   AFTPLLPMMLHDGVLTLTEGSWLATANYVGYLLGALACMALPWVAPGFYARWHPARLAR
FT                   AGLVATVLLTLAMALPVAAAWPALRFAAGAASAFVLLNVAAWCMVRLAVLGRPAMGGLI
FT                   FCGPGVGIVLTGLAASAMVAAQWRAASGWVVFGVLSVLLCVGVWPVVRGRAVKTDAGAQ
FT                   PRAAAQGGNAGTLAARGVHAVAYGLAGLGYIVTATFLPVIARAALPSGSPWPDLFWPMF
FT                   GAGVAVGAALSTRAPSGWDRRWLLLAAYALQALGIVLGLLWPTPAGFALSSALVGLPFT
FT                   AITFYGLQEARRLWPQSADSFASLVTAVYGLGQIAGPPLVAWLLAHADAGQGFARGLAL
FT                   AAGALVAGAAMYGWSAWRWPQRA"
FT   gene            complement(209236..209964)
FT                   /locus_tag="Ajs_0191"
FT   CDS_pept        complement(209236..209964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0191"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   pae:PA2229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40446"
FT                   /db_xref="GOA:A1W2H1"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2H1"
FT                   /protein_id="ABM40446.1"
FT                   /translation="MNMTPLPSQPTALGTLRAVLTDRAQPYTRPGSRSAIAKQARSGPV
FT                   AVGAEGLDGDEQGDLRVHGGPDKAVHCYAWPQYTPWREELAGHATAQALLAQPGAFGEN
FT                   FSLDGVQEAQVCIADQWRIGSAVFEVSQGRQPCWKLNDRFQVPGMALRVQRSLRAGWYL
FT                   RVLQPGTVQAGDTVWLLARPRPAWPIARLLEVIDRRDCTPATLREILALPLPPSWQRLF
FT                   QRRLDSGRSEAWDARLQGQH"
FT   gene            complement(209961..210524)
FT                   /locus_tag="Ajs_0192"
FT   CDS_pept        complement(209961..210524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbr:BB2475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40447"
FT                   /db_xref="GOA:A1W2H2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2H2"
FT                   /protein_id="ABM40447.1"
FT                   /translation="MTAAASFFAPAPPLQVAHWFNTPEPLTLDSLRGRVVVLHAFQMLC
FT                   PGCVEHGIPQARRVHEAFASDQLVVIGLHTVFEHHAVQGTPEALQAFIHEYRLRFPIGL
FT                   DQPDAPRSIPRTMQSLSLSGTPSLVVLDPQGRVRLHHFGHLDDLRLGALLGRLLAEPTP
FT                   AAPATVPATGCDDGGCPLPDQPRP"
FT   gene            complement(210609..211889)
FT                   /locus_tag="Ajs_0193"
FT   CDS_pept        complement(210609..211889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0193"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: rfr:Rfer_0509 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40448"
FT                   /db_xref="GOA:A1W2H3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2H3"
FT                   /protein_id="ABM40448.1"
FT                   /translation="MSSPSSRTDLPLLKSLARMSLISPFSRRLYLRIWLAVVGGVLVFA
FT                   FAVGMAWRWAAEQNQQQPPSREIRITDAAGRTLVDGVGLRQRRDPSEGVLYRIESATGE
FT                   VFEMHLSPRPPRPRPDERGPAAWFRPPFGFLWMLALVGIAVTVGVFPIIRRLLQRLEQL
FT                   QRSVQRFGEGDLSVRVPEHGHDEVAALARQFNAAAARIETLVQSHKSLLANASHELRSP
FT                   LTRIRMGLELMQGGTPSPAFRAEIERNIAELDQLVDEILLASRLDSGAADVGTVEPVDL
FT                   VGLAVEECVRVDAELHVGSGDGADAMTAPVEVPGVSKLLRRAVRNLLENARRYSQGEIT
FT                   LTLTREGHDAVLRVCDHGPGVPPAQRERIFEPFYRLPGASERSGGVGLGLALVRSIAAR
FT                   HGGSVVCEDRPDGAAGACFTLRLPVTR"
FT   sig_peptide     complement(211722..211889)
FT                   /locus_tag="Ajs_0193"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.881) with cleavage site probability 0.650 at
FT                   residue 56"
FT   gene            complement(211864..212619)
FT                   /locus_tag="Ajs_0194"
FT   CDS_pept        complement(211864..212619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0194"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rfr:Rfer_0510 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40449"
FT                   /db_xref="GOA:A1W2H4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2H4"
FT                   /protein_id="ABM40449.1"
FT                   /translation="MAPGEHGSTERHRMSSQLLMIEDDHRLAQMVGEYLGQSGLQVTHM
FT                   ADGTSGLARLQAPEGGQLPDLVILDLMLPDIDGLEVCRRIRALPGAAAQVPVLMLTAKG
FT                   DPMDRVIGLEIGADDYLPKPFEPRELLARIRAILRRRESGAQPATQVLRFGSLEIDRDA
FT                   RTVSVHGQPAELTSYQFDLLVTMAERAGRVLTRDQIMEAVRGRELEAFDRSIDVHMGRI
FT                   RAAIEADPKNPRRILTVRGVGYVFAKQQD"
FT   gene            212784..213425
FT                   /locus_tag="Ajs_0195"
FT   CDS_pept        212784..213425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0195"
FT                   /product="type III restriction system methylase"
FT                   /note="KEGG: cte:CT1159 type III restriction system
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40450"
FT                   /db_xref="GOA:A1W2H5"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2H5"
FT                   /protein_id="ABM40450.1"
FT                   /translation="MSLVKSKQRVADHGEVFTPPWMVEAMLDLVKDEAERIDARFLEPA
FT                   CGSGNFIVQILRRKLAAVERKYGKSDFERRHYALLGLMCIYGIELLADNIAECRANVLE
FT                   VFADYLQLDEADDLYRAALYVLLQNLVHGDALTMRDHHGQAITFAEWGYLGKGKYQRRD
FT                   FRFDALTGASKFSEEGSLFADLGKHEIFTPVTIHPPMTVGELAALPKDSI"
FT   gene            213422..214288
FT                   /locus_tag="Ajs_0196"
FT   CDS_pept        213422..214288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0196"
FT                   /product="DNA-damage-inducible protein D"
FT                   /note="KEGG: cch:Cag_1524 DNA-damage-inducible protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40451"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2H6"
FT                   /protein_id="ABM40451.1"
FT                   /translation="MTDTIVPQLTARFDELSQRLPDDGIEFWFARDLMEPLGYARWENF
FT                   TTAIHRAIESCKSTGYKESDHFRGVTKMVTLGSGAQRPVEDFMLTRYACYLIAQNGDPR
FT                   KQAIAFAQSYFAVQTRKQELIEDRMRLQARLEARDRLRESEKALSQNIYERGVDDAGFG
FT                   RIRAQGDAALFGGHTTQMMKEKYGIVQTRPLADFLPTLTIAAKNLATEMTNHNVQQANL
FT                   LGERSITHEHVQNNQSVRVMLGQRGIAPEQLPAEEDIKKLERRVKAEDKKIEKQSGKLP
FT                   GPEGQNV"
FT   gene            214296..215984
FT                   /locus_tag="Ajs_0197"
FT   CDS_pept        214296..215984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0197"
FT                   /product="Eco57I restriction endonuclease"
FT                   /note="PFAM: Eco57I restriction endonuclease; KEGG:
FT                   cte:CT1160 type III restriction system endonuclease,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40452"
FT                   /db_xref="GOA:A1W2H7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2H7"
FT                   /protein_id="ABM40452.1"
FT                   /translation="MSITLQAPFALHGRNPDVLTCIANLSNDEVFTPPELAGRMLDLLA
FT                   NAWAADHGGASLWADKTVRFLDPFTKSGVFLREITSRLTAGLAQEIPDLPTRVNHILTQ
FT                   QVFGIAITRLTSLLARRSVYCSKYANSAHSIAHGFASDMGNIWFERTEHTWVQGKCRFC
FT                   GASQAALDRGEGLETHAYAFIHTDNIKARMAELFGADMQFDVIIGNPPYQLSDGGYGTS
FT                   AAPIYQLFVEQAKKLEPRYLSMVIPARWFAGGKGLDEFRESMLSDNRLRSMDDFLSASE
FT                   VFPGVGLKGGVCYFLWNRDHPGLCNVSTHFKDWPTSTATRPLMENGADIFIRFNEGLSI
FT                   LKKVMATEQSVSQSVSQSVSQKHALKLPESKRFDLLVSSLRPFGFRTYFRGRARKRQGD
FT                   VAIYQNGGTGYVAQEEVETGTELIDKWKIYVGRAAPGTGNRDTYPHRILSTPFIGEPGS
FT                   ICSETYLCIGPFDTQTEAESALSYLTCRLTRLLILLHKPSQDTTRKVYTFVPTQDWTKR
FT                   WTDEDLYAKYGIEPHEIEFIEKVVRPMDLNSDLLGDVTVDESDDE"
FT   gene            215965..218511
FT                   /locus_tag="Ajs_0198"
FT   CDS_pept        215965..218511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0198"
FT                   /product="type III restriction system endonuclease,
FT                   putative"
FT                   /note="KEGG: dge:Dgeo_0923 type III restriction system
FT                   endonuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40453"
FT                   /db_xref="GOA:A1W2H8"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2H8"
FT                   /protein_id="ABM40453.1"
FT                   /translation="MKVMMNKPAIDEVLPPKPEARPRIYAYSIADAAHHGQLKVGQTTR
FT                   NVQQRVAEQLKTAAIQNFTIELDEPAERDDGSVFSDHEVRAALVRKGFANTQLEWMRCT
FT                   LADVQTVLAELRSGKPLGGTHHETFGLRAEQAEAVNKTFDYYQSIWAEDPQAAPRFLWN
FT                   AKMRFGKTFTTYQLAKKLQARRVLVLTFKPAVEDAWQTDLENHVDFAGWQYLSRTSGSD
FT                   PRQADPGRPLVYFGSFQDLLGRDAAGNIKARNEWLHTLNWDVVVFDEYHFGAWRDTAKE
FT                   LFEGEDDASVKKEKELEGVLEQVNEELGMRATLETDFLPITTRAYLYLSGTPFKALATG
FT                   EFIEEQIFNWTYTDEQRAKAAFAAAHPSQRNPYGALPQMRLLTYQMPDELLAVASGGEF
FT                   DEFDLNAFFEATGSGSGAQFKHKGDVQKWLDIIRGGHLAQSVELLKTGTRPPFPYSDVR
FT                   LLPYLQHSFWYLPDVAACHAMANLLAERHNTFWHGYQVIVAAGSAAGIGLAALPPVRRA
FT                   IGSGFDSQTITLSCGKLTTGVTVAQWSAILMLRNLKSPESYFQAAFRVQSPWSIKNPNG
FT                   DNPNEEEILKPVCFVFDFAPTRALRQLSEYGIGLSPGESNPENAVGDLVAFLPVLAFDG
FT                   AHMTQIDAGGILDIAMAGTSATLLARKWESALLVNVDNGTLRRILDNPEAMAAVERIEG
FT                   WRALGDNVIETIINKSEKVKALKQKAKDEELSAREKKELSAEEKEYRSKRKLVQEKLIK
FT                   FATRIPAFMYLTDFRENTLQDVITKLEPELFLTVTGLTVQDFHLLVQLKVFNTEQMNAA
FT                   VFAFRRYEDASLRYTGIASHPGLTHIGLYDTVVAMA"
FT   gene            complement(218549..219892)
FT                   /locus_tag="Ajs_0199"
FT   CDS_pept        complement(218549..219892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0199"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rfr:Rfer_0516 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40454"
FT                   /db_xref="GOA:A1W2H9"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2H9"
FT                   /protein_id="ABM40454.1"
FT                   /translation="MPPDAPASAAARRSWRQAWLVYLEPASLRMLALGFAAGLPLLLVL
FT                   GTLSFRLREAGIDRTTIGYLSWVGLAYAFKWVWSPLVDRLPLPLLTRWLGRRRSWLLLA
FT                   QALVMAGLVGMALADPRDALGPMVWCALLVAFGSATQDIALDAFRIESADADHQAALAA
FT                   TYQTGYRLAMIWAGAGVLWVAARAEVAGLAGYQASAWATAYLVMAASMLVGTVTVLLSP
FT                   EPQSDAARPLAPARNLGEWLRGAVVAPFADFIRRYRWQAALILALIAVYRISDVVMGIM
FT                   ANPFYVDMGYTKDEVAAVSKVFGVIMTLAGAFVGGVLSMRLGVMRVLMLGAVLSALTNL
FT                   LFAWLSGHGHDLTALVAVVSADNLAGGIASAAFIAYLSSLTNVQYSATQYALFSSMMLL
FT                   APKWLAGFSGQFVDAYGYSAFFTSTALLGLPVLLLVALAHRAKKASSA"
FT   gene            219954..220655
FT                   /locus_tag="Ajs_0200"
FT   CDS_pept        219954..220655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0200"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   SMART: helix-turn-helix- domain containing protein, AraC
FT                   type; KEGG: pol:Bpro_0312 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40455"
FT                   /db_xref="GOA:A1W2I0"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2I0"
FT                   /protein_id="ABM40455.1"
FT                   /translation="MARSASALLHPVASVRHYGGEHQAHAHAHAQVLYALHGRMELEVA
FT                   GRAAFVDTACGMVVPAGTEHGYLARPDTRILVIDVPAQAAVDCVRRFAVPAAARTVPEP
FT                   GGAAARLALLLQAPRVLARRGLDLAALCAAVDAALHEDWPTARMARLFHLSAARFHARL
FT                   LELTGDTPQQWLRARRLDLAERALARGQSLEATALRCGYASASALAYALRRERGLGARA
FT                   LRIQAKTASSA"
FT   gene            220754..221659
FT                   /locus_tag="Ajs_0201"
FT   CDS_pept        220754..221659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0201"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rsp:RSP_3308 possible transporter, DME
FT                   family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40456"
FT                   /db_xref="GOA:A1W2I1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2I1"
FT                   /protein_id="ABM40456.1"
FT                   /translation="MNTASIRSIAMVLLAAMLWGTTGTAQSLAPAGLSPYWVGALRLVI
FT                   ASAFFALLAWPAWRARRGGGLRWGPVLLAGACVATYNLSFFAGVKSAGVALGTALAIGS
FT                   GPIWAGLLQTVAQRRLPAPVWWLGTLLGVAGGAAMALDGGSTVRAPWTGIALCLLAGLA
FT                   YAMYALTNKRLVAQAGAAVVNLAVFGMAGLLSLPVALLLGGAPTVAPGALGIVLYLGLV
FT                   ATGVAYLLFSTALRHISGATGVTLALAEPVTAFALAVAVVGESPSAMAYGGLAAVLAGL
FT                   LLVIWAELRTTRPAVGAAAA"
FT   sig_peptide     220754..220837
FT                   /locus_tag="Ajs_0201"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.496 at
FT                   residue 28"
FT   gene            221756..222103
FT                   /locus_tag="Ajs_0202"
FT   CDS_pept        221756..222103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0202"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_A2446 probable signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40457"
FT                   /db_xref="InterPro:IPR024446"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2I2"
FT                   /protein_id="ABM40457.1"
FT                   /translation="MRKGQPMNHRQRAVAALLGLAAACAQAEVNVSVGIGLPGPIYAEP
FT                   APVYVAPPPAYVVPRPVYAPRPVMVVPQPVYAPHWRDDDHDEWKKWRKRHHKEQKKAYK
FT                   RWRREWEDNDD"
FT   sig_peptide     221756..221839
FT                   /locus_tag="Ajs_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 28"
FT   gene            222189..223064
FT                   /locus_tag="Ajs_0203"
FT   CDS_pept        222189..223064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0203"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: pol:Bpro_0210
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40458"
FT                   /db_xref="GOA:A1W2I3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2I3"
FT                   /protein_id="ABM40458.1"
FT                   /translation="MNSPTVSVPPLPVDAGCRCCAARGGTWQARRAFVLAAAGTLVLPA
FT                   AAQVEVGSASGMRRLVPAETLEDSAVQQYSQLLAQAKAKRALAPDNHPQLLKLRAIARQ
FT                   IIPYAAQWNSRAAQWRWEVNLIGSKQINAFCMPGGKIAFYTGILDQLKLTDDEIAMVMG
FT                   HEMAHALREHARSRVAKSQVTSIGLSLGAQLLGLGDLGNAAANLGAQLLTLKFSRSDET
FT                   DADLVGLELAARAGYNPQAAVSLWRKMGEATGNGGIAFLSTHPSGPDRIRELEQNVPKV
FT                   QGLYQAARGG"
FT   gene            complement(223101..223889)
FT                   /locus_tag="Ajs_0204"
FT   CDS_pept        complement(223101..223889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0204"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: bur:Bcep18194_B2973 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40459"
FT                   /db_xref="GOA:A1W2I4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2I4"
FT                   /protein_id="ABM40459.1"
FT                   /translation="MAKRSFHPLIALPGGDAAEDAALYDAPSRTLIEQTYATLRSDIVE
FT                   GRLAPGSKLRIEHLRTQYAVGAGTLREALTRLVSDALVTVEGQRGFRVAPIALQELEDI
FT                   TTLRVHIETDALRQSIRAGDAQWREALAEAYAAISAEEQPIAPHRRRQWELLNVRFHEA
FT                   LLAGHDSPWTVRVLRLLSRHSERYRFCAMGLPGGVRDVHAEHTEIFELAMSGQDARAAL
FT                   ALEAHIRATPDLLIRALREGRAFLPGCAPPQLQVKSAASP"
FT   gene            complement(223914..225614)
FT                   /locus_tag="Ajs_0205"
FT   CDS_pept        complement(223914..225614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0205"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; 4-vinyl reductase,
FT                   4VR; Activator of aromatic catabolism; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B2972 sigma54 specific transcriptional
FT                   regulator with PAS sensor, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40460"
FT                   /db_xref="GOA:A1W2I5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2I5"
FT                   /protein_id="ABM40460.1"
FT                   /translation="MSCQRPPSPPLPSDADLRRLVHFSPVDGRIWLADQRMLLVHAAAF
FT                   QALRRELVASLGQAHTRRLLMRAGYASGERDALLARQVRPHASLFDAFAVGPQLHMLEG
FT                   AVRVQPQVFEHDEAADHFHGVFQWDHSWEAEVHQRAWGPQDAPVCWMLVGYASGYTSAF
FT                   FRRPVLFKETQCTACGHAHCLIEGRFEHEWPDGEQLARDYDPDSMLVRLGELQSQVDAL
FT                   RTQLQPADDQGPLLGRSRAFNDTVELLRKAAPTQVTVLLTGETGVGKERFARALHAMGP
FT                   RADKPFVAVNCAALPAELIESELFGAEKGAYTGATAARVGRFERAHGGTLLLDELGELP
FT                   LPAQAKLLRVLQQGEVERLGGTQPRKVDVRVIAATNVDLEKAVEEGRFRRDLLYRLNVY
FT                   PIRIPALRERADDIELLAMHLLQRYAALHGKRLAGFTDLAMTAMRQHAWPGNVRELENL
FT                   VERGVILAPHDDLVDAAMLFPTSVLPTTHTVNAAGALESEAHCQQSAGLYDTLQASGLT
FT                   LDALEDALIREAVARAGGNLAAAARALGLTRPQLSYRLSRLQERPLAAS"
FT   gene            225908..226123
FT                   /locus_tag="Ajs_0206"
FT   CDS_pept        225908..226123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0206"
FT                   /product="phenol 2-monooxygenase P0 subunit"
FT                   /EC_number="1.14.13.7"
FT                   /note="PFAM: Phenol hydroxylase subunit; KEGG:
FT                   dar:Daro_3797 phenol hydroxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40461"
FT                   /db_xref="GOA:A1W2I6"
FT                   /db_xref="InterPro:IPR010353"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2I6"
FT                   /protein_id="ABM40461.1"
FT                   /translation="MTCTATEAPATTPQPVCDLSQRFVRVLGRRDNGLVEFSFSIGWPE
FT                   LAVELMLPAPAFEAFCVNNRVQRLDT"
FT   gene            226170..227165
FT                   /locus_tag="Ajs_0207"
FT   CDS_pept        226170..227165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0207"
FT                   /product="phenol 2-monooxygenase P1 subunit"
FT                   /EC_number="1.14.13.7"
FT                   /note="PFAM: methane/phenol/toluene hydroxylase; KEGG:
FT                   reu:Reut_B5681 methane/phenol/toluene hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40462"
FT                   /db_xref="GOA:A1W2I7"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2I7"
FT                   /protein_id="ABM40462.1"
FT                   /translation="MNIDLQAREITPLRQTYAHVAKYIGGDKTASRYQEATFGAQPMVN
FT                   FHYRPTWDPGHELFDASRSKIVLADWYVLKDPRQFYYATWTMARAKQQDAMEANFQFVE
FT                   QRGMVGMMPDAVREKALSVLMPLRHAAWGANMNNASICAYGYGTAFTAPAMFHAMDNLG
FT                   VAQYLTRLGLVLGEPQSLEDGKQAWLDAPEWQGLRRLVEDSFVVSDPFELFVAQNFALD
FT                   GLLYPLIYGGFVDDHVALQGGTAVAMLTSFMPEWHDETARWIDAVIKAAGAESDANKAL
FT                   LRGWAGHWMDRAQAALSPIARLALGETGETVLSDARVQLQARLAKTGVAA"
FT   gene            227191..227460
FT                   /locus_tag="Ajs_0208"
FT   CDS_pept        227191..227460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0208"
FT                   /product="phenol 2-monooxygenase P2 subunit"
FT                   /EC_number="1.14.13.7"
FT                   /note="PFAM: monooxygenase component MmoB/DmpM; KEGG:
FT                   reu:Reut_B5682 monooxygenase component MmoB/DmpM"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40463"
FT                   /db_xref="GOA:A1W2I8"
FT                   /db_xref="InterPro:IPR003454"
FT                   /db_xref="InterPro:IPR036889"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2I8"
FT                   /protein_id="ABM40463.1"
FT                   /translation="MSDVFIAFQHNEESRPVIDAIVADNPNAVLTHPTGLVKINAPGSL
FT                   TIRRETIEGLTGRPYDLQAIHVNLVTLSGYIDEDDDQLTLSWKH"
FT   gene            227485..229029
FT                   /locus_tag="Ajs_0209"
FT   CDS_pept        227485..229029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0209"
FT                   /product="phenol 2-monooxygenase P3 subunit"
FT                   /EC_number="1.14.13.7"
FT                   /note="PFAM: methane/phenol/toluene hydroxylase; YHS domain
FT                   protein; KEGG: reu:Reut_B5683 methane/phenol/toluene
FT                   hydroxylase:YHS"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40464"
FT                   /db_xref="GOA:A1W2I9"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2I9"
FT                   /protein_id="ABM40464.1"
FT                   /translation="MDTRVASKKLGLKERYAAMTRGLGWETSYQPMDKVFPYDKYEGIK
FT                   IHDWDKWQDPFRLTMDAYWKYQGEKEKKLYAVIEAFAQNNGQLGVTDARYVNALKLFIQ
FT                   GVTPLEYYAHRGFAHVGRQFTGEGARVAAQMQSIDELRHYQTETHAISHYNKYFNGIHH
FT                   SNHWYDRVWYLSVPKSFFEDACTAGPFEFLTAVSFSFEYVLTNLLFVPFMSGAAHNGDM
FT                   STVTFGFSAQSDESRHMTLGIECIKFMLEQDPDNVPIVQRWIDKWFWRGYRLLTLVAMM
FT                   QDYMLPKRVMSWKEAWEMYAEENGGALFKDLARYGIREPAGWKQACEGKDHISHQTWAT
FT                   FYNYNGAAPLHTWVPKEDELAWLSEKYPETFDKYYRPRWEFWRDQAAEGKRFYNMTLPM
FT                   LCTTCQVPMLFTEEGDPSKICYRDSDYKAYKYHFCSDHCKSIFDHEPEKYVQSWLPVHQ
FT                   IYQGHCFPEGTDPTAEGFDPLMAVLKYYEMEVGRDNFDFEGSEDQKNFAMWKGDTK"
FT   gene            229026..229382
FT                   /locus_tag="Ajs_0210"
FT   CDS_pept        229026..229382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0210"
FT                   /product="phenol 2-monooxygenase P4 subunit"
FT                   /EC_number="1.14.13.7"
FT                   /note="PFAM: Phenol hydroxylase conserved region; KEGG:
FT                   rme:Rmet_1327 phenol hydroxylase conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40465"
FT                   /db_xref="GOA:A1W2J0"
FT                   /db_xref="InterPro:IPR006756"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2J0"
FT                   /protein_id="ABM40465.1"
FT                   /translation="MSVVAIAPYEFTPRDVRENFPAPLLYIGWEDHLMFCAPVCLPLPP
FT                   DTPFGALSAAVLPGIYGYHPDFARIDWARAEWKKNGQPWTPDPAKSLAENGLVHKDAIR
FT                   FRTPGLTGIKGSFS"
FT   gene            229390..230451
FT                   /locus_tag="Ajs_0211"
FT   CDS_pept        229390..230451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0211"
FT                   /product="phenol 2-monooxygenase P5 subunit"
FT                   /EC_number="1.14.13.7"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   FAD-binding 9, siderophore-interacting domain protein;
FT                   KEGG: reu:Reut_B5685 ferredoxin:oxidoreductase
FT                   FAD/NAD(P)-binding:oxidoreductase FAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40466"
FT                   /db_xref="GOA:A1W2J1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2J1"
FT                   /protein_id="ABM40466.1"
FT                   /translation="MSYQLTIEPLGATIEVEEGQTVLDAVLRQGLYLPHACGHGLCGTC
FT                   KVQVCDGEVDHGAANPFALMDFERDDGKTLACCATLQADTTIEADIDEEPDARVIPVRD
FT                   FAATVSRIEDLTPTIKAIHLQLDKAIDFQAGQYVQVEIPGVGSRAFSIANHPADVVATK
FT                   GIELNVRKLPGGAGTTWLHEQLKAGDRLRVAGPYGRFFVRESACQPMLFMAGGSGLSSP
FT                   RSMIVDLLSRGCTLPITLVYGQRSHEELYYDAEFRALAEQHANFTYVPALSHEPEGSDW
FT                   DGFRGFVHEAAKAHFGGSFAGQKAYLCGPPPMIEACISTLMQGRLFERDIYTEKFLSAA
FT                   DAQAARSPLFRQV"
FT   gene            complement(230438..231358)
FT                   /locus_tag="Ajs_0212"
FT   CDS_pept        complement(230438..231358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0212"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: dar:Daro_3799 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40467"
FT                   /db_xref="GOA:A1W2J2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2J2"
FT                   /protein_id="ABM40467.1"
FT                   /translation="MDLKDMRQFLAVAEERNFTRAAERLHMAQPPLSRQIKALEDEMGA
FT                   PLFLRTPAGVELTEAGQALLDEVPNLLHLVQRAAERTRRAAQGLTGQLDVGIYGSGVLN
FT                   VIPRVLSKFHAQRPEVRIALHNLTKSEQLQALRERRISVGFNRLVPPEPDLVVESVLRE
FT                   PLLVAMHEAHPLAQRRQVGMADLDGLPMILYPNEAIHGLAQEVAEAFRQEGVRLAVEQD
FT                   VEDVVTAVALVASGFGLTIATRSAASLRLPGVVFVPLRSRHLKDLELSCLYRRGDPSPV
FT                   LAMFLEVVRAHGKSEAKGGNGLRPA"
FT   gene            231485..231856
FT                   /locus_tag="Ajs_0213"
FT   CDS_pept        231485..231856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0213"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: reu:Reut_B5686 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40468"
FT                   /db_xref="GOA:A1W2J3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2J3"
FT                   /protein_id="ABM40468.1"
FT                   /translation="MSLFDSRPKFAVHVAQTDETFPCAGNESLLTGMVRLGRKGIPVGC
FT                   VNGGCGVCKVRIVEGQIKALGPISRAHVTLDEENQGYTLACRVAPQTPVNLEVAGKLSK
FT                   PFSKGRAESATASPSIQQQ"
FT   gene            231878..232822
FT                   /locus_tag="Ajs_0214"
FT   CDS_pept        231878..232822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0214"
FT                   /product="catechol 2,3-dioxygenase"
FT                   /EC_number="1.13.11.2"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: reu:Reut_B5687 catechol
FT                   2,3-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40469"
FT                   /db_xref="GOA:A1W2J4"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR017624"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2J4"
FT                   /protein_id="ABM40469.1"
FT                   /translation="MGVMRIGHASLKVMDMDAAVRHYENVLGMKTTMKDKAGNVYLKCW
FT                   DEWDKYSVILTPSDQAGMNHLAYKVEKEADLEALQQKIEAWGVKTTMLDEGTLPSTGRM
FT                   LQFKLPSGHEMRLYASKEFVGTDVGNINPDPWPDGLKGAGAHWLDHCLLVCEMNPEAGI
FT                   NTVADNTRFMTEALDFFLTEQVLVGPEGNMQATTFMARTTKPHDIAFVGGPTSGLHHIA
FT                   FFLDSWHDVLKAADVMGKNKVRIDVAPTRHGLTRGETIYFFDPSGNRNETFAGLGYLAQ
FT                   RDRPVTTWTEDQLGSAIFYHTGYLVPSFTDVYT"
FT   gene            232858..233750
FT                   /pseudo
FT                   /locus_tag="Ajs_0215"
FT   gene            complement(233776..234681)
FT                   /locus_tag="Ajs_0216"
FT   CDS_pept        complement(233776..234681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0216"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: dar:Daro_3799 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40470"
FT                   /db_xref="GOA:A1W2J5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2J5"
FT                   /protein_id="ABM40470.1"
FT                   /translation="MDLRDLRHFLAVAEEGHIGRAAARLHLSQPPLTRHIQALEEKIGV
FT                   PLFVRTPKGMQLTDAGHTLLQETPNLLALAQQALERTRLAGQGLIGQLDVGLFGSGVLD
FT                   VIPRILARFHEERPEVKIVLHNLTKDAQLQALRERRISVGFNRLVPKEADISIETVLHE
FT                   PMVVALAASHPLAVRPSLRLSDLEGMPLILYPNVPLRGLAQEVMDAFRAEGVPLRVEQE
FT                   VQDVVTAVALVAGGFGCCITTRSATSLRLPGVTYRPLRSRHLNDIELSCLYRSDDPSPV
FT                   LAAFLSVVRAFAQVRAAAPA"
FT   gene            234952..235287
FT                   /locus_tag="Ajs_0217"
FT   CDS_pept        234952..235287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0217"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: dar:Daro_3791 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40471"
FT                   /db_xref="GOA:A1W2J6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2J6"
FT                   /protein_id="ABM40471.1"
FT                   /translation="MQKFVVSIEDTGEKYTCAGMRSVLEGMEALGKKGIPVGCRQGGCG
FT                   VCKVQILEGQYVRRVMSRAHVSTEEEAAGCVLSCRIYPTSDVRLQVVGAMKKNICRSLA
FT                   APSSTHP"
FT   gene            235310..236221
FT                   /locus_tag="Ajs_0218"
FT   CDS_pept        235310..236221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0218"
FT                   /product="catechol 2,3-dioxygenase"
FT                   /EC_number="1.13.11.2"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: dar:Daro_3789
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40472"
FT                   /db_xref="GOA:A1W2J7"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR017624"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2J7"
FT                   /protein_id="ABM40472.1"
FT                   /translation="MALTGVLRPGHAQIRVLDLEESVKWYTEVMGLVPMGRAYFKTRSE
FT                   RDHNSVVLRQADQAGIDFFAFKVLDQATLEDFDKKLQAFGVKTERIPAGELLETGERVR
FT                   FQIPTGHTVELYAEKTDVGNGMGYLDPDVDVLDGPGIRPIRMDHCLLYGGDVDGNVRLF
FT                   TEVLGFTLVERVKLEDGKTDLAVWLTCSAKAHDIAFVRHAEDGKLHHVSFQMPSWESVL
FT                   RAADIMSVNRVSIDIGPTRHGITQGTTIYFFDPSGNRLETFCGGYDHYPDMHPITWSWE
FT                   NVGRGIFYHDRKLNDAFLSVVT"
FT   gene            236236..236667
FT                   /locus_tag="Ajs_0219"
FT   CDS_pept        236236..236667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0219"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   reu:Reut_B5688 protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40473"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2J8"
FT                   /protein_id="ABM40473.1"
FT                   /translation="MAQHSVEQRAITAEAANAAVVAAVAKAGELGIRINVAVTDASGVL
FT                   AAFLRMPGAFLHSVDIAIDKAYTSAGFGFATAQWAGILQGDEALRLGMPVRPRNVVFGG
FT                   GLPMREGGALIGGIGVSGGSAEQDEICARAALAALGLDC"
FT   gene            236730..238190
FT                   /locus_tag="Ajs_0220"
FT   CDS_pept        236730..238190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0220"
FT                   /product="2-hydroxymuconate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.32"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: reu:Reut_B5689
FT                   betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40474"
FT                   /db_xref="GOA:A1W2J9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017628"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2J9"
FT                   /protein_id="ABM40474.1"
FT                   /translation="MKEFLNFINGEYVRNASGKTFQDINPVNGSVIGNIYEAGQAEVDA
FT                   AVAAARAALKGDWGRLSVAERCKLLDAVAGEINRRFDDFLQAEIADTGKPHHLASHVDI
FT                   PRGAANFQIFIDTIKSTATESFNMRTPDGKTALSYGVRVPRGVIAVVCPWNLPLLLMTW
FT                   KVGPALACGNTVVVKPSEETPATATLLGEVMNQVGMPKGVYNVVHGFGPGSAGEFLTRH
FT                   PGVNGITFTGETRTGTAIMKAAADGVRPVSLEMGGKNAAVVFADCDFQVTIDTLTRSCF
FT                   ENAGQVCLGTERVYVERPIFDKVVAALKERAEAMKPGLPFDHDTRIGPLISKKHQAKVL
FT                   GLYKTAKDEGATIVTGGGIPDMPEELKNGSWVQPTIWTGLPETATVVTEEIFGPCCHIS
FT                   PFDSEEEVLGKVNANRYGLATAIFTQDIARANRLAHQIEVGLCWINAWFLRDLRTPFGG
FT                   SKQSGIGREGGVHSLEFYTELRNVMVKF"
FT   gene            238264..239124
FT                   /locus_tag="Ajs_0221"
FT   CDS_pept        238264..239124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0221"
FT                   /product="2-hydroxymuconate semialdehyde hydrolase"
FT                   /EC_number="3.7.1.9"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: dar:Daro_1331
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40475"
FT                   /db_xref="GOA:A1W2K0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2K0"
FT                   /protein_id="ABM40475.1"
FT                   /translation="MSTTPSNPEIAHSIEAAGIRTNYHDSGGQGAPVLLIHGSGPGVSA
FT                   WANWRLVMPALAQQARVIAPDMVGFGYTERPQGFVYSMDAWVRQAVGLLDALGIERTDL
FT                   VGNSFGGGLSLALAIAHPERVRRLVLMGSAGVSFPLTEGLDAVWGYTPSVENMRAIMDY
FT                   FAFDQGLMSDDLARLRFEASIRPGFQESFAAMFPAPRQRWIEALASAEADIRALPHQAL
FT                   VIHGREDRVIPLSTSLTLSSWIQRSQLHVYGQCGHWTQIEHAARFARLVGDFLAEASAD
FT                   EPQPL"
FT   gene            239166..239954
FT                   /locus_tag="Ajs_0222"
FT   CDS_pept        239166..239954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0222"
FT                   /product="4-oxalocrotonate decarboxylase"
FT                   /EC_number="4.1.1.77"
FT                   /note="PFAM: Hydratase/decarboxylase; KEGG: dar:Daro_3785
FT                   hydratase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40476"
FT                   /db_xref="GOA:A1W2K1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR017632"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2K1"
FT                   /protein_id="ABM40476.1"
FT                   /translation="MTMTPALIEQLGDELYQALTQRRMLEPLTNRHADITIDDAYAIQQ
FT                   KMLARRLAAGEKVVGKKIGVTSKAVMDMLGVFQPDFGWLTDGMVFNEGQAVQANTLIQP
FT                   KAEGEIAFVLKKTLKGPGITAADVLAATEGVMACFEIVDSRIRDWKIKIQDTVADNASC
FT                   GVFVLGDRLVDPRDVDLGTCGMVLEKNGDIVATGAGAAALGHPANAVAWLANTLGAHGI
FT                   ALEAGEVILSGSLGIMVPVTAGDNLRVTIGGIGGCSVRFI"
FT   gene            239969..240877
FT                   /locus_tag="Ajs_0223"
FT   CDS_pept        239969..240877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0223"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.10"
FT                   /note="PFAM: Semialdehyde dehydrogenase, NAD - binding;
FT                   KEGG: bxe:Bxe_C1188 acetaldehyde dehydrogenase
FT                   (acetylating) (BphJ)"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40477"
FT                   /db_xref="GOA:A1W2K2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2K2"
FT                   /protein_id="ABM40477.1"
FT                   /translation="MTQKIKCALIGPGNIGTDLLAKLQRSPVLEPVWMVGIDPESDGLK
FT                   RAREMGIKTTHEGVDGLIPHMKADGVQIVFDATSAYVHAENSRKVNAQGALMIDLTPAA
FT                   IGPFCVPPVNLKEHVGKAEMNVNMVTCGGQATIPMVAAVSRVQPVAYGEIVATVSSRSA
FT                   GPGTRKNIDEFTRTTAGAIEKVGGAQKGKAIIIINPADPPLIMRDTVHCLVEGEPDKEA
FT                   ITRSIHDMLAEVQKYVPGYKLVNGPVFDGNRVSVFLEVEGLGDYLPKYAGNLDIMTAAA
FT                   ARTAEMFAEEILAGKLTLQAA"
FT   gene            240899..241927
FT                   /locus_tag="Ajs_0224"
FT   CDS_pept        240899..241927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0224"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /EC_number="4.1.3.39"
FT                   /note="PFAM: pyruvate carboxyltransferase; DmpG
FT                   communication domain protein; KEGG: rme:Rmet_1319 pyruvate
FT                   carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40478"
FT                   /db_xref="GOA:A1W2K3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2K3"
FT                   /protein_id="ABM40478.1"
FT                   /translation="MTQKITLHDMTLRDGMHPKRHLMTLEQMKSVAQGLDAAGVPLIEV
FT                   THGDGLGGASVNYGFPAHSDEEYLGTVIPLMKQAKVSALLLPGIGTVDHLKMAHGLGVH
FT                   TIRVATHCTEADVSEQHITMARKLDMDTVGFLMMAHMNDAAGLVKQARLMEGYGANCIY
FT                   VTDSAGYLLPDQVTERIAAVRAALKPETELGFHCHHNLAMGVANSIAAIQAGANRIDAA
FT                   AAGLGAGAGNTPLEVLVAVLDRMGIDTGVDVWKIQDVAEDLVVPLMDFPIRIDRDALTL
FT                   GYAGVYGSFLLFAKRAEKKYGIPARDLLVELGRRGMVGGQEDMIEDTALTMARARGLTV
FT                   NA"
FT   gene            241942..242730
FT                   /locus_tag="Ajs_0225"
FT   CDS_pept        241942..242730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0225"
FT                   /product="4-oxalocrotonate decarboxylase"
FT                   /EC_number="4.1.1.77"
FT                   /note="PFAM: Hydratase/decarboxylase; KEGG: rme:Rmet_1318
FT                   hydratase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40479"
FT                   /db_xref="GOA:A1W2K4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR017630"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2K4"
FT                   /protein_id="ABM40479.1"
FT                   /translation="MALAQDTIAQLAEHLENCQLQAKDTPKITDAHPDMDWDDAYAIQD
FT                   AILARKLARGARVVGLKAGLTSHAKMRQMGVTDPVFGFLVDEYVVPEGATVNTAELIHP
FT                   KVEPEIAFVLKHALKGPGCHIGAVLAATDFVLPGIEVIDSRYRDFKFDLKSVVADNTSA
FT                   SRFVVGGRALRPEDVDLRTVGIVLEKNGEPVALGAGAAVLGHPAAAIAMLANHLGRRGQ
FT                   EIPAGSLILSGGATEAVAVAAGDSVCLRVQGMGSVSLRFA"
FT   gene            242785..243768
FT                   /locus_tag="Ajs_0226"
FT   CDS_pept        242785..243768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0226"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   bbr:BB1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40480"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2K5"
FT                   /protein_id="ABM40480.1"
FT                   /translation="MQRRDFMTAGALAALGATLPGAAWAQSAYPTRPVRLIVPFPPGGP
FT                   TDIMGRTAAKAMGDQLGQQFVVENKAGAGGNIGTDAVAKAAPDGYTLGIAAISSLAISP
FT                   YLYAKLPFNVEKDLQAISLVGTTPNVIVANPRAPFTDLAGMVAYAKANPGKLLYATSGV
FT                   GTGNHLAAELLQKRAEIALTHVPYKGSSQIVPDLISGNVMLSMESSLVTTFQHIKAGKL
FT                   RAIAVTSPQRAPALPDVPTVAESGYPGFVVENWFGLIAPAAMPASMADRLAQAWAAGTQ
FT                   TPEVQAAFQSIHANLRSNTPQQFAQFIRAENERWSPLIRSLGLQLD"
FT   sig_peptide     242785..242862
FT                   /locus_tag="Ajs_0226"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            243788..243979
FT                   /locus_tag="Ajs_0227"
FT   CDS_pept        243788..243979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0227"
FT                   /product="4-oxalocrotonate isomerase"
FT                   /EC_number="5.3.2.-"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG: reu:Reut_B5693
FT                   4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40481"
FT                   /db_xref="GOA:A1W2K6"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2K6"
FT                   /protein_id="ABM40481.1"
FT                   /translation="MPFAQIYMLEGRTEEQKKAVIEKVTQALVDAVGAPPANVRVWIHD
FT                   VPKENWGIAGVSAKELGR"
FT   gene            complement(244055..244693)
FT                   /locus_tag="Ajs_0228"
FT   CDS_pept        complement(244055..244693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0228"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rfr:Rfer_0167 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40482"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2K7"
FT                   /protein_id="ABM40482.1"
FT                   /translation="MLQYHTVPVTPFQQNCSLVWCDQTQDAAVIDPGGDLDVLLAEAQR
FT                   LGLHLKAIWLTHAHIDHAGGTGELAQRLHLPIIGPHEGDQYWIDGLAQQSAMFGFAPAQ
FT                   PFTPTRWLHDGDTVAIGHESLSVRHCPGHTPGHVVFHAPQIDRAFVGDVLFAGSIGRTD
FT                   FPGGNHQQLIDSITQRLWPMGDQTVFIPGHGPESTFGRERRSNPYVGNT"
FT   gene            complement(244796..245494)
FT                   /locus_tag="Ajs_0229"
FT   CDS_pept        complement(244796..245494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0229"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   reu:Reut_B4629 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40483"
FT                   /db_xref="GOA:A1W2K8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2K8"
FT                   /protein_id="ABM40483.1"
FT                   /translation="MLPTLPPEPADDAPEIAPVTAADAVFHGIVQGLAQQRLVPGQRLV
FT                   EVDLAAQFGVSRASVREALQRLAAQGLVDLHRNKGAAIRSLSAQETLEVLDVAERMTGL
FT                   LARSAARAIAAGAPPAPIEAALQQLHEADRSQDADRFASARRALYRALLATSGSRELRR
FT                   LLPSIHMPIVYAQHRPATLQQVRMRDYQAMCQAILAGDAAAADAAGMQHVRNVREAIAP
FT                   ALQADDMRFA"
FT   gene            245619..246818
FT                   /locus_tag="Ajs_0230"
FT   CDS_pept        245619..246818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0230"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   pau:PA14_35970 probable acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40484"
FT                   /db_xref="GOA:A1W2K9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2K9"
FT                   /protein_id="ABM40484.1"
FT                   /translation="MDFSLSPELLALRDKVRQFIAEQVIPLENDGRQSHHGPDEALRNE
FT                   LVSRARAAGLLTPHASRDMGGLGLSHVAKAVVFEEAGYSWLGPTALNIHAPDEGNIHLM
FT                   EEVATPAQKERWLRGQVAGQWRSCFAMTEPAPGAGADPSMLATTAVRDGDDYVINGRKW
FT                   FITGAEGAHYAIIMARMEDRSATMFLTDMDRPGIVLERNMDAMDSCFTGGHGVLRFDNL
FT                   RVPASDVLGEIGKGFRYAQVRLAPARLTHCMRWLGQARRAHDTALAYARKRHAFGKPLA
FT                   EHEGVGYMLADNDMDLHTARLHIWHTAWMLDQGEKCNFESSRAKVVCSEAEWRVVDRSV
FT                   QILGGQGVTGETPVMRIFTDMRAFRIYDGPSEVHRWSMARKLVHMAEKAEAELLHEGGA
FT                   "
FT   gene            246821..247597
FT                   /locus_tag="Ajs_0231"
FT   CDS_pept        246821..247597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0231"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: ppu:PP_2794 oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40485"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2L0"
FT                   /protein_id="ABM40485.1"
FT                   /translation="MDNDVMQRFRLNGKRVLVTGASSGLGQHFARLLAAQGAQVALAAR
FT                   RTDKLQGTVDDINAAGGQARACALDVTDSASVRACFDDLADWGVPDVVINNAGVTVTRP
FT                   LLEQTEADFDQVLDTNLKGCWLVATEAARRMVVAGKGGSVVNVASILGERVAGGVAPYA
FT                   ISKAGVIQATKAMALELARHRIRVNALLPGYVVTDLNRDFLASEAGDKLRSRIPSRRFG
FT                   ELSDLDGPLLLLASDAGAAMSGATVAVDGAHLVSSL"
FT   gene            247594..248634
FT                   /locus_tag="Ajs_0232"
FT   CDS_pept        247594..248634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0232"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   reu:Reut_A1007 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40486"
FT                   /db_xref="GOA:A1W2L1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2L1"
FT                   /protein_id="ABM40486.1"
FT                   /translation="MSGASTSLPLDALGDYLRAQGLAGTGPLAATVLAGGQSNPTFRIT
FT                   TAEGRNYVLRKKPPGALIASAHAIDREYRVMRALQDTAVPVPRMLAYCDDAALLGTPFY
FT                   VMEFLQGRVLMDQSLPGMDPAERTAIYREMNRVIAALHAVDYAAVGLADYGKPGNYVGR
FT                   QVARWSRQCREATVPVTPAMERLMDWLPQHLPQDDETTLVHGDYRLDNLVFHPNEPRVI
FT                   GVLDWELSTLGHPLADLAYQCMAWRIPPSLWRGIGGLDLAALGIPPESEYVGWYEQATG
FT                   RQAAEHWDFYLAYNLFRMAAILHGIAQRAQDGNAAAADAVETGAKAGPLAELGWEAAQR
FT                   YMAGRK"
FT   gene            complement(248739..249542)
FT                   /locus_tag="Ajs_0233"
FT   CDS_pept        complement(248739..249542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0233"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: rfr:Rfer_3929 exodeoxyribonuclease III;
FT                   TIGRFAM: exodeoxyribonuclease III; exodeoxyribonuclease III
FT                   Xth; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40487"
FT                   /db_xref="GOA:A1W2L2"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2L2"
FT                   /protein_id="ABM40487.1"
FT                   /translation="MFKLTSLNLNGIRSATSKGVEAWIAQSRPDCICVQEIKAQSADMQ
FT                   GRFEELAGLKGYFHFAVKKGYSGVGIYARHEPSDVVIGYGSSEFDTEGRYVELRFDTPA
FT                   RRLSIISAYFPSGSSGEERQLAKFRFLEEFHPHLMRLKAEREFILCGDINIAHQQIDLK
FT                   NWRSNQKNSGFLPEERAWMTKLLHISDPAGGLVDVYRQLQPETTDACYTWWSNRGQAYA
FT                   NNVGWRLDYHLATPAIAALARTEEIYKAQKFSDHAPITVGYELSL"
FT   gene            249553..250263
FT                   /locus_tag="Ajs_0234"
FT   CDS_pept        249553..250263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0234"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: pol:Bpro_0217 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40488"
FT                   /db_xref="GOA:A1W2L3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2L3"
FT                   /protein_id="ABM40488.1"
FT                   /translation="MVTDSAQTVEQGASQTRLAQDFVRFAVDSGVLRFGEFKTKAGRMS
FT                   PYFFNAGLFDDGAKLGRLAQFYAQALLASGVEFDMVFGPAYKGIPLAATVAVELARLGK
FT                   NVPFAYNRKEAKDHGEGGTLVGAPLQGKVLIIDDVMSAGTAARESIALIRDAGATPHAI
FT                   AIALDRQEKATENGQDVDHSAVQYVRRELGMQVCAIAKLADLLQYLSAGGGDTQMREHH
FT                   ERVLAYRQRYGVND"
FT   gene            250296..251012
FT                   /locus_tag="Ajs_0235"
FT   CDS_pept        250296..251012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40489"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2L4"
FT                   /protein_id="ABM40489.1"
FT                   /translation="MKAGTRHAGWFMAGATAAALGLLSPVAWAQPKPPQEVYTCIDKTG
FT                   RRITADRPIADCVDREQRILDHTGAERRRIGPTLTEHERAALEVQRRKEAQERARIAEE
FT                   RRRERVLMARYPDEAAHQVEREAALVQVDEVMAVARKRIQELQVERKRIDGEMEFYRRD
FT                   PLKAPMKLQRQIAENDEAVAEQQRFLTAQDQEKRRIHQRFDAELAQLRQLWAAQRAAAS
FT                   QLVPPQSTLVSPGASR"
FT   sig_peptide     250296..250385
FT                   /locus_tag="Ajs_0235"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            complement(251086..252543)
FT                   /locus_tag="Ajs_0236"
FT   CDS_pept        complement(251086..252543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0236"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB N-terminal
FT                   region; GatB, central domain protein; KEGG: rfr:Rfer_3926
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40490"
FT                   /db_xref="GOA:A1W2L5"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2L5"
FT                   /protein_id="ABM40490.1"
FT                   /translation="MTAKLIQGYEVVIGFETHTQLATRSKIFSRASTAFGAEPNTQACA
FT                   VDLALPGTLPVMNREAVACAIKLGLALGSHIAPESIFARKNYFYPDLPKGYQISQFEIP
FT                   VVQGGEVSFYLGDEKKTVRLVRAHLEEDAGKSLHEDSSLGGGGQSGIDLNRAGTPLLEI
FT                   VTEPDIRSSEEAVAYAKELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGQPLGTRREI
FT                   KNLNSFKSMQQAIDYEIRWQIEEIEDGRAIQQATVLFDPDTGETRAMRTKEDAADYRYF
FT                   PDPDLPPLRIAAPWIDDIKAQMPELPRAMAARFVQQYGLPEYDATTLTQSQAMAAYFED
FT                   AAKGCGQPKLASNWVMGEISRRLNAEEIGVEQAKVNSAQLAALIGRINDGTISNNAARQ
FT                   VFEALWSGEGHDVDAVIEAKGLKQMNDTGALEKIIDEVIAANAANVEQYKAGKDKAFNA
FT                   LVGQVMKASKGKANPQQVNDLLKAKLA"
FT   gene            complement(252546..254048)
FT                   /locus_tag="Ajs_0237"
FT   CDS_pept        complement(252546..254048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0237"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: rfr:Rfer_3925
FT                   glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40491"
FT                   /db_xref="GOA:A1W2L6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2L6"
FT                   /protein_id="ABM40491.1"
FT                   /translation="MSNTPSSELHDLGIAQLTSALRSKQVSAVEAAQHFLARARQHQNL
FT                   GAYVAMNEDATLAQARAQDAALAAGTAAPLAGVPIAHKDIFVTRDFPSTAGSKMLAGYH
FT                   SPFDATVVTRLADAGCVTLGKLNCDEFAMGSANENSAVAPVGCDAPAPVRNPWDTSRIP
FT                   GGSSGGSAVAVSARLAPAVTGTDTGGSIRQPASFCGVTGIKPTYGRASRYGMIAFASSL
FT                   DQAGPMARSAEDCALLLSAMCGPDPDRDSTSLDVPAEDFSAQLNDSIDGLRIGIPAEFF
FT                   GDGLAGDVRAAVDAALKEYEKLGAKLVPISLPRTELSIPVYYIIAPAEASSNLSRFDGV
FT                   KFGHRAKDYADLVDMYKKTRAEGFGDEVKRRIMIGTYVLSHGYYDAYYLQAQKIRRMIA
FT                   DDFQNAFKDCDLIAGPVAPSVAWKLGEHGNDPLADYLADIFTLPASLAGLPGMSVPAGF
FT                   GAGGMPVGLQLIGNYFQEGRLLNAAHRLQQATDFHLRAPEGI"
FT   gene            complement(254059..254427)
FT                   /locus_tag="Ajs_0238"
FT   CDS_pept        complement(254059..254427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0238"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; KEGG: rfr:Rfer_3924 glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40492"
FT                   /db_xref="GOA:A1W2L7"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2L7"
FT                   /protein_id="ABM40492.1"
FT                   /translation="MNNSPWRSPESRFTYGFRPSLFPMALTPQDIGRIANLARLELSPG
FT                   ESERMLTQLNGFFGIVEKMQAVDTHGIAPLSHPVAVVRDVQLRLREDVASEPDQREANQ
FT                   RSAPAVERGLFLVPKVIE"
FT   gene            254564..255607
FT                   /locus_tag="Ajs_0239"
FT   CDS_pept        254564..255607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0239"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: pol:Bpro_0222 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40493"
FT                   /db_xref="GOA:A1W2L8"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2L8"
FT                   /protein_id="ABM40493.1"
FT                   /translation="MFGAFRRYFSTDLAIDLGTANTLIFARDKGIVLDEPSVVAIRHEG
FT                   GPHGKKVIQAVGHEAKAMLGKVPGNIEAIRPMKDGVIADFVITEQMIKQFIKMVHPRSV
FT                   LTPSPRIIICVPCGSTQVERRAIKDAAEAAGATAVYLIEEPMAAGIGAGLPVSEASGSM
FT                   VVDIGGGTTEVGVISLGGMVYKGSVRVGGDKFDESIINYIRRNYGMLIGEPTAEAIKKN
FT                   IGSAFPGSEVKEMGVKGRNLSEGVPRSFTISSNEVLEALTEPLNQIVSAVKNALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEEPLTCVVRGCGIALERMDRQ
FT                   GSIFTSD"
FT   gene            255637..256554
FT                   /locus_tag="Ajs_0240"
FT   CDS_pept        255637..256554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0240"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: pol:Bpro_0223 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40494"
FT                   /db_xref="GOA:A1W2L9"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2L9"
FT                   /protein_id="ABM40494.1"
FT                   /translation="MPLGTLDRSAPTLFKQGPSPLSRLTLYSALALFLMVADARFHLTE
FT                   PLRKAVSTALYPLQWLMLQPVEFADKGAGYFQSLQAAQQGMDDAQRTMAQMAVRAGEAD
FT                   QLLRENAELRQLLALRERLTTEATAAQVIYDTADPYTRRVMVDRGQLAGVEPGSPVMDA
FT                   SGVLGQVTRVFPMLSEVTLLIDRDQAIPVLNLRTGARSVAYGDPVAGHGGGMELRFTPG
FT                   NADVQEGDLLTTSGVDGLYPAGLPVARVLRVERRADSAFARIYCAPVAQMYGARHVMVL
FT                   KPVVADLPPRPEPEPAAPKRGGRK"
FT   gene            256551..257072
FT                   /locus_tag="Ajs_0241"
FT   CDS_pept        256551..257072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0241"
FT                   /product="putative rod shape-determining MreD transmembrane
FT                   protein"
FT                   /note="KEGG: pol:Bpro_0224 putative rod shape-determining
FT                   MreD transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40495"
FT                   /db_xref="GOA:A1W2M0"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2M0"
FT                   /protein_id="ABM40495.1"
FT                   /translation="MIMPKGQQLLLPVNPVFIAASLVAALALNMLPLGRVVWTPDWVMV
FT                   LLVFWGMHQPQRVGLGVAFLMGLCLDVYQSALLGQHALVYCLLMFGAQYTHRRLLWFGP
FT                   LLQALQLLPLFFAAHALELLLRVAIGGGILPGFEGLVAPLLEAALWPLASWVLLAPQRR
FT                   PPDRDENRPL"
FT   gene            257100..259040
FT                   /locus_tag="Ajs_0242"
FT   CDS_pept        257100..259040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0242"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   pol:Bpro_0225 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40496"
FT                   /db_xref="GOA:A1W2M1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2M1"
FT                   /protein_id="ABM40496.1"
FT                   /translation="MTELRNAEADVWHFRLRVFVVGVVVLLAFLLIVARLVVLQVVRHE
FT                   DLADQAESNRTAVVPIVPNRGLILDRNGVVLATNYSAYTLEITPSRTMDLEATIDALAE
FT                   VVDIQPRDRRRFKRLREESRSFDSLPIRTRLSDEEVARFAAQRYRFPGVDIKARLFRNY
FT                   PLGEVASHAIGYIDRINQREKERIEDSDDAANYRGTDYIGKLGVEQSFESTLHGQTGFE
FT                   RMETSAGGHAVRRLNSHPATPGNTVMLSLDIKLQKLIEDMFGERRGALVALDPRNGEVL
FT                   ALVSKPTFDPNLFVEGIDQENWQALNESINKPLLNRALRGTYPPGSTYKPFMALAALEL
FT                   GKRTAGQVFNDPGYYNYGGRTFRSHEGGLGGVDMHRAIQYSSNTYFYSLAVEMGVDAIH
FT                   DFMKPLGFGQITGIDLGGEVRGVLPSTEWKRNTYKRPEAKRWYSGETVSLGIGQGYNNF
FT                   TMLQLAVAEATLANGGTRHRPHLIKAVKDQVGGQVTEVQQPPGERLGYNPKHVAIVNNA
FT                   LMAVNQAGTGRRVFAGAPYTSAGKTGTAQAVSLGQNVRYNAKLLEEHQRDHSLFAAFAP
FT                   VEEPRIAVAVIVENAGFGAAAAAPIVRRVFDYWLLGQYPSEQDLAAVSKGQAGAPMGTP
FT                   RNVADVPLAMP"
FT   gene            complement(259057..259956)
FT                   /locus_tag="Ajs_0243"
FT   CDS_pept        complement(259057..259956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0243"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: dra:DR2393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40497"
FT                   /db_xref="GOA:A1W2M2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2M2"
FT                   /protein_id="ABM40497.1"
FT                   /translation="MRSERQGLLALLLVVAVWGTTFPAMKMMSAHLDALQIIWARFAIA
FT                   LLVLAPLWRGLRRTELRWGLLLGALLFLAFWLQIEGLARTSSNRNAFVTGLNVLVVPLL
FT                   AMAVLGRRYGAALWAACAMALAGMVLMFHENEPWNLGDTLTLASTLFYAIYILTLEECA
FT                   RRTAAQPLRATRMAAVQALVMFAAASVLLLARHGEVATTLQALADLPAHALTALAYLGV
FT                   VASVLVVTLQAWGQQRVDAMRSAIVFGLEPVFAAATAWVLIGERLGAAGLAGAALIVAA
FT                   LVVSQLPPPRALARPSTP"
FT   sig_peptide     complement(259876..259956)
FT                   /locus_tag="Ajs_0243"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.684 at
FT                   residue 27"
FT   gene            complement(260089..260841)
FT                   /locus_tag="Ajs_0244"
FT   CDS_pept        complement(260089..260841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0244"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_0403 ABC transporter related; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40498"
FT                   /db_xref="GOA:A1W2M3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2M3"
FT                   /protein_id="ABM40498.1"
FT                   /translation="MSHAASANPYIVCKDVRKAFGSHEVLKGVSTVFRTGEVTVIIGAS
FT                   GSGKSTLLRAINRLEPHDSGSITIDGVEVTDDPRTLQLQRSEVGMVFQQFNLFGHMTVL
FT                   DNVTLAPRRIRHTSRREANDKAMALLKRVGMQDHAHKYPWQLSGGQQQRVAIARALAMA
FT                   PKVMLFDEPTSALDPEMVQEVLDVMRELARGGMTMIVVTHEMGFAREVADRVMFFDQGC
FT                   IAHDAPPAEFFSNPANDRIRSFIGRMSH"
FT   gene            complement(260838..261620)
FT                   /locus_tag="Ajs_0245"
FT   CDS_pept        complement(260838..261620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0245"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pol:Bpro_0402 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40499"
FT                   /db_xref="GOA:A1W2M4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2M4"
FT                   /protein_id="ABM40499.1"
FT                   /translation="MLLALWPAHWSRTQRSNATLVAALVLMALVLALLGQFLSFFPEPI
FT                   GSNAELFSEGALTTLYLTLVSGTVGLLLGTAAALARTSRLAWLRWVASFYIWAIRGTPL
FT                   LVQILFVYFALPVLVPGLNLPDFAAAVVALGLNVGAYNAEAIRAGLLAVPRGQTEAARA
FT                   LGLSRTHVFFDVVFPQAFKIALPPLVSNFVALLKDSSLAYAIGVVELTNVGNRIQSATF
FT                   QPVATLTTVAITYLILTTLVTQVTHAIEYRFDVEGRVK"
FT   sig_peptide     complement(261522..261620)
FT                   /locus_tag="Ajs_0245"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.625 at
FT                   residue 33"
FT   gene            complement(261660..262421)
FT                   /locus_tag="Ajs_0246"
FT   CDS_pept        complement(261660..262421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0246"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: pol:Bpro_0401 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40500"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2M5"
FT                   /protein_id="ABM40500.1"
FT                   /translation="MKMFKTLATAVALCAAVVVQARPLEEIQKSGTIILGSEGQYAPFN
FT                   FFKGKQLTGYEIEVAEAVVKKMGLKYEWKTVGFDALLTGLAQDRWDLVIASHAITDERS
FT                   KAVTFTLPHYCSGGIIVSMKPEVAKAADLNGKVVAVQTGTTYLDAVKKVPGVKDVKNFP
FT                   TDEAARNALASKRVDAWVTDRFVAKEMLAKAPKAGFRTGDMLFVEQVAAAVSKGNQGLA
FT                   DAWNKALKEAIADGTVGKISQKYFQEDVTCK"
FT   sig_peptide     complement(262356..262421)
FT                   /locus_tag="Ajs_0246"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            complement(262587..263507)
FT                   /locus_tag="Ajs_0247"
FT   CDS_pept        complement(262587..263507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0247"
FT                   /product="arginase"
FT                   /EC_number="3.5.3.1"
FT                   /note="TIGRFAM: arginase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: rfr:Rfer_3884
FT                   arginase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40501"
FT                   /db_xref="GOA:A1W2M6"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2M6"
FT                   /protein_id="ABM40501.1"
FT                   /translation="MTTLTLIGAPTDVGASVLGASMGPDALRIAGIARAMQARGFDVRD
FT                   QGNLAGPGNPQAEPASGFRHLAEVAAWNRAVYEATHAALQAGQLPLLMGGDHCLAIGSI
FT                   SAVAQHCRARGRRLKVLWFDAHADANTPESSPSGNLHGMPVACLLGHGPAQLTRLAGPE
FT                   DPPALQPGQITLIGVRSVDATEKRFVNEHGIEVYDMRTIDELGMRAVMQAALADVDQDT
FT                   HLHVSFDMDCLDPSVAPGVGTGVRGGPTYRETQLCMEMLADCGALGSADLVELNPALDV
FT                   RNQTAELAVDLLESLFGKSTLMRPQ"
FT   gene            complement(263545..264303)
FT                   /locus_tag="Ajs_0248"
FT   CDS_pept        complement(263545..264303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0248"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rfr:Rfer_3919 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40502"
FT                   /db_xref="GOA:A1W2M7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2M7"
FT                   /protein_id="ABM40502.1"
FT                   /translation="MEWIIVSLASLLAGFVDAIVGGGGLILLPALFATFPTAPPATLMG
FT                   TNKSAAIWGTGIATWQYSRRVQMRWRALLPAALAGFVGAFAGAWVVTLISADFLRKLLP
FT                   LVLVALLIYTLARKDLGRHHAPRLAAGRETLAACAIGVTIGFYDGFFGPGTGSFFVFLF
FT                   VRVLGYDFLNASVSAKLLNLATNVAALILFTAKGHVWWHFALPLAVANVVGSLLGAHLA
FT                   LKHGAGFVRGIFILVVGMLILKTGYDAFLR"
FT   gene            complement(264603..266312)
FT                   /locus_tag="Ajs_0249"
FT   CDS_pept        complement(264603..266312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0249"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: rfr:Rfer_3918
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40503"
FT                   /db_xref="GOA:A1W2M8"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2M8"
FT                   /protein_id="ABM40503.1"
FT                   /translation="MRSASMSDTTFDYIIIGGGTAGALLANRLSADPKNRVLLVEAGRR
FT                   DDYHWIHIPVGYLYCIGNPRTDWLYHTEADTGLNGRSLRYPRGKVLGGCSSINGMIYMR
FT                   GQARDYDQWAQITGDDAWRWDNVLPAFRRHEDHWRLDQPEGVNENFKRLHGSKSTGSSG
FT                   EWRVEKQRLRWDILDAFAQAAQQAGIPATDDFNRGTNEGVGYFEVNQKNGWRWNTAKAF
FT                   LRPTCYGRPNFEMWTSAQVTRLVLDRQPDGSLRCTGVQVWTGEEMVTAHAQQEVILSAG
FT                   AVNSPQILQLSGIGPGALLQRHGIDIQADLPGVGANLQDHLQIRAVYKVQGVPTLNMLA
FT                   GNLLGKARIGLEYAFKRSGPMSMAPSQLGAFTRSQPDLPHPNLEYHVQPLSLEAFGEPL
FT                   HRFPAFTASVCNLNPTSRGTIQIKSPDFRTAPAIAPNYLSTPEDRQVAADSLRVTRRIV
FT                   AQPALAPYQPEEYKPGPQYQSDEDLARLAGDIATTIFHPVGTTRMGRLDDPQAVLDARL
FT                   RVRDGRGGVVAGLRVVDAGAMPTITSGNTNAPTLMMAEMAAQWIRSEARAPV"
FT   gene            266634..267752
FT                   /locus_tag="Ajs_0250"
FT   CDS_pept        266634..267752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0250"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   pol:Bpro_0230 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40504"
FT                   /db_xref="GOA:A1W2M9"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2M9"
FT                   /protein_id="ABM40504.1"
FT                   /translation="MPVTHPPSVVQDHAARPLAQPQGDWVAAAFADRRAWRRVAAQLKE
FT                   CGPGVAWSLQGVQRLDHVGAQILWNHWGRAWPEQLELTENQREMLERVAQYTTPCEPPA
FT                   PWRLGDQVDRLGVMVLHALDHVRHLVILVGQLVLDVLRLLRNPRRGPWRDISGHLYRMG
FT                   ATALPITALVGFLIGVVLAYLMSLQLRQFGAEAFIVNILGISLIRELGPMLGAILVAGR
FT                   SGSAITAQIGVMRVTEELDAMRVMGIPHGFRLVMPRALALALAMPLVALWTTLAALAGG
FT                   MLAADLTMGISSAYFAQALPAAVNVSNLWLAMSKSVVFGVFIALIGCHWGLRVKPNTQS
FT                   LGEGTTASVVSAITMVIIVDALFAVAFKNVGF"
FT   gene            267755..268597
FT                   /locus_tag="Ajs_0251"
FT   CDS_pept        267755..268597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0251"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_0231 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40505"
FT                   /db_xref="GOA:A1W2N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2N0"
FT                   /protein_id="ABM40505.1"
FT                   /translation="MDATRPAADADTRAVVEPPVVDIRGLATVFGRGDEAFTVHDDLQL
FT                   TVQRGEILSLVGGSGTGKTVLLRHILGLTRPTRGSVEVLGRSAAELVGGERASSRVGML
FT                   FQQGALFSAFNVLDNIAFALRELGTLPPALVNDAAMVKLRLAGLKPEHATRMPADLSGG
FT                   MIKRVALARALIMDPPLLLLDEPTAGLDPSSSDEFCALLRELHAALGLTVIMVTHDLDT
FT                   LYALSTRVAVLADRRVIVTGTPQEVARFDHPFIHHFFLGERGRRAMAQPPAASSSKEA"
FT   gene            268597..269574
FT                   /locus_tag="Ajs_0252"
FT   CDS_pept        268597..269574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0252"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: pol:Bpro_0232 mammalian cell entry related"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40506"
FT                   /db_xref="GOA:A1W2N1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2N1"
FT                   /protein_id="ABM40506.1"
FT                   /translation="MENKSHALAAGIFVIAVAALLAGLGMWLTRDQTDYQLYELSSKDS
FT                   VSGLQPQAAVRYKGVAVGKVMHIGFDPQVSGNVLIRIAVNADAPISPTTFATLGYQGVT
FT                   GLAHVQLDDAEAPLPAPPPGASGLPRLPLHSSSFSQLAEQGPAILGQVQEATQRINTLL
FT                   GDENQQRFSTALKQLGDAAGSIDQLARRLDNTVTTRLDPALAGVPPLVQDTQQTLQALR
FT                   QAGSSAATAANDVSQAIRTLQAEGGALDEIAAGAKSLAGAADRFGRVTLPRINHAADET
FT                   ARAARRLGRTASGINDNPQSLIYGPGRSAAGPGEPGFTAPAAQQ"
FT   sig_peptide     268597..268665
FT                   /locus_tag="Ajs_0252"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.500 at
FT                   residue 23"
FT   gene            269592..270269
FT                   /locus_tag="Ajs_0253"
FT   CDS_pept        269592..270269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0253"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: pol:Bpro_0233 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40507"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2N2"
FT                   /protein_id="ABM40507.1"
FT                   /translation="MMTIKKIAASAYQISAKAIFCLASLALVAGCSILPEPPVRADVYD
FT                   FGPGPLQAPGPAASAPLPPIALAEVTATGLPEGSTALLYRLAYTNAQQLRPYTQARWSL
FT                   PPAVLLHQAVRERLGQRRAVLSGDDGMAVLLERGRMPSVLRLELEEFSHVFGAPQASAG
FT                   LVRVRAVLADASTAGETLVAQRVFVARRDAATPDAAGGAKALADAAAQVAEELAAWVEQ
FT                   SGR"
FT   sig_peptide     269592..269717
FT                   /locus_tag="Ajs_0253"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.698) with cleavage site probability 0.555 at
FT                   residue 42"
FT   gene            270514..270729
FT                   /locus_tag="Ajs_0254"
FT   CDS_pept        270514..270729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0254"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: pol:Bpro_1152
FT                   CsbD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40508"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2N3"
FT                   /protein_id="ABM40508.1"
FT                   /translation="MNEDRIEGNWKQFKGKVKEQWGKLTDDDLDVIAGKRDQLLGKLQE
FT                   RHGLAREAAEEQLKGWEQRNPDFRYD"
FT   gene            270806..271384
FT                   /locus_tag="Ajs_0255"
FT   CDS_pept        270806..271384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40509"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2N4"
FT                   /protein_id="ABM40509.1"
FT                   /translation="MKNARNLLALAAAALMATSGMAMTKEEYNAGKDRIGADYKAAKAQ
FT                   CDTLKGNAKDVCMKEAKGREKVAKAELEAQYKPSDKATYNVNEARADADYEVAKEKCDD
FT                   QKGDAKDICVKDAKAAHVAAKENAKVQRAQAKPADSTAEKRADVAEAKKDAAEAQREAN
FT                   YKAAKERCDTMSGDAKDKCVADAKRTYGQ"
FT   sig_peptide     270806..270880
FT                   /locus_tag="Ajs_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.666 at
FT                   residue 25"
FT   gene            271533..272039
FT                   /locus_tag="Ajs_0256"
FT   CDS_pept        271533..272039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0256"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   reu:Reut_A0820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40510"
FT                   /db_xref="GOA:A1W2N5"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2N5"
FT                   /protein_id="ABM40510.1"
FT                   /translation="MAALQWSEELALDLPQMDHTHQEFVALLQAVESADDVALIGAWED
FT                   LVAHTDAHFAQEDRWMQATRFAAGNCHSTQHQVVLKIMREGTDRARQGELHVLREMAAE
FT                   LAVWFPQHTDAMDASLAQHLRRVGFDPATGSVQKPGALPDDLIHGCGGACSSGDDTPAQ
FT                   PAAVA"
FT   gene            272219..273151
FT                   /locus_tag="Ajs_0257"
FT   CDS_pept        272219..273151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0257"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: bxe:Bxe_B2063 putative diguanylate cyclase
FT                   (GGDEF domain); TIGRFAM: PAS sensor protein; diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein; PAS fold-3
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40511"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2N6"
FT                   /protein_id="ABM40511.1"
FT                   /translation="MTPHEPPESALYRTLLESTRAIPWKIDWATATFAYIGPQIEDLLG
FT                   WAPTSWRTVQDWADRMHPDDRDRVVNFCISQSQSGVDHEADYRALTTGGDYVWIRDVVH
FT                   VVRDLQGNVVSLVGFMFDITERKQNEHQLLQLQQVLQELSFRDGLTGVNNRRKFDAEYE
FT                   REWQEAQRTGEPLSLLMFDVDFFKSYNDQYGHVEGDECLRRVARALQQAAHRPRDCLAR
FT                   YGGEEFVLLLPGADASSARAVAQRCMQEVAHAGIVHAASPLGQQLTVSVGMGTALPGTQ
FT                   DDSKRFLETVDRCLYRAKHAGRNRIEATA"
FT   gene            complement(273155..273793)
FT                   /locus_tag="Ajs_0258"
FT   CDS_pept        complement(273155..273793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0258"
FT                   /product="multiple antibiotic resistance (MarC)-like
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: pol:Bpro_0238 multiple antibiotic
FT                   resistance (MarC)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40512"
FT                   /db_xref="GOA:A1W2N7"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2N7"
FT                   /protein_id="ABM40512.1"
FT                   /translation="MDLKPLITLLAIVNPLAIVPFFIHYTSGFNAAQRRRTVQVAAFSA
FT                   FCVIAACALVGLQILDFFNISLQSFQVGGGMLLLISAMNMLNAQPAEAKPHTHELEQGA
FT                   EKAAAGSSIAVVPLTIPLLTGPAAMSTVVIYADRAQSIWQHLALVGYGVVVGAATALCF
FT                   ALAEPIERVLGKTGINVMTRLMGLILAALAVEVMADGLSKLFPVLAARS"
FT   gene            complement(273793..274539)
FT                   /locus_tag="Ajs_0259"
FT   CDS_pept        complement(273793..274539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0259"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   pol:Bpro_0239 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40513"
FT                   /db_xref="GOA:A1W2N8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2N8"
FT                   /protein_id="ABM40513.1"
FT                   /translation="MDKIVLITGGSRGIGAAAAVLAAQRGWAVAINYLRHAEAANGVVR
FT                   QIEAAGGRAIAVQADVAVEADVVTLFETVDHRLGRLTALVNNAGVVDRPAPVDEMHGER
FT                   LRRMFSINVLGAFYCVREAVLRMSTRHGGAGGSIVNVSSIAARLGAPHQYVDYAASKGA
FT                   LDTLTIGLAHEVGGEGIRVNAVRPGLIDTDIHASGGLPHRVRDLAGQVPMGRGGTPEEV
FT                   AEAIVWLMSDAASYTSATLMDIAGGR"
FT   sig_peptide     complement(274471..274539)
FT                   /locus_tag="Ajs_0259"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.846) with cleavage site probability 0.717 at
FT                   residue 23"
FT   gene            274647..275336
FT                   /locus_tag="Ajs_0260"
FT   CDS_pept        274647..275336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0260"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: pol:Bpro_0241
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40514"
FT                   /db_xref="GOA:A1W2N9"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2N9"
FT                   /protein_id="ABM40514.1"
FT                   /translation="MGQWVDLTASDGFTAPAWVARTDGAPRGAVVVLQEIFGVNAHIRA
FT                   VTDRLAMRGYLAVAPSTFARVQKGVDLGYSDADMKAGRALKAAVEGLPAPGVMPDIQAA
FT                   IDYAARHSDCKVGVVGFCWGGLLTWRAACMLQGLSAAVPYYGGGMTTPAEVARQPRVPV
FT                   LAHFGERDQWIPLDSVQAFARAHPEAQVHVYAADHGFNCDQRASYDEAAAMTARDRTLA
FT                   FLARHVG"
FT   gene            complement(275424..276992)
FT                   /locus_tag="Ajs_0261"
FT   CDS_pept        complement(275424..276992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0261"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_3234 drug resistance transporter EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40515"
FT                   /db_xref="GOA:A1W2P0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2P0"
FT                   /protein_id="ABM40515.1"
FT                   /translation="MTAPAHTPPLPPPPLTGSARLWGTLALSAATFMNVLDTSIANVSL
FT                   PAIAGDLGVSPTQGTWVITSFAVANAIAVLLTGWLSQRFGQVRLFVASVALFVIASLLC
FT                   GLAPNMTLLIAARALQGFVAGPMIPLSQSLLLSSYPRALAGLAMAMWSMTTLIAPVMGP
FT                   LLGGWITDNMTWPWIFYINVPVGIAAVVVTWGIFHQRETERRALPIDSIGLALLVIWVG
FT                   AMQVMLDIGKEHDWFESPWVVACGLVALVGLVAFVVWERGEDHPVVDLALFRIRNFWAG
FT                   ALATSVGYGLFFGNVVLLPLWLQQYMGYTATQAGEVMAPVGLLAMVLSPLVGKNIAKVD
FT                   PRRFATLAFLVFALVLWMRSNFNTQADLATIMVPTIIQGVAMAFFFIPLVTITLSGIAP
FT                   DRIPAASGLSNFMRITAGAVGTSVTTTLWERRASLHHAQLTEGLHQGHLPFTQALQGLQ
FT                   AGGLTPEQALAQVERLVNQQAFMLAANDIFYASALLFLLLIPLVWLAHPTRAASGSADA
FT                   AAGAH"
FT   gene            complement(277003..278220)
FT                   /locus_tag="Ajs_0262"
FT   CDS_pept        complement(277003..278220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0262"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   pol:Bpro_3235 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40516"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2P1"
FT                   /protein_id="ABM40516.1"
FT                   /translation="MSTMTATPSTPSTASKASRRKALFTLAGVVVLAGCAWGLYDWLVA
FT                   SHYEHTDNAYVQGNVIQITPQTGGTVMSILADDTDFVRAGAALVQLDPADARVALQQAE
FT                   ANLAQAVRQTRTLYANNSALAAQVRLREAEAARAQAEIARAEDDLRRRQALTGEGAVSQ
FT                   EELRHAQSQLQTARTQLAAAQAGVAAAREQLASNQSLTQGVAVAQHPSVQAAAAKVREA
FT                   YLADRRTALPAPVDGYVARRTVQLGQRVAAGTPLMTIVPLREVWVDANFKENQLRNLRL
FT                   GQRATLVADLYGKKVEYTGTVAGLGVGTGAAFALLPAQNATGNWIKVVQRVPVRIALDA
FT                   GQLAEHPLRVGLSMNVSVDTQDRSGPALADAPRKEAVASTAVYDALDKGADADVARIIR
FT                   ANLGTL"
FT   sig_peptide     complement(278104..278220)
FT                   /locus_tag="Ajs_0262"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.625 at
FT                   residue 39"
FT   gene            complement(278249..279802)
FT                   /locus_tag="Ajs_0263"
FT   CDS_pept        complement(278249..279802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0263"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: pol:Bpro_3236 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40517"
FT                   /db_xref="GOA:A1W2P2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2P2"
FT                   /protein_id="ABM40517.1"
FT                   /translation="MKNHLSPSSAPALTPPTAPRGSALLYGATLAVALLALPLLSGCAD
FT                   MAGIDSHARMRDPVSLGLAAAPSSGADAAVQPQTAVSADWWRSFGDAQLDALITQALQG
FT                   NPGLQQAAARIARAEAFADTARAAQSPQVNGSLDATRQRYSANGPYPPGQAGAIRSVET
FT                   ARLSGSWELDFFGKHRAALAAALGEAQAARADAEAARLLLASRVAQGYFQLARLQAQRA
FT                   VAERTLQQRTEMLQLVQRRVQAGLDTQLELRQSEGTLPEARQQIEALREQEALARNALG
FT                   ALIADPQTAQTLTPQALAAIHFSETPAAVPADLLGRRPDVAAARWRVEAATQDMGVARA
FT                   QFYPNVSLTAFVGLASVGLDRFIEAGSREWGVGPALRLPIFDAGRLRANLRGKAADRDA
FT                   AVESYNAALLEAVRDAADQLASSSSIARQITEQRQAGESAQAAYGIARRRYEAGLGTYL
FT                   QVLTAESQVLAQRRLAVDLAARRLDNQVGVMRALGGGYAATPPPMAQAPQAAPTVAAAR
FT                   "
FT   sig_peptide     complement(279659..279802)
FT                   /locus_tag="Ajs_0263"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.624) with cleavage site probability 0.231 at
FT                   residue 48"
FT   gene            complement(279861..280376)
FT                   /locus_tag="Ajs_0264"
FT   CDS_pept        complement(279861..280376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0264"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: rfr:Rfer_1513
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40518"
FT                   /db_xref="GOA:A1W2P3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2P3"
FT                   /protein_id="ABM40518.1"
FT                   /translation="MNSSSIPPPLSADAACPLSDPELPVPFEIERSIGFQMRRITTLLG
FT                   YEVERRMEPLGLTDAQWKPLLRLLLDPPGTAAALARMCHLDAGGLTRLLDRLEAKGLCQ
FT                   RERSQEDRRVVHVALTPEGQAVAAQLPALLGEVQDQLLQGFSAEEEAQLRDFLKRIYAN
FT                   VRPPEGGP"
FT   gene            complement(280480..281685)
FT                   /locus_tag="Ajs_0265"
FT   CDS_pept        complement(280480..281685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0265"
FT                   /product="Mg2+ transporter protein, CorA family protein"
FT                   /note="PFAM: Mg2+ transporter protein, CorA family protein;
FT                   KEGG: pol:Bpro_0244 Mg2+ transporter protein, CorA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40519"
FT                   /db_xref="GOA:A1W2P4"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2P4"
FT                   /protein_id="ABM40519.1"
FT                   /translation="MTPTPQAIRIFHLQPGAHAQELPELPTQPPARGFHWIACTRAAFS
FT                   SELPRLQGVLQALTGQQLVDLHVSDLLNAQLPSHYDYTSQYDMLVVRRLSASLAPAAAP
FT                   LMPAAARGGPPVLRRIDTSPVGFAVFDQVLLSVHPADCSVRDAYAARLITPPAPTTTPP
FT                   PEAPNGNAPPATPAEAVVRELRTGPVAGTRLPASPADLMLRMVNQIVDNYLDLRRELSR
FT                   QLDHWQAELLQPRTRFNNWRALMDARLTLHQLDEICEDQRAAVQAWCAVLETWAPSSDT
FT                   PAALRELDLLKVRSRDVLEHIERVVHHVRRLEQSTEATVQMHFSAQSNRTNDIMRTLTA
FT                   LTAVFLPLNLIAGIFGMNFEFIPLVHKQDGFWWAMGSMIATAVGLTLFFWRKRYLARTG
FT                   QG"
FT   gene            complement(281725..282732)
FT                   /locus_tag="Ajs_0266"
FT   CDS_pept        complement(281725..282732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0266"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   pol:Bpro_0245 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40520"
FT                   /db_xref="GOA:A1W2P5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2P5"
FT                   /protein_id="ABM40520.1"
FT                   /translation="MHLSSPTPFPANRPRRLRRDAFTRNLVRETVLTPHDFIYPVFVHE
FT                   GSNLRVPVASMPGVERLSLDLLLPVAEECVKLGIPVLALFPSIDAALKTPDGKEALNPD
FT                   GLIPRVVRKLKAEFPDLGVMTDVALDPYTSHGQDGLLDDTGYILNDETVELLVGQALTH
FT                   AQAGVDMVAPSDMMDGRIGAIREALEAHGQIYTRIMAYSAKYASAFYGPFRDAVGSAAN
FT                   LGRSNKNVYQMDPANTDEALREVALDLAEGADMVMVKPGMPYLDVVRRVKDEFKVPTFA
FT                   YQVSGEYAMLKAAAANGWLDHDKVMMESLLAFKRAGADGVLTYFALDAARLLAK"
FT   gene            282893..283606
FT                   /locus_tag="Ajs_0267"
FT   CDS_pept        282893..283606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0267"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   rfr:Rfer_3968 biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40521"
FT                   /db_xref="GOA:A1W2P6"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2P6"
FT                   /protein_id="ABM40521.1"
FT                   /translation="MQTAVTRPYWRVWIYETPAVVLGCSQRAYLDGARARLALGMELLQ
FT                   RPSGGGAVLCGPWMVSCSVVLPPSHPWVQGRLPDSYQGLGQLHAQVLAPWGVAARALPP
FT                   DQVAAANARGGPVVPWACYGSLAPWEVVDAAGRKLVGLAQRRQRAGVLLVAGTLVTPPD
FT                   WALLCQALDQQGDEAALRARTVSCAELSARAPDAQQMARALRVALTQTLGEEAGDGAGE
FT                   AADDPARQATAPNRP"
FT   gene            283816..284244
FT                   /locus_tag="Ajs_0268"
FT   CDS_pept        283816..284244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0268"
FT                   /product="conserved hypothetical protein 701"
FT                   /note="PFAM: conserved hypothetical protein 701; KEGG:
FT                   rfr:Rfer_3804 conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40522"
FT                   /db_xref="GOA:A1W2P7"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2P7"
FT                   /protein_id="ABM40522.1"
FT                   /translation="MLWVKAFHIVFVASWFAGLFYLPRIFVNLAMVAPGSVAERERLLL
FT                   MARKLLRFTTLLSVPAIALGLWLWLGYGIGKGPGNGWLHAKLAVVLLVVGYHHACAVLL
FT                   RRLASNADQHSHRWFRWFNEVPVLLLLVAVVLVVVKPF"
FT   gene            284342..285439
FT                   /locus_tag="Ajs_0269"
FT   CDS_pept        284342..285439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0269"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: rfr:Rfer_3803 VanZ
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40523"
FT                   /db_xref="GOA:A1W2P8"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2P8"
FT                   /protein_id="ABM40523.1"
FT                   /translation="MHKTSAWPLALIYAALIVFASLFPFDGWREQGISPWVFFSARIPP
FT                   PYWTWFDVNMNIAGYAPLGFLLALAGLRSGWPRAAVPLAALAGALLSLSMEYLQIFLPR
FT                   RVPSNMDFALNATGALLGALAAALLERFGAIARWSRFRERWFVPHARGALVLLALWPWA
FT                   LLFPAALPFGLGQMWERLEAALIDALQDTPFLQWLPVREAPLEPLSPGAELMAVALGLL
FT                   IPCLLGYCVMRHAGRRMAFALATAAVGVGVTALSSLLSYGPTHAWEWLTLPARMGVLVA
FT                   LGAALAMAAVPRRGCAALLLLALMLHLNLLNQAPASAYFAQTLQAWEQGRFIRFYGLGQ
FT                   WLGWLWPYGALVYVVLRVSRRDGDS"
FT   sig_peptide     284342..284404
FT                   /locus_tag="Ajs_0269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.973 at
FT                   residue 21"
FT   gene            285449..285790
FT                   /locus_tag="Ajs_0270"
FT   CDS_pept        285449..285790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0270"
FT                   /product="ferredoxin-like protein"
FT                   /note="KEGG: pol:Bpro_0248 ferredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40524"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2P9"
FT                   /protein_id="ABM40524.1"
FT                   /translation="MSDTTPQYYQRHIFFCLNERTNGENCCAHHGAQQAFDRCKMLVKQ
FT                   QGLMGPGKVRVNKAGCLDRCAGGPIAVVYPEGTWYTYVDESDIDEIVESHLKNGVVVER
FT                   LLTPPELGR"
FT   gene            285862..286521
FT                   /locus_tag="Ajs_0271"
FT   CDS_pept        285862..286521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0271"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: pol:Bpro_0249 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40525"
FT                   /db_xref="GOA:A1W2Q0"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Q0"
FT                   /protein_id="ABM40525.1"
FT                   /translation="MDSNVNAQTERLTLTGAAGAIEAARDAAADGVPSRGVAVIAHPHP
FT                   LFGGTMDNKVVQTLARAFVACGWTAVRFNFRGVGGTAGVHDEGRGELEDLLAVVLQVAP
FT                   EGPGAVPIALAGFSFGAFVTSHALARLWGERAVEHAVLVGTAASRFKVADVPAEAHLRT
FT                   LVVHGEADDTVPLSAVMDWARPQTLPVTVVPGGGHFFHGQLPLLKGLVMRHLQSAP"
FT   gene            286601..287764
FT                   /locus_tag="Ajs_0272"
FT   CDS_pept        286601..287764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0272"
FT                   /product="penicillin-binding protein 6"
FT                   /note="PFAM: beta-lactamase; peptidase S11,
FT                   D-alanyl-D-alanine carboxypeptidase 1; Penicillin-binding
FT                   protein 5 domain protein; KEGG: rfr:Rfer_3801 serine-type
FT                   D-Ala-D-Ala carboxypeptidase; Serine peptidase; MEROPS
FT                   family S11"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40526"
FT                   /db_xref="GOA:A1W2Q1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Q1"
FT                   /protein_id="ABM40526.1"
FT                   /translation="MKSLLSSLRTLACAALMAPAILWAQVPQPPEIAARNYMLVDVTAG
FT                   QVLATKDIDAPVEQASLTKLMTGYLVFDALRAKKITLEQRLPVSERAWKMPGSRMFIDP
FT                   KMQVPVDDLLKGMIVQSGNDATVALAEGVGGTVENFVRLMNEQAKALGMTNTAYKNPEG
FT                   LTEPGHTTTARDLATLATRLMQDFPEYMHYYSTKQYRYEGTPASNSNNRNMLLFRDPSV
FT                   DGLKTGHTAAAGYCLVATSKREFPNVGQRRLLSIVLGAASENARANESQKLLNWGYTAF
FT                   DSVKLFDAGQAAATPAVWKGTQSTLKIGRPEAIVITVPSGSAGKVTTEIVRKDPLVAPF
FT                   TKGQAIGTLKVKLGEQQVAEVPLVALEDVAQAGIFGRAWDAIRLWIK"
FT   sig_peptide     286601..286675
FT                   /locus_tag="Ajs_0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            287915..288292
FT                   /locus_tag="Ajs_0273"
FT   CDS_pept        287915..288292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0273"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: rfr:Rfer_3800 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40527"
FT                   /db_xref="GOA:A1W2Q2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2Q2"
FT                   /protein_id="ABM40527.1"
FT                   /translation="MPTINQLVRQGRTVEVVKSKSPAMENCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDL
FT                   QGVKDRKQARSKYGAKKPKAK"
FT   gene            288463..288936
FT                   /locus_tag="Ajs_0274"
FT   CDS_pept        288463..288936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0274"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: rfr:Rfer_3799
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40528"
FT                   /db_xref="GOA:A1W2Q3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2Q3"
FT                   /protein_id="ABM40528.1"
FT                   /translation="MPRRREVPKREILPDPKFGNVELSKFMNVIMEGGKKAVAERIIYG
FT                   ALDLISQKQPEKDALEVFVTAINNVKPMVEVKSRRVGGANYQVPVEVRPVRRLALSMRW
FT                   IKEAARKRGEKSMAQRLANELMEATEGRGGAMKRRDEVHRMAEANKAFSHFRF"
FT   gene            289094..291202
FT                   /locus_tag="Ajs_0275"
FT   CDS_pept        289094..291202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0275"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: pol:Bpro_0253 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40529"
FT                   /db_xref="GOA:A1W2Q4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2Q4"
FT                   /protein_id="ABM40529.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVTHKLGEVHD
FT                   GAATTDWMEQEQERGITITSAAVTCFWKGMDMSYPEHRFNIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVVDQIKTRLK
FT                   GNPVPVVVPIGAEDNFKGVVDLLKMKAIIWDEASQGMKFEYTDIPAEVKETAEKWRENM
FT                   VEAAAEASEELMNKYLDEGTLSEEDIKAGLRARTLAVEIQPMLCGTAFKNKGVQRMLDA
FT                   VIDYLPSPVDIPDVEGTDPDDEEKKLARKADDGEKFSALAFKLMTDPFVGQLTFVRVYS
FT                   GVLSKGDTVFNSVKGKKERIGRIVQMMANERIEVDEIRAGDIAACVGLKDVTTGETLSD
FT                   VDNPIILERMVFPEPVIAQAVEPKSKADQEKMGIALSRLASEDPSFRVRTDEESGQTII
FT                   AGMGELHLEIIVDRMKREFNVEANVGKPQVAYRETVRKTVTDVDGKFVRQSGGKGQYGH
FT                   VVFTLEPQEAGKGFEFVDEIKGGVVPREYIPAVQKGVEEALTSGVLAGYPVVDVKVRLT
FT                   FGSYHDVDSSEQAFKMAAIFGFKEAARKANPVILEPMMAVEVETPEDYAGTVMGDLSSR
FT                   RGMVQGMDDMVGGGKAIKAEVPLSEMFGYATQLRSMTQGRATYTMEFKHYAEAPRNVAE
FT                   AIVAARAK"
FT   gene            291387..292577
FT                   /locus_tag="Ajs_0276"
FT   CDS_pept        291387..292577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0276"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   pol:Bpro_4449 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40530"
FT                   /db_xref="GOA:A1W2Q5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2Q5"
FT                   /protein_id="ABM40530.1"
FT                   /translation="MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLAKKFGGEAK
FT                   GYDQIDNAPEEKARGITINTSHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLDKYDF
FT                   PGDDTPIIRGSAKLALEGDQSDKGEPAILRLAEALDTYIPTPERAVDGAFLMPVEDVFS
FT                   ISGRGTVVTGRVERGIIKVGEEIEIVGIRDTQKTTVTGVEMFRKLLDQGQAGDNVGLLL
FT                   RGTKREDVERGQVLCKPGSIKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPADKEMVMPGDNVSITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIA"
FT   gene            292605..292916
FT                   /locus_tag="Ajs_0277"
FT   CDS_pept        292605..292916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0277"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: rfr:Rfer_3796
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40531"
FT                   /db_xref="GOA:A1W2Q6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2Q6"
FT                   /protein_id="ABM40531.1"
FT                   /translation="MSKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTR
FT                   MKRFDILRSPHVNKTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ"
FT   gene            293167..293841
FT                   /locus_tag="Ajs_0278"
FT   CDS_pept        293167..293841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0278"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: pol:Bpro_0256
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40532"
FT                   /db_xref="GOA:A1W2Q7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2Q7"
FT                   /protein_id="ABM40532.1"
FT                   /translation="MSLSNSLGLLGRKVGMMRLFTDDGDAVPVTVVDVSNNRVTQVKTQ
FT                   ENDGYVSLQVTFGSRKASRVTKPEAGHLAKAGVEAGEIIREFRVTPEVAGKYAAGAAVP
FT                   VADVFAVGQKVDVQGTSIGKGFAGTIKRHNFGSQRASHGNSRSHNVPGSIGMAQDPGRV
FT                   FPGKKMTGHLGDVTVTTQNLDVVRIDEARQLLLIKGAVPGSKGGFVTVRPAVKAQASKG
FT                   AN"
FT   gene            293841..294461
FT                   /locus_tag="Ajs_0279"
FT   CDS_pept        293841..294461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0279"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: pol:Bpro_0257
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40533"
FT                   /db_xref="GOA:A1W2Q8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2Q8"
FT                   /protein_id="ABM40533.1"
FT                   /translation="MQLELLNEQGQAASKVDVPETVFDRQYNEDLIHQIVVAYQANARQ
FT                   GTRAQKDREQVKHSTKKPFKQKGTGNARAGMTSSPLWRGGGRIFPNLPEENFSQKINKK
FT                   MYRAGMASILSQLAREGRLAVVDSLKLDTPKTKVLADKFKAMNLQSVMVIADEVDENLY
FT                   LASRNLKNVFVTEPRYADPVSLVHYKKVLVTKGAIDKLKEMFA"
FT   gene            294458..294772
FT                   /locus_tag="Ajs_0280"
FT   CDS_pept        294458..294772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0280"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: rfr:Rfer_3793
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40534"
FT                   /db_xref="GOA:A1W2Q9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Q9"
FT                   /protein_id="ABM40534.1"
FT                   /translation="MSTLKFDEGRLMQVLVAPIVSEKATMVAEKSNAVTFKVLQNATKP
FT                   EIKAAVELMFKVEVKGVSVVNTKGKTKRFGKTMGRRDNVRKAYVLLKEGQELNLSGEAA
FT                   "
FT   gene            294776..295600
FT                   /locus_tag="Ajs_0281"
FT   CDS_pept        294776..295600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0281"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: pol:Bpro_0259
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40535"
FT                   /db_xref="GOA:A1W2R0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2R0"
FT                   /protein_id="ABM40535.1"
FT                   /translation="MAVIKIKPTSPGQRGAVKISRDHLYKGEAFAGLLEPQFQKAGRNN
FT                   NGHITTRHKGGGHKHHYRVVDFRRNKDAIPAKVERIEYDPNRTAHIALVCYADGERRYI
FT                   IAPRNLEVGATIVSGSEAPIRVGNTLPIRNIPVGSTIHCIELKPGAGAQIARSAGTSAT
FT                   LLAREGVYAQVRMRSGEVRKIHIECRATIGEVANEEHSLRQLGKAGVKRWMGIRPTVRG
FT                   VAMNPIDHPHGGGEGRTGEGRHAVDPWGNLTKGYRTRNNKRTQVMIVSRRKK"
FT   gene            295611..295889
FT                   /locus_tag="Ajs_0282"
FT   CDS_pept        295611..295889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0282"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: rfr:Rfer_3791 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40536"
FT                   /db_xref="GOA:A1W2R1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2R1"
FT                   /protein_id="ABM40536.1"
FT                   /translation="MTRSLKKGPFVDHHLVAKVEKAIATKDKKPVKTWSRRSMVLPEFI
FT                   GLTIAVHNGKQHVPVYVTDQMVGHKLGEFALTRTFKGHPADKKVQKK"
FT   gene            295899..296231
FT                   /locus_tag="Ajs_0283"
FT   CDS_pept        295899..296231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0283"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: rfr:Rfer_3790 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40537"
FT                   /db_xref="GOA:A1W2R2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2R2"
FT                   /protein_id="ABM40537.1"
FT                   /translation="MSETRAVLRGVRLSVDKGRLVADLIRGKKVDQALNILAFTQKKAA
FT                   VIVKKVLESAIANAEHNDGADIDDLKVKTIFVEQGTTLKRFTARAKGRGNRISKPTCHI
FT                   YVTVGN"
FT   gene            296248..297114
FT                   /locus_tag="Ajs_0284"
FT   CDS_pept        296248..297114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0284"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: rfr:Rfer_3789 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3-C-terminal
FT                   domain protein; KH, type 2 domain protein; Ribosomal
FT                   protein S3, N-terminal domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40538"
FT                   /db_xref="GOA:A1W2R3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2R3"
FT                   /protein_id="ABM40538.1"
FT                   /translation="MGQKIHPTGFRLSVSRNWASRWYASNRDFAGMLAEDIKVREYLKA
FT                   KLKNAAVSRILIERPAKNARITIFSARPGVVIGKKGEDIENLKKELATRLGVPVAVNIE
FT                   EVRKPEIDAKLIADSITQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIA
FT                   RTEWYREGRVPLHTLRADIDYGTSEAKTTYGVIGVKVWVYKGDTLGRNDLPAAETPRPE
FT                   EERRPRGPRRDGRPGDRAGAGRGGRRPMGTNAAPADGSDKPAGAGGDSVKRVKSAPAAA
FT                   AADGKGE"
FT   gene            297117..297533
FT                   /locus_tag="Ajs_0285"
FT   CDS_pept        297117..297533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0285"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16; KEGG: pol:Bpro_0263
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40539"
FT                   /db_xref="GOA:A1W2R4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2R4"
FT                   /protein_id="ABM40539.1"
FT                   /translation="MLQPARRKFRKEQKGRNTGVATRGNSVAFGDFGLKCTDRGRLTAR
FT                   QIEAARRAISRHVKRGGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKVVF
FT                   EIVGVPEELAREAFRLAAAKLPLRTTFVARQIGA"
FT   gene            297545..297742
FT                   /locus_tag="Ajs_0286"
FT   CDS_pept        297545..297742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0286"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: rfr:Rfer_3787
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40540"
FT                   /db_xref="GOA:A1W2R5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2R5"
FT                   /protein_id="ABM40540.1"
FT                   /translation="MTKSAELRQKDVAGLEAEIKSLQKAHFGLRMQKATQQLGNTATLK
FT                   ATRRDIARAKTILAEKQAAK"
FT   gene            297752..298021
FT                   /locus_tag="Ajs_0287"
FT   CDS_pept        297752..298021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0287"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: rfr:Rfer_3786
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40541"
FT                   /db_xref="GOA:A1W2R6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2R6"
FT                   /protein_id="ABM40541.1"
FT                   /translation="MTEAKKSLKRTLVGKVVSDKRAKTVTVLVERRVKHPIYDKIMIKS
FT                   SKYHAHDENGEYKMGDTIEITESRPLSKTKNWVATRLVQKAGLL"
FT   gene            298085..298642
FT                   /locus_tag="Ajs_0288"
FT   CDS_pept        298085..298642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0288"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: rfr:Rfer_3785
FT                   alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40542"
FT                   /db_xref="GOA:A1W2R7"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2R7"
FT                   /protein_id="ABM40542.1"
FT                   /translation="MGPADPAGALQPSKEILMIQVGDTLPAITLMEYSEVEGNGCSLGP
FT                   NPVDVQKAAAGKTIALFAVPGAFTPTCSAKHVPGYVEQAGALKAAGVDEIWCLSVNDAF
FT                   VMGAWARDQKTDGKVRMLADGDAAFAKATGLTLDLNGKGLGLRSNRYSMLVKDGKVVAL
FT                   NVEAPGKFEVSDAATLLGQAKG"
FT   gene            complement(298786..299301)
FT                   /locus_tag="Ajs_0289"
FT   CDS_pept        complement(298786..299301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0289"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rfr:Rfer_3784 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40543"
FT                   /db_xref="GOA:A1W2R8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2R8"
FT                   /protein_id="ABM40543.1"
FT                   /translation="MPDSFCTVDHSPDITLLSPALPHEMHVVRDIFQEYADTLDVDLSF
FT                   QNFAQELATLPGEYAPPRGHILLAEVEGSIAGCCALRPLDTADYPNACEMKRLYVRKAF
FT                   RGFGLGRQLAEAMLDQARQAGYACVLLDTLDGMESARALYSELGFEEIPPYYHNPLPGS
FT                   HYLKAEIY"
FT   gene            complement(299343..300011)
FT                   /locus_tag="Ajs_0290"
FT   CDS_pept        complement(299343..300011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0290"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: pol:Bpro_0268
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40544"
FT                   /db_xref="GOA:A1W2R9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2R9"
FT                   /protein_id="ABM40544.1"
FT                   /translation="MPHTVRIWDLPTRLFHWSLAVTTVALVVTAKLGGNAMQWHLRLGY
FT                   VMLALLAFRLAWGLVGGRWSRFASFLPTPARLRSHFANQEGKVTSPGHSPLGALSVFAL
FT                   LAVLLAQVGTGLLSDDEIAFAGPLTRFVSGEWVSQATWYHKDVGQFLLLGLVALHLAAI
FT                   VFYTLVRRQALVGPMVHGDRQLPGATPASRDDALSRAGAALVAALSALLAWWVASLGAF
FT                   "
FT   gene            300192..300653
FT                   /locus_tag="Ajs_0291"
FT   CDS_pept        300192..300653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0291"
FT                   /product="cytochrome c, class II"
FT                   /note="PFAM: cytochrome c, class II; KEGG: pol:Bpro_0269
FT                   cytochrome c, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40545"
FT                   /db_xref="GOA:A1W2S0"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="InterPro:IPR015984"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2S0"
FT                   /protein_id="ABM40545.1"
FT                   /translation="MPIKALALAATAAAATLVSLPAAAQFAKPEDAIKYRQGALFVIGQ
FT                   HFGRIGAMANGRVPFDAKAAQENADTVAALAALPWAGFGPGTDKGAPTKAKPGVWTEQA
FT                   KFQEHADKFQAEAAKLAAAAKTGSLDNLKAAFGPAANSCKACHDAYRAR"
FT   sig_peptide     300192..300266
FT                   /locus_tag="Ajs_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.822 at
FT                   residue 25"
FT   gene            complement(300749..301252)
FT                   /locus_tag="Ajs_0292"
FT   CDS_pept        complement(300749..301252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0292"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: pol:Bpro_0270
FT                   putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40546"
FT                   /db_xref="GOA:A1W2S1"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2S1"
FT                   /protein_id="ABM40546.1"
FT                   /translation="MQIKKWLAAGALVAGAAVGAVVVLGSGTSQAPQSTFVLLDGSQQT
FT                   TADLKGKVALVNFWATSCTTCVAEMPEIVATYDKYKGQGFETLAVAMSYDPPSYVVNFT
FT                   ETRKLPFKVAIDNTGAVAKAWGDVKLTPTTYIVNKRGEIVKSYIGAPDFEELHKLIERL
FT                   LAEA"
FT   sig_peptide     complement(301175..301252)
FT                   /locus_tag="Ajs_0292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.735 at
FT                   residue 26"
FT   gene            301505..302068
FT                   /locus_tag="Ajs_0293"
FT   CDS_pept        301505..302068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40547"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2S2"
FT                   /protein_id="ABM40547.1"
FT                   /translation="MTLAPAGARRLLTLAFAASMLALAACSPALNWRSVTLSDAGLALT
FT                   LPCKPEYASRPVDLGTGAVPLAMVGCEADGATFAVSHMPLAEVAQAGAMLARWQAAVQA
FT                   GMRASQPAAPVAFVPTRALAVPQSVRLQAQGQAPGGSAVTVDAVWFARLEGGQARLYHA
FT                   AVYAPRRTTATAADTFFASLALQP"
FT   sig_peptide     301505..301600
FT                   /locus_tag="Ajs_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.551 at
FT                   residue 32"
FT   gene            302065..303303
FT                   /locus_tag="Ajs_0294"
FT   CDS_pept        302065..303303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0294"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_0296 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40548"
FT                   /db_xref="GOA:A1W2S3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2S3"
FT                   /protein_id="ABM40548.1"
FT                   /translation="MSVLTRRTAVVVFLAFAFTYFISALLRAITATLAPTLEAEFQLHA
FT                   RDLGLLAGGYFLGFALTQLPLGRWLDRHGPRVVLLGFLGVAVAGCLVFSWATGFSGLLA
FT                   GRMLCGAGVSACLMAPLTGFRRWLEPGAQLRANSWMLMTGSLGMVASTLPVQWLLPLAG
FT                   WRPLFWGLAALIVLAMALLALGVPRWPQAPAESGAGVETGYAQVWRHPYFLRTAPLGFF
FT                   CYGGMVAVQTLWAAPWMQHVAGYTPLQAATGLFWINVSMLLTFWTWGMASPWLLRRVGG
FT                   ADPVMAASLPLSLLVLAGIVLAGGRAGAAAWALYCVSCTSVALSQPAVALAFPQALAGR
FT                   ALSAYNLVIFAGVFAVQWGIGLAVDAFVAAGLDMARAYRAAMALHLACTVGAYAWFMAR
FT                   RGHGDNALHCSTP"
FT   sig_peptide     302065..302151
FT                   /locus_tag="Ajs_0294"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.771 at
FT                   residue 29"
FT   gene            303300..303749
FT                   /locus_tag="Ajs_0295"
FT   CDS_pept        303300..303749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0295"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: pol:Bpro_0297 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40549"
FT                   /db_xref="GOA:A1W2S4"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2S4"
FT                   /protein_id="ABM40549.1"
FT                   /translation="MNTRLLIIAHAPLAHALRECALHVFPDCWQEVLALDVPPHEAPEA
FT                   TLSAARALMEQQGEASVLVLSDLFGATPCNVAQRLVDGLQSRLVAGVNLPMLLRAVSYR
FT                   SEPLDALVARALVGGTQGVMQVGAAAPQNQNRRPSHDQEEHHHQQ"
FT   gene            303718..303987
FT                   /locus_tag="Ajs_0296"
FT   CDS_pept        303718..303987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0296"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: pol:Bpro_0298 HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40550"
FT                   /db_xref="GOA:A1W2S5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2S5"
FT                   /protein_id="ABM40550.1"
FT                   /translation="MIKKNITISNKLGLHARASAKLTKMAGSFPCDVWMRKGERRINAK
FT                   SIMGVMMLAAGMGSEVEIETDGAQEQEAMDALVALIDGKFGEGE"
FT   gene            304006..305775
FT                   /locus_tag="Ajs_0297"
FT   CDS_pept        304006..305775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0297"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing enzyme;
FT                   PEP-utilising enzyme, mobile region; PEP-utilising enzyme
FT                   domain protein; KEGG: pol:Bpro_0299
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40551"
FT                   /db_xref="GOA:A1W2S6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2S6"
FT                   /protein_id="ABM40551.1"
FT                   /translation="MTFSIHGLAVARGIAIGRAVLAVSSRMEVVHYFIEPGQVEAEILR
FT                   ARRGRDAVAEELQRLQADMPHDAPPELAALLDVHLMLLQDEMLVNGVKHWITDRLYNAE
FT                   WALTTQLEIISRQFDEMEDEYLRERKADLEQVVERILRHMRGVASPVAPPPSAPRRQAE
FT                   AGAEAEFLLGGAADAPLVLVAHDLSPADMLQFKQSVFAGFVTDVGGKTSHTAIVARSMD
FT                   IPAVVGARSASQLVRQDDWVIIDGDAGVVIVDPTPIILAEYGFRQRQITLEHERLMRLR
FT                   HTPAVTLDAQAIELLANIEQPGDAGAALRAGAAGVGLFRSEFLFMGRSGRLPDEEEQYR
FT                   AYREAVEGMQGLPVTIRTVDVGADKPLDKGYKDSSLNPALGLRAIRWSLADPAMFRTQL
FT                   RAVLRAAAHGPVRLLFPMLAHVSEIRQTLAQVDLARAELDARGAAYGAVQLGAMIEVPA
FT                   AALMVRQFLRYFDFLSIGTNDLIQYALAIDRADEAVAHLYDPLHPAVLRLVADVIAEGA
FT                   RQGKSVSVCGEMAGDVAMTRLLLGLGLRSFSMQPAQILAVKQEVLRADARKLGEWAQQL
FT                   LDADDPAASLQAP"
FT   gene            complement(305847..306827)
FT                   /locus_tag="Ajs_0298"
FT   CDS_pept        complement(305847..306827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0298"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: pol:Bpro_0313 lipoic acid synthetase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40552"
FT                   /db_xref="GOA:A1W2S7"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2S7"
FT                   /protein_id="ABM40552.1"
FT                   /translation="MSTPDVVREAQSTEAYNPLAKQKAAAKLSRIPIKVEQGEVLKKPE
FT                   WIRVKAGSPTTRFYEIKNILREHKLHTVCEEASCPNIGECFGRGTATFMIMGDKCTRRC
FT                   PFCDVGHGRPDPLDKDEPLNLAKTIAALRLKYVVITSVDRDDLRDGGSGHFVECIQRTR
FT                   ELSPSTQIEILTPDFRGRDDRALEILKAAPPDVMNHNLETVPRLYKEARPGSDYQFSLN
FT                   LLKKFKQLHPGVPTKSGLMVGLGETDEEILEVMRDMRAHGIEMLTIGQYLAPSNSHLPV
FT                   RRYVHPDTFKMFEEEAYKMGFSHAAVGAMVRSSYHADQQAHAAGV"
FT   gene            complement(306845..307525)
FT                   /locus_tag="Ajs_0299"
FT   CDS_pept        complement(306845..307525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0299"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: rfr:Rfer_3935
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40553"
FT                   /db_xref="GOA:A1W2S8"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2S8"
FT                   /protein_id="ABM40553.1"
FT                   /translation="MLGRVDYPATVAAMQRFTEERTDETPDELWICEHPAVYTQGLAGK
FT                   SDHVLSPGSIPVVATNRGGQVTHHGPGQVVAYPLIDLRRAGYYVKEYVYRIEEAVIRTL
FT                   GHYGVTGHRVAGAPGIYVRLDDPHGHSMLPQRPQKRAHADGPPQPDFTGLGKIAALGIK
FT                   VARHCTYHGVALNVAMDLEPFSRINPCGYAGLQTVDLSTIGVHIPWDDAAAMLGQQLAR
FT                   RLAP"
FT   gene            complement(307549..307845)
FT                   /locus_tag="Ajs_0300"
FT   CDS_pept        complement(307549..307845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0300"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   pol:Bpro_0316 protein of unknown function DUF493"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40554"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2S9"
FT                   /protein_id="ABM40554.1"
FT                   /translation="MTTPNQPSSADPRKDSLIEYPSRFPIKVTGANVNGFVHAVTEVAR
FT                   RFDPDFDASTIELRDSRAGNYLGVTITVTATSREQLDDLYRALTSHPMVKVVL"
FT   gene            308086..308574
FT                   /locus_tag="Ajs_0301"
FT   CDS_pept        308086..308574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0301"
FT                   /product="putative ATP synthase protein I"
FT                   /note="KEGG: rfr:Rfer_0113 putative ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40555"
FT                   /db_xref="GOA:A1W2T0"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2T0"
FT                   /protein_id="ABM40555.1"
FT                   /translation="MAQASSNDKKIASETESEVEDSDFKPLTAQEAREWRSRHPALSVW
FT                   RIVWGQAAVGAVVALLAWWLTGRLPVAWSAGYGALSVVVPAALFARGMARRRSTAGAAM
FT                   VGLLGWELVKIALTVAMLAAAPRVVPGLSWLALLVGMVVTMKTYWIALLARPGVRRTD"
FT   gene            308597..309460
FT                   /locus_tag="Ajs_0302"
FT   CDS_pept        308597..309460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0302"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit; KEGG:
FT                   pol:Bpro_0321 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40556"
FT                   /db_xref="GOA:A1W2T1"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2T1"
FT                   /protein_id="ABM40556.1"
FT                   /translation="MAADAHAPTASEYIVHHLQHLQNIKQKSIIDFSVVNLDSVAVSVI
FT                   LGVLGLFVMWLAARTATSGVPSRFQAAVEMLVEMVDNQAKANIHNAQSRKFIAPLALTV
FT                   FVWIFLMNAMDLLPVDLLPVLWQVATGDSHAYLRVVPTADLSTTLGLSSAVLILCFVYS
FT                   IKIKGLGGWAHELVTAPFGTSKNPVFALILGVVNLLMQIIEYVAKTVSHGMRLFGNMYA
FT                   GELVFMLIALMGGAAAMSLSGVLLPVGHIIAGSIWAIFHILIITLQAFIFMMLTLIYLG
FT                   QAHEAH"
FT   gene            309512..309760
FT                   /locus_tag="Ajs_0303"
FT   CDS_pept        309512..309760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0303"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+-transporting two-sector ATPase, C subunit; KEGG:
FT                   rfr:Rfer_0111 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40557"
FT                   /db_xref="GOA:A1W2T2"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2T2"
FT                   /protein_id="ABM40557.1"
FT                   /translation="MENILGLVALACGLIVGLGAIGASIGIALMGGKFLESSARQPELI
FT                   NELQTKMFILAGLIDAAFLIGVAIALLFAFANPFVLA"
FT   sig_peptide     309512..309580
FT                   /locus_tag="Ajs_0303"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.812 at
FT                   residue 23"
FT   gene            309796..310266
FT                   /locus_tag="Ajs_0304"
FT   CDS_pept        309796..310266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0304"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, B/B' subunit; KEGG:
FT                   pol:Bpro_0323 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40558"
FT                   /db_xref="GOA:A1W2T3"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2T3"
FT                   /protein_id="ABM40558.1"
FT                   /translation="MSINATLFVQAIVFLILVLFTMKFVWPPITKALDERAQKIADGLA
FT                   AADRAKTELAAADQRVKQELAAASNEIATRLADAERRAQAIIEEAKARANDEGNKIVAA
FT                   ARAEAEQQAIQAREALREQVAALAVKGAEQILRKEVNAGVHADLLNRLKTEL"
FT   gene            310278..310820
FT                   /locus_tag="Ajs_0305"
FT   CDS_pept        310278..310820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0305"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta (OSCP) subunit;
FT                   KEGG: pol:Bpro_0324 ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40559"
FT                   /db_xref="GOA:A1W2T4"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2T4"
FT                   /protein_id="ABM40559.1"
FT                   /translation="MAELATIARPYAEALYKACTDQAGVDLNGATAWVDELAAIAANPQ
FT                   LRQLADNPKVTGEQVFDVIVGVARSALPDLAKNFLRTVIDNGRVQALPEIAAQFRTLVN
FT                   RSHGTSDAVVYSAFPLDAGALTDVGATLEKRFGRKLNLSVQLDETLIGGVRVVVGDEVL
FT                   DTSVKARLEQMKAALTA"
FT   gene            310867..312426
FT                   /locus_tag="Ajs_0306"
FT   CDS_pept        310867..312426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0306"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: pol:Bpro_0325 ATP synthase F1, alpha subunit;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40560"
FT                   /db_xref="GOA:A1W2T5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2T5"
FT                   /protein_id="ABM40560.1"
FT                   /translation="MQLNPAEISELIKSRIEGLAASSDIRNQGTVVSVTDGIVRVHGLS
FT                   DVMQGEMLEFPAAADGQPSFGLALNLERDSVGAVILGEYEHISEGDTVKCTGRILEVPV
FT                   GPELIGRVVNALGQPIDGKGPINAKMTDVIEKVAPGVIARQSVDQPLQTGLKSIDSMVP
FT                   IGRGQRELIIGDRQTGKTAVAIDAIINQKGQGVTCIYVAIGQKASSIKNVVRALEQAGA
FT                   MEYTIVVAASASESAAMQYVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLL
FT                   LRRPPGREAFPGDVFYLHSRLLERAARVNADYVEAFTKGEVKGKTGSLTALPVIETQAG
FT                   DVSAFVPTNVISITDGQIFLETSLFNAGIRPAINAGISVSRVGGAAQTKLIKGLSGGIR
FT                   TDLAQYRELAAFAQFASDLDEATRKQLDRGARVTELLKQPQYSPLSTALMGATLFTVNK
FT                   GFLDDVDVKKVLAFEAGLHQYLKTSHGALLDRLQQNRAFDKEGKDEAELTQAITAFKKS
FT                   FV"
FT   gene            312445..313311
FT                   /locus_tag="Ajs_0307"
FT   CDS_pept        312445..313311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0307"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: pol:Bpro_0326 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+-transporting two-sector ATPase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40561"
FT                   /db_xref="GOA:A1W2T6"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2T6"
FT                   /protein_id="ABM40561.1"
FT                   /translation="MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQDRMRAARPY
FT                   AEKVRNIAAHLGEANPEYVHPFMKANDAKAAGIIVVTTDKGLCGGMNTNVLRAVTTKLR
FT                   ELQSTGVDVQSVAIGNKGLGFLNRVGAKVVAHATGLGDTPHLDKLIGPVKVLLDAYAEG
FT                   KINAVYLSYTKFINTMKQESVVEQLLPLSSEQMQAQKTGHGWDYIYEPDAQSVIDELLV
FT                   RYVESLIYQAVAENMASEQSARMVAMKAATDNAGNVINELKLVYNKTRQAAITKELSEI
FT                   VAGAAAV"
FT   gene            313354..314760
FT                   /locus_tag="Ajs_0308"
FT   CDS_pept        313354..314760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0308"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: pol:Bpro_0327 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40562"
FT                   /db_xref="GOA:A1W2T7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2T7"
FT                   /protein_id="ABM40562.1"
FT                   /translation="MAQVQGKIVQCIGAVVDVEFPRDRMPKVYDALKLEGSPLTLEVQQ
FT                   QLGDGVVRTIALGSSDGLKRGLMVTNTGNPITVPVGKATLGRIMDVLGNPIDERGPVDQ
FT                   SLTASIHRKAPAYDELSPSQELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMEL
FT                   INNIAKAHSGLSVFAGVGERTREGNDFYHEMADSGVVNLENLGESKVAMVYGQMNEPPG
FT                   NRLRVALTGLTIAESFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAE
FT                   EMGRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFAHLDSTVVLSRDIAALGIYP
FT                   AVDPLDSTSRQLDPQVVGEEHYQVARQVQGTLQRYKELRDIIAILGMDELAPEDKLVVA
FT                   RARKIQRFLSQPFHVAEVFTGSPGKYVPLSETIRGFKMIVAGECDHLPEQAFYMVGTID
FT                   EAFEKAKKVA"
FT   gene            314836..315252
FT                   /locus_tag="Ajs_0309"
FT   CDS_pept        314836..315252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0309"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta/epsilon subunit;
FT                   KEGG: pol:Bpro_0328 ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40563"
FT                   /db_xref="GOA:A1W2T8"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2T8"
FT                   /protein_id="ABM40563.1"
FT                   /translation="MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRI
FT                   KPGSVRIELPDGNEEFVFVAGGILEVQPDCVTVLSDTAIRGRDLDDQKAQEAKAAAEEA
FT                   LKNAKSEIDLARAQSELAVMAAQIAALRKFRQKR"
FT   gene            315383..316483
FT                   /locus_tag="Ajs_0310"
FT   CDS_pept        315383..316483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0310"
FT                   /product="putative mRNA 3-end processing factor"
FT                   /note="KEGG: ppu:PP_1106 putative mRNA 3-end processing
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40564"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2T9"
FT                   /protein_id="ABM40564.1"
FT                   /translation="MVNPLAESAADDLVVARPEGLYCPPGGFYIDPWRPVDRAVITHGH
FT                   GDHARRGHGHYLAHEHSAGILRGRLGADIALQTLAYGEPLHHNGVRISLHPAGHVLGSS
FT                   QVRLEHGGRVWVASGDYKLEADGTCAPFEPVRCDTFITESTFGLPIYRWPAQAVLQAQI
FT                   NDWWRSNAAMRRPSVLFCYAFGKAQRILHGVDASIGPLLMHGAVEPLNAAYRAAGVRLP
FT                   PTQGATDASLNAVTRETALVLAPPSAQGTPWMRRFPRHADAFASGWMQLRGTRRRRGVD
FT                   RGFVLSDHADWPGLQQAIAATGAERVFVTHGSVAVMVRWLREQGLDAQAFATEYGDEDE
FT                   AAPADAPTAAPTAPEGDAGDAAGGTS"
FT   gene            316483..318162
FT                   /locus_tag="Ajs_0311"
FT   CDS_pept        316483..318162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0311"
FT                   /product="DNA ligase (ATP)"
FT                   /EC_number="6.5.1.1"
FT                   /note="PFAM: ATP dependent DNA ligase domain protein; ATP
FT                   dependent DNA ligase; KEGG: reu:Reut_B3895 DNA ligase
FT                   (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40565"
FT                   /db_xref="GOA:A1W2U0"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2U0"
FT                   /protein_id="ABM40565.1"
FT                   /translation="MQAFAALYQALDASTSSLAKQAALRDYLRGAPPEDAAWAVYFLAG
FT                   GKPRQLVPTKLLRAVAREAAGLPEWLFDESYEAVGDLAETIALLLPPPTQAHALGLAAW
FT                   MREHLLPLRGLAPDTQAERLGAQWARLAPEERLVYFKLITGAFRVGVSRLQVTQALAAV
FT                   SGVDAKRIAQRLMGYTHVGAQPGAADYQRLVAPQGDSAGAQAAEAQGHPYPFFLAHPLQ
FT                   LPVAQFDAALGPPADWIVEWKWDGIRAQLVRRAGATWLWSRGEELVTDRFPELQALGDE
FT                   ALPDGTVLDGEIVVWQPERADAPAQPRPFADLQKRIGRKSLGPKLLREVPVVLLAYDLL
FT                   EEHGQDLRGLPLQARRARLDALLARTDHPALVPSPVLQGQSWAELARLRDSARALGVEG
FT                   MMLKGRTAHYGVGRTRDVGIWWKWKIDPMSVDAVLIYAQRGHGRRASLYSDYTFAVWSA
FT                   PQGTEGRTLVPFAKAYSGLTDAEMARVDAIIRKTTVESFGPVRSVRPTLVFELGFEGIA
FT                   RSARHKSGIAVRSPRMLRWREDKPVDEADSLDTLAALLPATP"
FT   gene            318254..321166
FT                   /locus_tag="Ajs_0312"
FT   CDS_pept        318254..321166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0312"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: reu:Reut_A1853
FT                   helicase, C-terminal:DEAD/DEAH box helicase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40566"
FT                   /db_xref="GOA:A1W2U1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2U1"
FT                   /protein_id="ABM40566.1"
FT                   /translation="MPWPRGATGGAVTAPRFPLATGWLATRGWAPFAFQRQVWRAIAQG
FT                   RSGLLHATTGAGKTYAVWLGALQAFADWESKRPVAPVHSALHAINNEAAPRTVPLTVLW
FT                   ITPMRALAADTLRALAAPLQALAAQHAGLARWSLGARTGDTGSAERSAQARRLPTVLVT
FT                   TPESLSLLLARADAREQLARVRLVVADEWHELLGNKRGVQVQLALARLAGWNPRLLVWG
FT                   MSATLGNLPEAMQTLLGREGGTLVRGRVEKRLVVDTLLPERPERFTWAGHLGLAMLPAV
FT                   VRALEESPGTTLVFVNVRSQAEQWYQALLDARPDWAGQIAIHHGSLDRAVREWVEAGLK
FT                   SGSLRAVVCTSSLDLGVDFLPVQRVLQIGSAKGVARLLQRAGRSGHAPGRPSRITLVPT
FT                   HSLELVEAAAARAAVHAGRVEKRVSPHQPVDVLVQHLATVALGGGFEPEALYAEVRRTA
FT                   AYRALPRGVWQWCLDFVARGGSALAAYPDYCRVVPDENGVWRLPDARLARRHRANIGTI
FT                   VSDASMQVQILQGARLGAVEEGFIARLSPGDCFVFAGQVLELVRTREMTAFVRRAPGRQ
FT                   PTVPRWNGSRMPLSTVLADYVVQQLAQAGRGRYASPELRAVRPLLEVQRRWSALPTPGT
FT                   LLAETLRTREGWHLFLYPFAGRHAHIGLASLFAWRAAQGVPGTFSIAVNDYGLELLSAT
FT                   ERDWPALLPDLLRTDAAAPQAARQAHALAPDEALAIRNTANATAPESVPQERDARAALL
FT                   HEVLASLNATEMARRRFREIARVAGLIFQSHPGEQRSARQLQASSQLFFEVFRRYDAGN
FT                   LLLRQADQEVLSQELDVAQLLATLTRMQAQQLMVQPLVRPGPLAFPLMVERFREQLSNE
FT                   ALADRIARMLGDMEAAASARKPVPAPPVQDVVPPDPPRRRRAAPPAAPPRQEASSAVTD
FT                   ALRGTLDFADASEGTGAAPAAARGRSPRRARKPSRPLPRL"
FT   gene            321170..321844
FT                   /locus_tag="Ajs_0313"
FT   CDS_pept        321170..321844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0313"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: reu:Reut_A1852
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40567"
FT                   /db_xref="GOA:A1W2U2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2U2"
FT                   /protein_id="ABM40567.1"
FT                   /translation="MHAPDPPADLAVDLAGTTVWLLPERALWWPEGAMLCLADLHLGKA
FT                   ATFRARGLPVPAGTTRGNLDRLAQLLARHPGVQRLVVLGDFLHAAEAHAPALLRALAAW
FT                   REDHAALELVLVRGNHDRHAGDPPAWLGARIVEEPWSLGPFACCHHPQHRAGQWVLAGH
FT                   LHPTAVLYGGGRDALRMPCFVAEPGLLVLPAFGEFTGGHAVPAAPGRQRFAVGAGRVWA
FT                   LP"
FT   gene            complement(321893..322444)
FT                   /locus_tag="Ajs_0314"
FT   CDS_pept        complement(321893..322444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0314"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   pol:Bpro_0329 protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40568"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2U3"
FT                   /protein_id="ABM40568.1"
FT                   /translation="MVTPSSSPPSGVLARLTRLLRHRWSDGGLHQALPPEVLERLGQRV
FT                   AASERRHTGQIRICVEGGLPLSYLWRGATARERAVTQFGKLRVWDTEHNNGVLIYLMLA
FT                   EHAIEIVADRALARRVPPATWRSMVSHMAEAFRQGRYEDGLTQALSEVSALLVEHFPAT
FT                   EGVDRPNELPDAPVIPGTVD"
FT   gene            complement(322470..323372)
FT                   /locus_tag="Ajs_0315"
FT   CDS_pept        complement(322470..323372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0315"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   rfr:Rfer_0103 protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40569"
FT                   /db_xref="GOA:A1W2U4"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2U4"
FT                   /protein_id="ABM40569.1"
FT                   /translation="MPLALALQALIAIFLVAIGALPATAQPLRAVPALQARVIDQTGTL
FT                   NDAQRQRLEARLAAIEQQHGSQVVVLMVPTTAPEDIAAFANRVSNAWKIGRKDVGDGVL
FT                   VVVAKDDRRMRIEVAKALEGAIPDIAAARIIDGAMKPRFREGDFAGGLDAAVQQIGARI
FT                   AGENLPAPQSSQQGDGQGRGASAGFDWTDLAVFLFFGVMVAGPVVRRLFGQRLGGLVMG
FT                   GGAGFLAFIVTSSLLLAGGAGLLALLYTWIFAGRGGPVVWHGGGWGGGHGGGWGGGGGG
FT                   GFGSGGGGDFGGGGASGDW"
FT   sig_peptide     complement(323295..323372)
FT                   /locus_tag="Ajs_0315"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            complement(323394..323999)
FT                   /locus_tag="Ajs_0316"
FT   CDS_pept        complement(323394..323999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0316"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: rfr:Rfer_0102 LemA"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40570"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2U5"
FT                   /protein_id="ABM40570.1"
FT                   /translation="MKRLIAMLSAVLALSGCGYNDFQRLDEQSKAAWSEVLNQYQRRAD
FT                   LVPNIVATVKGEAAFEQETLTKVIEARAKATSIQVTPETLNNPEAFNKFQQAQGELSSA
FT                   LSRLMVVAERYPQLQANQAFRDLRVTLEGTENRITVARNRYIQTVQEYNVLARSFPTNL
FT                   TAMVFGYEPKPSFTVANEAEISAPPKVDFSSPAPASKP"
FT   sig_peptide     complement(323937..323999)
FT                   /locus_tag="Ajs_0316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.584 at
FT                   residue 21"
FT   gene            324144..324593
FT                   /locus_tag="Ajs_0317"
FT   CDS_pept        324144..324593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40571"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2U6"
FT                   /protein_id="ABM40571.1"
FT                   /translation="MPRTPLRAAALAGSPDDLEAAFYDALQAGDVERVMACWADEDDIV
FT                   CVHPGAARHVGPAAIRAAFATLLQQGGLNVHPAQVMRVQALASAVHSVLEHVRVMLPDG
FT                   PREAVVQATNVYHKTPQGWRLVAHHASAAGMHEAEGAAPAGHLLH"
FT   gene            324666..325670
FT                   /locus_tag="Ajs_0318"
FT   CDS_pept        324666..325670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0318"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="KEGG: rpe:RPE_0805 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40572"
FT                   /db_xref="GOA:A1W2U7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2U7"
FT                   /protein_id="ABM40572.1"
FT                   /translation="MKYEAPWWLPGGHAQTIWPALWARRTLGPPPAYVRERWLAPDGDF
FT                   VDVDFLRPCAAAGAAPAPLLVLFHGLEGSSRSHYAQAFAGVARERGWGFAVPHFRGCSG
FT                   EINRAPRAYHSGDHEEIDWILRRLAGLQRTGGGARAPLLAVGVSLGGNALMRWAGEQGG
FT                   SALASADAIASVCAPLDLAAGGHAIGRGFNRQVYTRMFLRTMVPKALAKLAQYPGLFDR
FT                   AALLAARDLHAFDDLFTAPLHGFRDAEDYWRRASAKPLLPAVRVPALLVNARNDPFVPG
FT                   ASLPRDGEVAPAVTLWQPAHGGHVGFAQGGWPGHVRALPEAVAAWLADHAALG"
FT   gene            325711..326250
FT                   /locus_tag="Ajs_0319"
FT   CDS_pept        325711..326250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40573"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2U8"
FT                   /protein_id="ABM40573.1"
FT                   /translation="MDDIVKQAIAKWPNVPACYGWLGLDARGHWYLRDDAVQLQGGFAV
FT                   ARGTRLEHAKLIEFIHRNYEADGEGRWFFQNGPQRVYVELEATPLIWRLGADGEPVAHT
FT                   GRPAGRVNECLVDEAGRVYLACTAGLGLVHSLDVEALARQIDQGRWTPREVLAADLPGA
FT                   YGFVPSPQAAAGPLPA"
FT   gene            complement(326330..326872)
FT                   /locus_tag="Ajs_0320"
FT   CDS_pept        complement(326330..326872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0320"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: rfr:Rfer_0208
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40574"
FT                   /db_xref="GOA:A1W2U9"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2U9"
FT                   /protein_id="ABM40574.1"
FT                   /translation="MSDTHDEAHTGPIKNPKQLLVTVIFAFVLPVFAIIGLVLFVTADK
FT                   KPAAGSANPELAVAQRIQKIGNVEVRDANRPLRTGEAVFQGQCAACHATGAAGAPKLGD
FT                   AAAWAPRIATGFEALVQSALKGKGAMAPQGGGDFDDTEIARGVAYMANAAGAKFEEPNR
FT                   PGAEGGAAAASAPAASN"
FT   gene            complement(326993..328435)
FT                   /locus_tag="Ajs_0321"
FT   CDS_pept        complement(326993..328435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0321"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: pol:Bpro_2037 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40575"
FT                   /db_xref="GOA:A1W2V0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2V0"
FT                   /protein_id="ABM40575.1"
FT                   /translation="MHKHNLHSTRPARALSTLTAAVLLAGCSFIPHYERPAAPVPPTYP
FT                   LASASAAAPQSAASIDWKDYFTDPRLQRLIGIALDNNRDLRMAMLNVEQARAQFQIQRA
FT                   NQFPTVNAIASGTRQPSVTTGSYANQFQVGLGISAWEIDFFGRVAALKEQALAQYLATD
FT                   EARKSAQISLVAAVASGWLTLMADEELLDISRRTLETRDESVKLTRLRLENGVSSELDN
FT                   RQAESLAQAARATYAQQQRQRMLDENALVLLLGQPLPDDIRASLPSSRLADATPMQALP
FT                   AGLPSDLLVRRPDVRMAEQQLIGANANIGAARAAFFPRISLTAQFGTVSDELSGLFKSG
FT                   SWAFSLAPQLALPIFDAGRNQAGLESARAGREIAVAQYEKSIQTAFREVSDALAGQATL
FT                   QEQVDAQRAQAQADAKRFELSDLRYRNGVASYLDLLDAQRSLFATQQSLVVTRLQQLQN
FT                   QVTLYKVLGGGWTAPAEETPRS"
FT   gene            complement(328460..331614)
FT                   /pseudo
FT                   /locus_tag="Ajs_0322"
FT   gene            complement(331633..332934)
FT                   /locus_tag="Ajs_0323"
FT   CDS_pept        complement(331633..332934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0323"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rfr:Rfer_2066 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40576"
FT                   /db_xref="GOA:A1W2V1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2V1"
FT                   /protein_id="ABM40576.1"
FT                   /translation="MPLLNHAMAPTIRQAQRTPAIVSSLALAGVLTLSACGQKNDAGGA
FT                   PAQPPTPEVGVVAVQASSIGLVTELPGRLEASRVAQVRARAAGILQKRVFTEGSDVKAG
FT                   QVLFQIDSAPYQASLAQAEASVAQAEASLAQNRALAERYRPLVGVNAISKQEYDNAVAG
FT                   QKTSEANVAAAKAAVTTARINLGYATVTAPISGRIGRALVTEGALVGQGTPTELAVIQQ
FT                   IDPLYINFTQSASDALKLRAAMTSGKYKQADAKAAAVRVVLEDGSVYPQVGRLLFTDLT
FT                   VDATSGQVTMRAEVPNSDRSLLPGLYVRVRLEQAQVDNGILLPQQAVTRSGKADTVLVV
FT                   GPDNQVTPRVVKLGPAQGSHWVVLDGLKSGEQVMVDGFQKLPRGKPGDPIVVKPVAWQA
FT                   AGAAQQPATAPASAAPATPASAASSQPAPAAAKQ"
FT   sig_peptide     complement(332821..332934)
FT                   /locus_tag="Ajs_0323"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.537 at
FT                   residue 38"
FT   gene            333098..333709
FT                   /locus_tag="Ajs_0324"
FT   CDS_pept        333098..333709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0324"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; Tetracycline
FT                   transcriptional repressor MAATS-type, C-terminal domain
FT                   protein; KEGG: pol:Bpro_2034 transcriptional regulator,
FT                   TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40577"
FT                   /db_xref="GOA:A1W2V2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2V2"
FT                   /protein_id="ABM40577.1"
FT                   /translation="MARRTKADAAATRNGLLDAAEHVFYEKGVSRASLADIATVAGTTR
FT                   GAIYWHFKDKADLFNAMLDRVTHPLMQAIEDTQGMAHLARLRGLVQGVQGAVAHDERMR
FT                   RVFEIALYRVEYVEDFEAVKRHHVAGCAAFQAQIARELGLAAAAQGIDLPLSAPVAAMG
FT                   VQALFDGLLQSWLLNDANFDLEAASRQTIDAYLRGLGFCL"
FT   gene            333762..333837
FT                   /locus_tag="Ajs_R0001"
FT                   /note="tRNA-Arg1"
FT   tRNA            333762..333837
FT                   /locus_tag="Ajs_R0001"
FT                   /product="tRNA-Arg"
FT   gene            complement(334076..334849)
FT                   /locus_tag="Ajs_0325"
FT   CDS_pept        complement(334076..334849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0325"
FT                   /product="regulatory protein, IclR"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: mfa:Mfla_2558
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40578"
FT                   /db_xref="GOA:A1W2V3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2V3"
FT                   /protein_id="ABM40578.1"
FT                   /translation="MSDSPDTDDRHQGGIQVIARAGRIMRALSAHSHLSGMSLAAIAAE
FT                   VDLPRSTVQRIINALVAENIVEPAGPTGFRMGPALGQMLYTTHSDVVPVLTPHVQQLSM
FT                   KLQETVSLARLQLQKLHVVDAVVGEQVLRVVPQLGIMPPLEITAAGKVLLARLDEASLQ
FT                   AWIQQELGDRPQQAAALRQTLDTVRQQGYALDDGQIIPGVSAIAVAINTYRGAYAMMVL
FT                   APSVRMQAQLELFKQELFSLRTNLEKLLNSPTGVR"
FT   gene            335273..336499
FT                   /locus_tag="Ajs_0326"
FT   CDS_pept        335273..336499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0326"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: eba:ebA3455
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40579"
FT                   /db_xref="GOA:A1W2V4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2V4"
FT                   /protein_id="ABM40579.1"
FT                   /translation="MDLTPMHKRVIALDVHQAKITACAVVEHDDGRVEVTKRDFGAFKR
FT                   DRRALAQWALEMAPEVVVMESTGVYWKSPFAALEAVGLIAWVVNARHVKAVPGRKTDMA
FT                   DAQWLATLARAGLLRASFIPPVQMRQLRLVARQRQKLVGMCSAEKNRLHKVLVDAGIRI
FT                   NVLVADIHGQSARAMVKALIEGQPMHEVLNHKGRLRASRQELCEALSTEQFSAVHRFVA
FT                   QEIVQHIEQIEQRIARMDQYLLQGLQPWQPQLRLLQTLPGIDEQGAAMLLVEIGADMSV
FT                   FGSAERLASWVGICPGNNESAGKRKTGRIRKGNAWVRRLLCEFAQAAARTRCALKAKFD
FT                   ALTIRKGHKKSVVALAHKMLRTIYAMLSNASHYQDKEVDYEALNVQRNAPRWIKMLRKH
FT                   GFIATPAAA"
FT   gene            336684..337814
FT                   /locus_tag="Ajs_0327"
FT   CDS_pept        336684..337814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0327"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   mfa:Mfla_2557 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40580"
FT                   /db_xref="GOA:A1W2V5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2V5"
FT                   /protein_id="ABM40580.1"
FT                   /translation="MSVKFSKAAGAALAVVAAGMLMACGGQPGGQGGPQGPAAVGVFAV
FT                   QTQAVTLSTELPGRTVASRVAEVRPQTSGIVQKRLFEEGSVVKQGQALYQIDPATMNAR
FT                   LVKAQAQLQSTENLAKRYAVLREKNAISQQQYDDAMSAWRNAQADVELARIDTVYAKVL
FT                   SPISGRIGRSQVTEGALVGVGQAQPMATVQQIDPMHVDMQQSMTDILRLQAANAQASAN
FT                   VRLVLEDGSVYPLEGTLKFSEVNVDESTGSVTLRATFANPDGLLRPGMFVRAQLQTGTK
FT                   PQALLVPQQAVWRNTQGKSMVWVVGDDNVAKPRPVNAVRTVGNTWLVEGGLQSGERVIT
FT                   EGLQKLRGEMPVQPVPAQNVDIVTDLYAVNAVGKGD"
FT   sig_peptide     336684..336755
FT                   /locus_tag="Ajs_0327"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.859 at
FT                   residue 24"
FT   gene            337825..340977
FT                   /locus_tag="Ajs_0328"
FT   CDS_pept        337825..340977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0328"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   pau:PA14_05540 RND multidrug efflux transporter MexB"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40581"
FT                   /db_xref="GOA:A1W2V6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2V6"
FT                   /protein_id="ABM40581.1"
FT                   /translation="MSKFFINRPIFAWVIAIVIMLLGVLAIKGLAISQYPNVAPPAISI
FT                   SVTYPGASAQTVQDTVVQVIEQQLNGLDGLRYITSASESDGSMQIVVTFEQGTDPDIAQ
FT                   VQVQNKLNLATPMLPQEVQQQGIRVAKYQMNFMMVVGLVSEDGRMNSKDLADYIASNIQ
FT                   DPVSRTKGVGDFTLFGAPYAMRIWLDPAKLNAHQLTPTDVIAAVQSQNVQISAGQLGGL
FT                   PTINDKVQLQATVLGKTRMKTADEFREIMLKVRPNGAQVRLKDVADVQLGGQFSSISGK
FT                   FDGKPASGLALRLATGGNVLESIAAVRDTIAQLEPNFPQGVKVVYPYDTSPVVQVSIDS
FT                   VITTLLEAVVLVFLVMLLFLQSVRATIIPTLAVPVVLLGTFGILLAAGFTINLLTMFAM
FT                   VLAIGLLVDDAIVVVENVERLMHDEHLSPKEATIKSMGQISGALVGIGVVISAVFVPMA
FT                   FMDGSTGVIYRQFAITIAAAMSLSVLVALIFTPALCATILKAPVPGKKPARFFAWFNRV
FT                   FNASASGYAVGVEGILKRNKGFLLIYVLLLAGLVALFARIPTAFLPDEDQGTLMVQVQL
FT                   PSNASAARTDKVLQAVSQHLLDNEKDTVQSVMAVNGFNFAGRGQNNGLLFVELKPFDER
FT                   KGAHQHLKALYGRTWGFVSQLNDAMIIPIMPPAIIELGNATGYDFFLQDNGGVGHEVLM
FT                   QARNQMLGMAAQSPKLALVRPNGLSDEPQYQIEIDEEKARALNLNLADINATMSIAWGS
FT                   AYINDFIDRGRVKKVFLQGKADARVGPEDFSKWYVRNNLGKMVPFSAFATGKWVYGPAK
FT                   LERYNGVPAVQIVGSTAPGVSTGEAMAILQDMAKQLPPGVDLVWTGLSYEEIKAGDQSA
FT                   WIMALSMLVVFLCLAALYESWSIPFSVMLVVPLGILGAVLATLGRGLTNDVFFQIGMIT
FT                   TMGLAAKNAILIVEFARELYEDEGKPLFQAVVEAARLRLRPIVMTSLAFVLGVVPLAIA
FT                   TGASSGSQHSIGTSVVGGTLAGTFLAIFFVPLFFYVIASITQRFRKARPAAPVTPIQEK
FT                   TA"
FT   sig_peptide     337825..337905
FT                   /locus_tag="Ajs_0328"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.825) with cleavage site probability 0.340 at
FT                   residue 27"
FT   gene            340974..342392
FT                   /locus_tag="Ajs_0329"
FT   CDS_pept        340974..342392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0329"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: pfl:PFL_2142 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40582"
FT                   /db_xref="GOA:A1W2V7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2V7"
FT                   /protein_id="ABM40582.1"
FT                   /translation="MKLHTLTGAIALAGLLSACSMVPKHQTPAAPVPADWPQPTAGGTQ
FT                   AAAPVNWQQFFGNAQLRTLIELTLENNRDLRAAALNVQAFQALYRIQKADSLPTIGAEA
FT                   GGSRQRVPADVAGAPQAVTASTYSVGLGMAAYELDLFGRVQSLNDQALQNYLAMDSTRK
FT                   ATQLSLVAATASAWMTWQADQQLLDVVTRTLAANERALDLIVAQVDNGIATDLQRHQAQ
FT                   TAVDSARAQHAQFTRAVEQDLNALQALVGAPLPPSVLQTRVGIADWQLAQLPVGLPSQV
FT                   LAQRPDILAAEQQLRAANANIGAARAAFFPRIALTASVGTASSDLSGLFNGGSGAWSFA
FT                   PQISIPLFNAGRLAANLDYATLQKDMRVAQYEKAIQTAFREVADGLSARHTFVRQLQAN
FT                   QSLVQASGKYLDLAQLRYDAGVEGYLTVIDAQRNLLSAELGAVQTGLQQALSEVQLFKA
FT                   LGGGMLVADAQPGA"
FT   sig_peptide     340974..341036
FT                   /locus_tag="Ajs_0329"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.662 at
FT                   residue 21"
FT   gene            342477..343154
FT                   /locus_tag="Ajs_0330"
FT   CDS_pept        342477..343154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0330"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bxe:Bxe_B1631 HAD-superfamily hydrolase,
FT                   subfamily IA, variant3"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40583"
FT                   /db_xref="GOA:A1W2V8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2V8"
FT                   /protein_id="ABM40583.1"
FT                   /translation="MTFEAILFDCDGVLVDSEPITNGVLCQMLGEAGWQLSPDECMRLF
FT                   IGKTVRSETARIEAETGRPLTDAWMAEFYARRNARLQTELVAIANAPQAVHAVHALLQG
FT                   RIACASGADRFKVEMQLTQVGLAPYFAGRIFSGHEMPATKPAPDVYLAAAASVAVPPAR
FT                   CLVVEDTVTGVMAGVAAGATVVGYSPSPVGHGSPDALRAAGALQVMTDMAELPVLLQAL
FT                   RGL"
FT   gene            343428..343760
FT                   /locus_tag="Ajs_0331"
FT   CDS_pept        343428..343760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40584"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2V9"
FT                   /protein_id="ABM40584.1"
FT                   /translation="MANTNQGNQNQGNRNQSQGSRDNNQGQSGSGRGFASMDPDRQREI
FT                   AAEGGRAAHASGNAHEFTSQEARAAGAKSHGGGGNNASSGSGNTRGGGSGQQQARAGSQ
FT                   SHKNDR"
FT   gene            343972..344433
FT                   /locus_tag="Ajs_0332"
FT   CDS_pept        343972..344433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40585"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2W0"
FT                   /protein_id="ABM40585.1"
FT                   /translation="MTTSTPHPWGTNLQKAQTFQPDWDSYVVTKVKHVRAALLSGIDTF
FT                   SAEGFTVPMATGFIELTGMRAGSLRTFLKIGFSESNRVMLPTFQLVDNAAVGTLILPSP
FT                   CFGSALQFVNSPMAHFRIGGDGRRNALATDVTLLNSALIEAGEPEGMEI"
FT   gene            344497..344736
FT                   /locus_tag="Ajs_0333"
FT   CDS_pept        344497..344736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0333"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: mfa:Mfla_1441 alcohol dehydrogenase GroES-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40586"
FT                   /db_xref="GOA:A1W2W1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2W1"
FT                   /protein_id="ABM40586.1"
FT                   /translation="MKALTYQGAKDVRVENVPDPVLLAQDDVLLRVTATAICGSDLHIY
FT                   RGKIPGMKDGDILGHEFMGIVEDVGRKRSAARWC"
FT   gene            complement(344886..345395)
FT                   /locus_tag="Ajs_0334"
FT   CDS_pept        complement(344886..345395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0334"
FT                   /product="putative outer membrane protein"
FT                   /note="KEGG: reu:Reut_B4919 putative outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40587"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2W2"
FT                   /protein_id="ABM40587.1"
FT                   /translation="MPKICTARLVTAACGLVLAAAAHADASTKDREFLTQAATGGLYEV
FT                   QAGKLAQNRATANEVKSFGAMLVKDHTAANDELRALAARKGVALPTTLPGDKQKQLDQI
FT                   AKAQNFDQEFLSQVGLNDHRKDIALFEAAGKDADDPEIQSFALKALPKLKAHKDHAEDL
FT                   AVSIKR"
FT   sig_peptide     complement(345321..345395)
FT                   /locus_tag="Ajs_0334"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 25"
FT   gene            complement(345522..346289)
FT                   /locus_tag="Ajs_0335"
FT   CDS_pept        complement(345522..346289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0335"
FT                   /product="glutamine amidotransferase, class-II"
FT                   /note="PFAM: glutamine amidotransferase, class-II; KEGG:
FT                   pol:Bpro_4539 glutamine amidotransferase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40588"
FT                   /db_xref="GOA:A1W2W3"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2W3"
FT                   /protein_id="ABM40588.1"
FT                   /translation="MCQLLGMNANTPTDVTFSFTGFAQRAGNTADHTDGWGIAFFEGRG
FT                   LRHFVDHERATDSPVAELIRRYPIKSRNVIAHIRKATQGVVSLENCHPFVRELWGRYWV
FT                   FAHNGDLKDFRPRLHAHFHPVGTTDSEHVFCWLMQELSKSHAGMPSIEELTLTLRELAA
FT                   RIAPHGTFNFLLSNGQALWAHASTHLYYIERRHPFSQAQLCDEDLRVDFSAHTTPNDKV
FT                   AVVVTAPLTSNEQWTAFQSGEMRVFVDGQCQAA"
FT   gene            complement(346323..346511)
FT                   /locus_tag="Ajs_0336"
FT   CDS_pept        complement(346323..346511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0336"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG: pol:Bpro_4532
FT                   4-oxalocrotonate tautomerase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40589"
FT                   /db_xref="GOA:A1W2W4"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2W4"
FT                   /protein_id="ABM40589.1"
FT                   /translation="MPTYHIEMMEGRTVEQKRKLVEEITRVSVEILGGSPESVDILITD
FT                   VKRENWATGGKLWLDRQ"
FT   gene            complement(346535..346771)
FT                   /locus_tag="Ajs_0337"
FT   CDS_pept        complement(346535..346771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psb:Psyr_3980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40590"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2W5"
FT                   /protein_id="ABM40590.1"
FT                   /translation="MPTTAPSTTRCPLCGQSNGCAVAAGLPAQQCWCMHESVSRDALAR
FT                   LPAEARGRACICPLCAREEPAAPQAPAPVVPNP"
FT   gene            complement(346878..349079)
FT                   /locus_tag="Ajs_0338"
FT   CDS_pept        complement(346878..349079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0338"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: pol:Bpro_4517 malate synthase G; TIGRFAM:
FT                   malate synthase G; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40591"
FT                   /db_xref="GOA:A1W2W6"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2W6"
FT                   /protein_id="ABM40591.1"
FT                   /translation="MTARTHVHGLQVANELHAFINEQVLPGTGVEPAAFWKGFDALVAD
FT                   LAPKNAALLAERDRLQKELDTWHKANPGPIQDMAGYRAFLSQIGYLVEPPKGAQATTTN
FT                   VDAELAIQAGPQLVVPILNARYALNAANARWGSLYDALYGTDVIGEEGGAEKGKGYNPV
FT                   RGAKVIAFARDFLDQAAPLASGSHKDATAYKVEGGTLAVTLQGGATTGLKNAAQFVGYQ
FT                   GNAAEPSSVLLVNNGLHIDIRVDRNTPIGKGDAAGVADVVVEAALSTILDLEDSVAAVD
FT                   AEDKVLGYSNWLGILKGTLTDTFDKGGKQVTRGLNPDREYTGADGKPVKLHGRSLMFVR
FT                   NVGHLMTNPAILWGGEGKEIPEGILDAMVTTAIAIHDLKGGAGGIRNSRTGSVYIVKPK
FT                   MHGPAEVAFANELFGRVEQVLGLPANTVKLGIMDEERRTSVNLKACIAAAPARVAFINT
FT                   GFLDRTGDEIHTAMQAGPMIRKGDMKSSAWIQAYERNNVLVGLSMGLSGRAQIGKGMWA
FT                   APDLMKAMLEQKIAHPKAGANTAWVPNPTGATLHALHYHQVNVAAVQAELLKVDADAER
FT                   DNLLTGLLTVPVSSNPNWSETEKQQELDNNIQGILGYVVRWIDQGVGCSKVPDINDIGL
FT                   MEDRATLRISSQHVANWLLHGVVTEGQVRATFERMAAKVDQQNSGDPLYQRMHGRFAES
FT                   MAYQAACDLVFKGVEQPSGYTEPLLHAWRQKVKAAQKKA"
FT   gene            349308..350246
FT                   /locus_tag="Ajs_0339"
FT   CDS_pept        349308..350246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0339"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_4493 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40592"
FT                   /db_xref="GOA:A1W2W7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2W7"
FT                   /protein_id="ABM40592.1"
FT                   /translation="MDKLKAFESFVSVATRGSLTAAAKAEGVAPAIMGRRLDALEEHLG
FT                   VKLLVRTTRRISLTHEGSAFLEDCQRLLSDVANAEASVSAGGVKATGHLRVTAPAGFGR
FT                   RHVAPLVPRFHDLHPEVTLSLNLSDRVVDLAGEGYDCAVRVGDLPDSSLVSVRMADNRR
FT                   LCVATPQYLQRRGTPTHPGELAQHDCLTLSSDASQTRGWAFRVPVAGGGGATEVVHFKP
FT                   GGPLDCSDGQVLHDWCLGGWGIAWRSTWEVESEIAAGRLVAVLEEFAAPPNGIYVVFPQ
FT                   RKHLPLRVRLWIEYLKHHYAQPEFWARPASV"
FT   gene            350338..350922
FT                   /locus_tag="Ajs_0340"
FT   CDS_pept        350338..350922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xoo:XOO0695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40593"
FT                   /db_xref="InterPro:IPR021557"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2W8"
FT                   /protein_id="ABM40593.1"
FT                   /translation="MRIPVLSVLPALPAARWMLAVMALALVAGCALPARHAETTPRAHG
FT                   APAGMVSVTYADPAGFAEAREQTPHEPAAARRAWMDALCEHLAERVAAALPEGERAEVH
FT                   ITDVRRAGAFEPAARATAQAVRVVRDVHPPRIALEFKRLSPDGRTLAEGSRTLPGLAFQ
FT                   MRGDRYPGDKLRHEKTLIDDWVAQEFSARRP"
FT   sig_peptide     350338..350451
FT                   /locus_tag="Ajs_0340"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.838 at
FT                   residue 38"
FT   gene            350962..351417
FT                   /locus_tag="Ajs_0341"
FT   CDS_pept        350962..351417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0341"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: reu:Reut_A0848 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40594"
FT                   /db_xref="GOA:A1W2W9"
FT                   /db_xref="InterPro:IPR018706"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2W9"
FT                   /protein_id="ABM40594.1"
FT                   /translation="MTTEALLAYAHILAFLMAATFLASETALCRKEWMNAAAVERLARV
FT                   DMLYGISALLVLATGLARTWWGMKGGAWYWSQPLLHAKVTLFVVIGLMSIVPTMRFLRW
FT                   RRAVRAGGALPSDDQVRSTRRLVMIEAHLLALIPLLAVFLARGVGTR"
FT   gene            complement(351518..351850)
FT                   /locus_tag="Ajs_0342"
FT   CDS_pept        complement(351518..351850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0342"
FT                   /product="PsiF repeat protein"
FT                   /note="PFAM: PsiF repeat protein; KEGG: pau:PA14_64460
FT                   putative phosphate starvation-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40595"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2X0"
FT                   /protein_id="ABM40595.1"
FT                   /translation="MKKLLPLLAAAGFALSFAAHAADAPAAGASAPAKAPTAQQTRMKT
FT                   CNADAGAKNLKGDERKAFMKECLSGNKASTQQDKMKSCNADAVAKNLKGDARKAFMKEC
FT                   LSGAAS"
FT   sig_peptide     complement(351785..351850)
FT                   /locus_tag="Ajs_0342"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            351946..353679
FT                   /locus_tag="Ajs_0343"
FT   CDS_pept        351946..353679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0343"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: rfr:Rfer_0773 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40596"
FT                   /db_xref="GOA:A1W2X1"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2X1"
FT                   /protein_id="ABM40596.1"
FT                   /translation="MTGRPVESAPMLSVKQELLAALADELEKVSPGAGSRAAFESPKVA
FT                   AHGDLACTAAMQLAKPLKQNPRALGEQLQAALEATPAFQKWVQAIEIAGPGFLNIRLKP
FT                   AAKQQVVHEVLAQGAQYGYQPARGEKVLVEFVSANPTGPLHVGHGRQAAIGDAISHLYA
FT                   TQGWSVHREFYYNDAGVQIDTLTKSTQLRAKGFKPGDDCWPTDADNPLAKNFYNGDYIQ
FT                   DIADAFLAKATVQADDRAFTANGDVEDYENIRQFAVAYLRNEQDKDLQAFNLQFDQYYL
FT                   ESSLYANGHVDATVQRLVANGKTYEQDGALWLKSTDYGDDKDRVMRKQDGTYTYFVPDV
FT                   AYHIQKFQRGFTKVVNIQGTDHHGTIARVRAGLQAADVGIPQGYPDYVLHTMVRVVRNG
FT                   EEVKISKRAGSYVTLRDLIEWTSKDAVRFFLLSRKPDTEYTFDVDLAVAQNNDNPVYYV
FT                   QYAHARICSVLRGWREDYDVAALRDVDLSPLEGPQAQALMLLLAKYPEMLTAAAAGNAP
FT                   HDVTFYLRDLAAAYHSYYDAERILVDDEAVKQARLALVAATAQVLHNGLAVLGVSAPAR
FT                   M"
FT   gene            353692..354318
FT                   /locus_tag="Ajs_0344"
FT   CDS_pept        353692..354318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0344"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   rfr:Rfer_0774 sporulation related"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40597"
FT                   /db_xref="GOA:A1W2X2"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2X2"
FT                   /protein_id="ABM40597.1"
FT                   /translation="MKKQQRGGTIVGFILGVIVGLGAALAVAVYVTKVPVPFLNKSTPR
FT                   ASEQDEATKNKNWDPNAPLYGKNPVRPAAPAAVPASDTATAAAQPASGSRAAASRPGAA
FT                   PTSADPLGDLARAKANAAPAPATSADPFEYFVQAGAFRTQQDADAQRAKLAMLGWEARV
FT                   SEREQNGRTVFRVRVGPFGKRDDAESLKEKLDGAGVESALVRVQR"
FT   sig_peptide     353692..353772
FT                   /locus_tag="Ajs_0344"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.686 at
FT                   residue 27"
FT   gene            354377..355027
FT                   /locus_tag="Ajs_0345"
FT   CDS_pept        354377..355027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0345"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: pol:Bpro_4488 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40598"
FT                   /db_xref="GOA:A1W2X3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2X3"
FT                   /protein_id="ABM40598.1"
FT                   /translation="MKRREFSLTVASAATALSLPLAAPALAQGRQFKEGKDYVKLGKPV
FT                   ATEAPAGKIEVIEFFWYSCPHCNTFEPSLEAWIKSAPKDLHIRRVPVAFNASFVPQQKL
FT                   YYALEGMGKLPELHAKVFRAVHVERLPLNKDELIFDWIGKQGVDVAKFKEVYNSFTVSN
FT                   QVRKASQLQDGYQVEGVPSMGVAGRYYTDGTMAGNMQSVLQVVEHLVGVARKG"
FT   sig_peptide     354377..354460
FT                   /locus_tag="Ajs_0345"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            355177..355860
FT                   /locus_tag="Ajs_0346"
FT   CDS_pept        355177..355860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0346"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: rfr:Rfer_0776
FT                   OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40599"
FT                   /db_xref="GOA:A1W2X4"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2X4"
FT                   /protein_id="ABM40599.1"
FT                   /translation="MTARFVPSMRTRLPFLLLSRAAALALALAASPLVHAEKADRNKPM
FT                   NIEADALRHDELKQTSVFTGRVVMTKGTIVLRGAQLEVRQDADGFQYGVVTAEPGKRAF
FT                   FRQKRDTAPGAPDEFVEGEGEVIEYDGRADVVKLIRRAELRRYREATLTDELAGALIVY
FT                   NNLTDVFTVDGQKTAPGGATAGTPGGRVRAVLAPKEPASGTSATPPVRTEPPALRTSPS
FT                   LDGAK"
FT   sig_peptide     355177..355287
FT                   /locus_tag="Ajs_0346"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 37"
FT   gene            355869..356636
FT                   /locus_tag="Ajs_0347"
FT   CDS_pept        355869..356636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0347"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rfr:Rfer_0777 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40600"
FT                   /db_xref="GOA:A1W2X5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2X5"
FT                   /protein_id="ABM40600.1"
FT                   /translation="MDDARMSEGVSRLEALHLEKSYGSRKVVKDVSVVVQKGEVVGLLG
FT                   PNGAGKTTSFYMIVGLVRSDGGRISIDGQDVTDMPIHRRSRLGLSYLPQEASIFRKLNV
FT                   EDNVRAVLELQTDEAGRSLPRAEVERRLTALLQELRVDHLRKSPALALSGGERRRVEIA
FT                   RALATQPRFILLDEPFAGIDPIAVIEIQRIIGFLKARGIGVLITDHNVRETLGICDHAF
FT                   IISDGQVLAQGTPSDIVDNAEVRRVYLGEHFRM"
FT   gene            356689..358266
FT                   /locus_tag="Ajs_0348"
FT   CDS_pept        356689..358266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0348"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor, core-binding region;
FT                   sigma-54, DNA-binding domain protein; KEGG: rfr:Rfer_0778
FT                   sigma-54 (RpoN)"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40601"
FT                   /db_xref="GOA:A1W2X6"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2X6"
FT                   /protein_id="ABM40601.1"
FT                   /translation="MKPGLSLRVSQHLALTPQLQQSIRLLQLSTLELAQEVEQMLDENP
FT                   FLERTLEEAPREEFGLAQADAPVSEQDREAEDAIYSGAVSAGQESATSQNDAETSTAET
FT                   TAEPADWEGDGSVDLAPDDSEWGGDAPARNGAGAGSDDEVDATELARSQESLTAFLHRQ
FT                   ALALRLSELDMAALRFLIESLNDDGYLDESLQDLAASLAGTEDPEQLDELVHRFTVALR
FT                   LLQSLEPAGVGARGLAECLTLQLRAMDQDEEGDPDVIQAALAICDQPLDLLAKRDVRRL
FT                   AQACGTSEERTRAAMALIARLEPRPGRRFADVDRNIIVPDVIVKKTGRGGQQNFSVQLN
FT                   PDVMPRLRVHDIYAGALRGGRGEGHQALQARLQEARWFIKNIQQRFDTILRVSRAIVER
FT                   QKNFFVHGELAMRPLVLRDIADELGLHESTISRVTTAKYMATPQGTYELKYFFGSGLGT
FT                   ETGGNASSTAVRALIKQFIAAENPHKPLSDSQIAEMLKEQGIECARRTVAKYREALKIA
FT                   PANLRKAL"
FT   gene            358270..358713
FT                   /locus_tag="Ajs_0349"
FT   CDS_pept        358270..358713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40602"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2X7"
FT                   /protein_id="ABM40602.1"
FT                   /translation="MARVVFDLPPHFGFSTELQIYISHVNQGGHLDNAQLLSLVSEARV
FT                   RFFKSLGYPEADVAGLSTVVGDIVAQYKSEAFHGETLRVEMTPQDFNRYGFDLVFRMTE
FT                   KSQGREIARGKTGIVFIDRAARKPAPIPESVLQPLLQRAAQPQ"
FT   gene            358710..360032
FT                   /locus_tag="Ajs_0350"
FT   CDS_pept        358710..360032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0350"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   KEGG: pol:Bpro_4484 putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40603"
FT                   /db_xref="GOA:A1W2X8"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2X8"
FT                   /protein_id="ABM40603.1"
FT                   /translation="MNQLQLFLPCAAGVEGYLADEVHSLTGLAGQDLLVGRAGVLLRAS
FT                   WRDALRLNLHSRLAQRVLVQLAERPYRNEDDIYAAAADVAWEIWFTPRQSFKVEVTAQH
FT                   SPLKSLNFAALRVKDAVADRFRAKAGVRPDVQTQWPDVRVHLHLTSDRAQIYIDTSGEP
FT                   LFKRGWREDKGDAPLKETLAAAMIAATGWDPHGEQPLPLYDPCCGSGTVVIEAAQIACR
FT                   IAPGLQRRFAFEKLLPHQAHVWSAIKDEAASAVTAASVPIFGSDVSHRMVDFAQRNAVR
FT                   AGVADAVQLRGGDALQRMPPSEQPGVMLLNPPYGERIAAAGTAGRNARERMSTVERMGR
FT                   ETAQTEDGVDFFAQLAAHWKKHYAGWQAWMLTPDLKLPGKMRLKESRRVPLWNGPIECR
FT                   LFRFDLVAGAVRDRPRAGHTGEGGAASGAPGAPAGGASDAS"
FT   gene            360022..360507
FT                   /locus_tag="Ajs_0351"
FT   CDS_pept        360022..360507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0351"
FT                   /product="protein of unknown function DUF132"
FT                   /note="KEGG: pol:Bpro_4483 protein of unknown function
FT                   DUF132"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40604"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2X9"
FT                   /protein_id="ABM40604.1"
FT                   /translation="MRPELRLPAVAPAGESARAVVLDTNIVLDLFIFADAAVATVRALL
FT                   QAQRLDWIATQHMRDELERVLQYTHLQPRMAYYGVGAGDVLTAFDAGVRLVEVAPRAPW
FT                   ACKDADDQKFIDLAVAHRAIIVSKDKAVLCMRKRLLTQDTHAVAAIVFEEVCEPCPT"
FT   gene            360495..361796
FT                   /locus_tag="Ajs_0352"
FT   CDS_pept        360495..361796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0352"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="PFAM: EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase); KEGG: bbr:BB1554 putative
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40605"
FT                   /db_xref="GOA:A1W2Y0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Y0"
FT                   /protein_id="ABM40605.1"
FT                   /translation="MSNLIVHGGTPLRGRVTPSANKNAVLPVLCATLLTRAPLRLVGVP
FT                   DITDVRKILEIFRTLGSEVRWDHASATLELHHQATHFDAATHRLPEEMRSSIMLVPPLL
FT                   ARFGVARLEDNVKGCTLGVREIDPHVEVFRSFGGQVERAEGSLLVRRVGMLTPVHHWLD
FT                   YASVTTTENFVLCAVAAQGTSTLTNAASEPHVQEFCRFMQMLGAQIEGVGTSRLTVHGG
FT                   GDLGGGEFRFAEDFHEITTFLALGAITGGDVVVKNSAPENFPLIDRTFAKFGVRVEHRD
FT                   GWSRAFVDGPLTVQTPFTPNVLTKVEAAPWPYFPVDLLPIFIALGVRAQGNAMFWNKVY
FT                   DGALGWTGELSKFGAHVYQSDPHRIVTFGGGPLAPAVVESPYIIRVAIALFMVAASIPG
FT                   RSEIRNATPIRRAHPHFVENLRSLGARVEWTAEE"
FT   gene            362277..363107
FT                   /locus_tag="Ajs_0353"
FT   CDS_pept        362277..363107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0353"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   reu:Reut_B5710 sec-C motif"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40606"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Y1"
FT                   /protein_id="ABM40606.1"
FT                   /translation="MNATSDTPASAAAPALGPDELDELDSLLDDLRTREEDVPQWEFCD
FT                   GFLTALVCTRRPVPAAEWLPMLLGDGLELDVAEGEPLPLVPTFKDLAQQERFLALWELR
FT                   RAEVQAQLDEQAESLDADNAFQPEVIDMRGAIASLPEEERAEMAGQEIPSFGQVWALGF
FT                   MFAVENWPEDWATPRDKEAAQWLDGALESIVALTEDDTGKPEICMYAEDGPPSTSQERL
FT                   EVFGEAIWGVYDLRQLWRSLGPRQETIVKGEQPGRNDPCPCGSGKKYKKCCGAA"
FT   gene            complement(363323..363862)
FT                   /locus_tag="Ajs_0354"
FT   CDS_pept        complement(363323..363862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0354"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: pol:Bpro_4476
FT                   CinA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40607"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Y2"
FT                   /protein_id="ABM40607.1"
FT                   /translation="MELSKIELPALDGQALEADLIHISTALLARGWMLATAESCTGGLI
FT                   AAACTDLSGSSQWFERGFVSYSNAAKTALLGVPADLITAHGAVSEPVARAMAEGAVRHS
FT                   AAQVSVAVTGVAGPTGGSPDKPVGTVWFGWCVAGATHAELRRFGGDRAAVRAATVRHAL
FT                   GRLAQLLAQLPAPSRS"
FT   gene            complement(363868..364398)
FT                   /locus_tag="Ajs_0355"
FT   CDS_pept        complement(363868..364398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0355"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /EC_number="3.1.3.27"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   pol:Bpro_4475 phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40608"
FT                   /db_xref="GOA:A1W2Y3"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Y3"
FT                   /protein_id="ABM40608.1"
FT                   /translation="MPDTPPPTPLPPHALRRFLFVHPAHCIALGFGSGLSRVAPGTVGT
FT                   LWGWLAFLVLQLWLTPRGMGLLIALSLLLGWWACTVTARHMRVADPGHIVWDEIVAIWI
FT                   VLWLAMPMGFWGQLAAFALFRYFDAAKPGPVAWADRLFKGFGWRGGLGIMLDDLVAAFC
FT                   TLLVIALWRHWFG"
FT   gene            complement(364462..365436)
FT                   /locus_tag="Ajs_0356"
FT   CDS_pept        complement(364462..365436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0356"
FT                   /product="thiamine-phosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="KEGG: pol:Bpro_4471 thiamine-monophosphate kinase;
FT                   TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40609"
FT                   /db_xref="GOA:A1W2Y4"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Y4"
FT                   /protein_id="ABM40609.1"
FT                   /translation="MGEFDLIARYFTRPVRRAALGVGDDCALLSVTPGMQLAVSSDMLV
FT                   EGRHFFADVDPAHLGHKALAVNLSDLAACGVRPLAFTLALALPRVDAPWLQAFADGLLR
FT                   LADAHQCELVGGDTTQGPLNLCVTVFGEVPTGQALLRSGARVGDDIYVSGTPGEARLAL
FT                   DALRGRLALPPAALQQLRPRLEQPTPRVALGLALRGVASSAIDVSDGLLGDLGHILKAS
FT                   GVGACVDATVATNLLAASAQQAGATADFDAQTLMQCALAGGDDYELVFTAPPAQQAAVQ
FT                   AAAQASGTRATRIGRVEPAPGLRVVDGQGQPVAQHFASFDHFA"
FT   gene            complement(365452..366576)
FT                   /locus_tag="Ajs_0357"
FT   CDS_pept        complement(365452..366576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0357"
FT                   /product="uncharacterized enzyme"
FT                   /note="TIGRFAM: uncharacterized enzyme; PFAM:
FT                   glutamate--cysteine ligase, GCS2; KEGG: pol:Bpro_4470
FT                   enzymatic protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40610"
FT                   /db_xref="GOA:A1W2Y5"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2Y5"
FT                   /protein_id="ABM40610.1"
FT                   /translation="MSLEAFHHSEPLTLGVELELQLVSTNDYDLAPYAEDMLRIMKKVP
FT                   LPGSVVPEMTNSMIEISTGVCHSSSEVLGQLTQIRDALVKSADKLNIAVVGGGTHPFQQ
FT                   WHERRIYDKPRFQELSQLYGYLSKQFTIFGQHVHIGCPDADSALLMLHRMSRYIPHFIA
FT                   LSASSPYVQAQDTQFDSARLNSVFAFPLSGRAPCVLTWSEFEQYFNKMTRTGVVKSMKD
FT                   FYWDIRPKPEYGTIEIRVFDTPLTIERAAALAGYVQSLAAWFLAEQPFTPTEDDYLVYT
FT                   YNRFQACRFGLDAVYVDPASGDHMPLRDHILQTLDHVARYAGTHGASGALHMLRGETAL
FT                   GQNDARWLRERQREEQLLAEVSRQAALRFRGHDI"
FT   gene            complement(366566..367831)
FT                   /locus_tag="Ajs_0358"
FT   CDS_pept        complement(366566..367831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0358"
FT                   /product="transporter, CPA2 family"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: pol:Bpro_4469
FT                   sodium/hydrogen exchanger; TC 2.A.37"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40611"
FT                   /db_xref="GOA:A1W2Y6"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Y6"
FT                   /protein_id="ABM40611.1"
FT                   /translation="MNELMSFWAQWLRPSAGLPTVQWSLLLAVASITGYLVQRYSGLPK
FT                   VVGYTLVGTIVGLLGFGGAVWPLQGIGLFLVELGVAVVLFEAGGRIPLRWFRHNPMVLV
FT                   QSIAESAFTYFAVYWTMLWFDVPERAAGPLALVAMAASPAVLTRVVSDTRAAGPVTDRA
FT                   VVLATLSSLYALALGSAQAELINRPGVGLVGTLYPALVVLGVSVAVGALLSLILRLALR
FT                   VMSPTSENTSMLLMALIAASTAVTAHMGGSAPLAALLGGMLLKQLHPRPWAWPRQMGTA
FT                   SSLLTMLMFVLVSTVAAQADWSGPVVGAVLALIFVRLLAKALGVGVGNVGSGASWRQAL
FT                   WLSCAMAPMSAIALLVASQFVVASASTGHLIARIALPAILVMEVLGAVIATVAIYRAGE
FT                   SSKPWAPLSSRGSNTGDTQRES"
FT   gene            complement(368013..369995)
FT                   /locus_tag="Ajs_0359"
FT   CDS_pept        complement(368013..369995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0359"
FT                   /product="putative site-specific recombinase transmembrane
FT                   protein"
FT                   /note="KEGG: rfr:Rfer_0530 putative site-specific
FT                   recombinase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40612"
FT                   /db_xref="GOA:A1W2Y7"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Y7"
FT                   /protein_id="ABM40612.1"
FT                   /translation="MSRSGPDLAQLLAGIDPTAPLAQRHLQLIAVLDWVRGDGQSTEGA
FT                   AGRVALLVEAAERSPDIQVRLQAWWAALTQQVDITTLLADFGFAQRTSMASELAERVRY
FT                   KLLPSSPETLDASELFMLALPSDFDARWLASLDETLLGRLLAVLVPASEQGGASHWQRA
FT                   LLDAITYCAGQILSTGFAPELRLRMSEEAREAQPFHALIRDVESLRVEVEHPLRTGDRL
FT                   QEAVQRLRERLDACRAATNTVYAHFEDNGISVGLVFRLRQLRERILRVRELLECLLSPR
FT                   PAVAAAKFLARLVTVGRERRSLRALVASNSSMLAAKVAERSAETGAHYITRTAGEYLAM
FT                   VRKAAGGGLVMAFTTLAKFGLYALALSAFWGGFMAGVNYAVSFVLIQLLHFTVATKQPA
FT                   MTAPAMAAKLKDLDEAQGLESFVDEVAHLVRSQVAAVLGNVLLVFPGALALALLIAQML
FT                   GQPAIGTAQAEHVLQSLHLLGPSLLFAAFTGVLLFASSIFAGWVENWFVLRRLDSAIQY
FT                   NPRITHMLGAARAARWARFLRGNISGFAANISLGFMLGLTPAFAAFFGLGLDVRHVTLS
FT                   TGQIGVASATLGMDVLHQPAFWWALAMVPFNGALNVLVSFYLAFRLALRAHNVGSVDRA
FT                   RIYRALLARWRSAPLGFFLPPRRTV"
FT   gene            complement(369992..370405)
FT                   /locus_tag="Ajs_0360"
FT   CDS_pept        complement(369992..370405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0360"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: pol:Bpro_4467 ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40613"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2Y8"
FT                   /protein_id="ABM40613.1"
FT                   /translation="MPKYQFQVQVQVQPQYLPDQSAPDEGVYSFAYTITITNTGDVTAQ
FT                   LISRHWIISDANGHTEQVKGLGVVGQQPLLKPGEAFQYTSGCRLRTASGSMHGSYFCVA
FT                   EDGEPFTCPIELFVLEAFSPGQPGQPMAARVLH"
FT   gene            370517..371197
FT                   /locus_tag="Ajs_0361"
FT   CDS_pept        370517..371197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0361"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   rfr:Rfer_0532 ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40614"
FT                   /db_xref="GOA:A1W2Y9"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Y9"
FT                   /protein_id="ABM40614.1"
FT                   /translation="MSRTYRIAPSILSADFARLGEEVRNVIAAGADWIHFDVMDNHYVP
FT                   NLTFGPMVCQALKPHAVTPAGHAVPIDVHLMVQPVDELATAFAKAGADLISFHPDASAH
FT                   VHRSIQNIRAQGCKAGLTFNPAMPLDVLDWVIEDIDLILLMSVNPGFGGQSFIDSTLRK
FT                   IEAARRRIEASGKDIRLEVDGGIKADNIRRVADAGADTFVAGSAIFGKSDYKAVIDAMR
FT                   AELA"
FT   gene            complement(371238..371603)
FT                   /locus_tag="Ajs_0362"
FT   CDS_pept        complement(371238..371603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40615"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Z0"
FT                   /protein_id="ABM40615.1"
FT                   /translation="MALHRFTALLPAALLLCAGAAQAANEVRSQYSSDRAACASVPAES
FT                   RAACVREAGAAAQAARTGQLSSSDTSIYERNALARCEAFKTPQDRSDCEARVRSSATVS
FT                   GSVEGGGVLREATTPVQ"
FT   sig_peptide     complement(371532..371603)
FT                   /locus_tag="Ajs_0362"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            371770..372555
FT                   /locus_tag="Ajs_0363"
FT   CDS_pept        371770..372555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0363"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="KEGG: rfr:Rfer_3611 phosphoglycolate phosphatase;
FT                   TIGRFAM: phosphoglycolate phosphatase ; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40616"
FT                   /db_xref="GOA:A1W2Z1"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Z1"
FT                   /protein_id="ABM40616.1"
FT                   /translation="MERVQQDLAALLARTDAAIVDLDGTMVDTLGDFAEALNRMLRDLQ
FT                   LPAIAPGAIERMVGKGSEHLLRSVLKHVLAPDQQALTAMQLEAKAEALYPQAWERYQHH
FT                   YLAINGQYAALYAGVAEGLAALHRTGRPLVCLTNKPTDFARPLLRAKGLDGFFTHVFGG
FT                   DAFARKKPDPLPLLKACEAVGTSPARTLMIGDSSNDAQAARAAGCPVVLVTYGYNHGQP
FT                   VRGVDADGYVDALTELIARACSHYFCQCEWRENRANLGA"
FT   gene            complement(372815..374557)
FT                   /locus_tag="Ajs_0364"
FT   CDS_pept        complement(372815..374557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0364"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rfr:Rfer_2225
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40617"
FT                   /db_xref="GOA:A1W2Z2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Z2"
FT                   /protein_id="ABM40617.1"
FT                   /translation="MHLSNLKVGTRLALSFGLVLLITVVIAAVGIWRLQELASVTHQLT
FT                   STDNERLRAASTWRQAIDLNWVRTRAAILDADTSHLSSWQSEIAKTSEEASKAQEVVER
FT                   LVTTDEGRRLLADIAKTREAYRGPRAELLKRKAAGESVGELLDSQLKPLADAYLQSIVA
FT                   MEQRQRALYESTRDNAAKQATRSRAILMVVTAVALLVGAGAAILLSRSVTGPLQLAVRG
FT                   AGLIAEGDLTQSIQAHGRDEAAALLKALGHMQGNLARVVAGVRANAESVASASAEISQG
FT                   NHDLSGRTESQASALEETAASMEQLGATVRQNADNARQANQLAMNASTVAVQGGEVVSE
FT                   VVDTMRGINESSRKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRA
FT                   LAQRSAEAAKEIKQLITASVERVEQGSQLVDKAGATMTEVVTAIRRVTDIMGEISAASS
FT                   EQSAGVAQVGEAITQMDQATQQNAALVEEMAAAASSLSGQARELVEAVAVFKLAQKASA
FT                   LPRMAPVHATAAPAPVPATSATPAAPARPATPPAAALARPAAARPQPAQAARTTADNDE
FT                   WESF"
FT   sig_peptide     complement(374474..374557)
FT                   /locus_tag="Ajs_0364"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.958 at
FT                   residue 28"
FT   gene            complement(374679..375281)
FT                   /locus_tag="Ajs_0365"
FT   CDS_pept        complement(374679..375281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0365"
FT                   /product="putative lipoprotein transmembrane"
FT                   /note="KEGG: pol:Bpro_4459 putative lipoprotein
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40618"
FT                   /db_xref="GOA:A1W2Z3"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Z3"
FT                   /protein_id="ABM40618.1"
FT                   /translation="MPFTRRRTLQWGALALPLCLALPAPASTEPTTAAGVKFEPTLDLG
FT                   GSKLQLNGAGVRYKAVFKVYAAGLYLEKKASTPAEVYALRGPKRISVTMLRDIDSTELG
FT                   KLFSRGMEDNMDKAAFSKLIPGVLRMSQIFSEHKKLMAGEQFVVDWLPGTGTQVTVKGV
FT                   PQGEPFKEPEFFNALLGIWLGSQPADWKLKDALLGKE"
FT   sig_peptide     complement(375195..375281)
FT                   /locus_tag="Ajs_0365"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 29"
FT   gene            375578..377137
FT                   /locus_tag="Ajs_0366"
FT   CDS_pept        375578..377137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0366"
FT                   /product="anthranilate synthase, component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: rfr:Rfer_3607 anthranilate synthase component
FT                   I; TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Anthranilate synthase component I and chorismate binding
FT                   protein; Anthranilate synthase component I domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40619"
FT                   /db_xref="GOA:A1W2Z4"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Z4"
FT                   /protein_id="ABM40619.1"
FT                   /translation="MILRRTGAASDRAARAGNLLVITELEFKSLASEGYNRIPLMAEAF
FT                   ADLETPLSLYLKLAHGKGDGKHSFLLESVVGGERFGRYSFIGLPARTLLRSSGFGDAAR
FT                   TEVVTDGQVVETHPGNPLDFIAAYQERFKVALRPGLPRFCGGLAGYFGYDAVRYIEKKL
FT                   EATCPPDTLGCPDILLLQCEELAVIDNLSGKLYLIVYADPAQPEAYAKGKKRLRELKDQ
FT                   LKYSVSAPVVRPTESHTAQRSFAKADYLAAVERAKELIAAGDFMQVQVGQRIHKRYTES
FT                   PLSLYRALRSLNPSPYMYYYNFGDFQVVGSSPEILVRQESTPEGQKVTIRPLAGTRPRG
FT                   ATPEADKATEVELVNDPKERAEHVMLIDLARNDIGRIAKTGTVKVTEAFAVERYSHVMH
FT                   IVSNVEGILNDGMTSMDVLKATFPAGTLTGAPKVHAMELIDQLEPSKRGLYGGACGYLS
FT                   YAGDMDVAIAIRTGIVKDGTLYVQAAAGVVADSVPELEWKETEHKARALLRAAELVEEG
FT                   LE"
FT   gene            377134..377478
FT                   /locus_tag="Ajs_0367"
FT   CDS_pept        377134..377478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0367"
FT                   /product="Chorismate mutase"
FT                   /note="PFAM: Chorismate mutase; KEGG: pol:Bpro_4456
FT                   chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40620"
FT                   /db_xref="GOA:A1W2Z5"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Z5"
FT                   /protein_id="ABM40620.1"
FT                   /translation="MTTRAIDKTQPCASMAEVRARIDALDDILVPLLVERGGYMTQAAL
FT                   NKPREDQVRDEARIEAIVQRVRARAAAEGGEPDVIEAIYRSMMEAYIAYEHREFARLCA
FT                   EGRKGQEVTP"
FT   gene            377475..378047
FT                   /locus_tag="Ajs_0368"
FT   CDS_pept        377475..378047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0368"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   pol:Bpro_4455 glutamine amidotransferase of anthranilate
FT                   synthase or para-aminobenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40621"
FT                   /db_xref="GOA:A1W2Z6"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Z6"
FT                   /protein_id="ABM40621.1"
FT                   /translation="MTRVLMVDNYDSFTYNIVQYFGELGAEVEVFRNDEITLEGIAARA
FT                   PDRLVISPGPCSPAEAGISVAAIQHFASKLPILGVCLGHQSIGAAFGGKIIRAQQLMHG
FT                   KTSVITTTQTGVFAGLPKQFTVNRYHSLSIERASCPEVLEVTAWTDDGEIMGIRHRELA
FT                   IEGVQFHPESILTEHGHAMLKNFLDQK"
FT   gene            378145..379179
FT                   /locus_tag="Ajs_0369"
FT   CDS_pept        378145..379179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0369"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="KEGG: pol:Bpro_4452 anthranilate
FT                   phosphoribosyltransferase; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase; PFAM: glycosyl transferase,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40622"
FT                   /db_xref="GOA:A1W2Z7"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2Z7"
FT                   /protein_id="ABM40622.1"
FT                   /translation="MTPITPQEALQRTIEHREIFHDEMLHLMRMIMSGELSPVMTAAIT
FT                   TGLRVKKETIGEITAAAQVMREFSHKVQVHDTKHLVDIVGTGGDGANTFNISTCATFVI
FT                   AAAGAKVSKHGGRSVSSKSGSADAMEALGVHINLQPAQIAQCIGDVGIGFMFAPNHHPA
FT                   MKNVAPVRKELGVRTIFNILGPLTNPAGAPNILMGVFHEDLVGIQVRALQRLGAEHALV
FT                   VYGRDGLDEISLGAGTLVGELKDGAVREYEIHPEDFGLRMAGTRALRVENPTESKAMLM
FT                   GVLQGDEGPARDIVCLNAGAALYAANVADSLEDGLRRAQQALASGAALAKLQQLVAYTQ
FT                   KLAA"
FT   gene            379434..380234
FT                   /locus_tag="Ajs_0370"
FT   CDS_pept        379434..380234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0370"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   pol:Bpro_4451 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40623"
FT                   /db_xref="GOA:A1W2Z8"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W2Z8"
FT                   /protein_id="ABM40623.1"
FT                   /translation="MSDILKKICDVKVEEVAAAQKRVSFTDMRRDAESRVLTRDFVGAL
FT                   RAKIDQGQAGVIAEIKKASPSKGVIREDFIPADIAQSYAEGDGKVGAACLSVLTDRQFF
FT                   QGQPDYLKQARASCPLPVLRKDFMIDPYQIYESRAFGADCVLLIAACLEDGLMAEMEQI
FT                   ARSLDMAVLVEVHDGAELERALRLQTPLVGINNRNLRTFEVSLQTTLDLKKEVPADRLL
FT                   VAESGILAPVDVHTLRDAGVNAFLVGEAFMRAPDPGRALAQLFA"
FT   gene            380373..383045
FT                   /locus_tag="Ajs_0371"
FT   CDS_pept        380373..383045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0371"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: rfr:Rfer_3606 diguanylate cyclase with PAS/PAC
FT                   sensor; TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; PAS fold-3 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40624"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1W2Z9"
FT                   /protein_id="ABM40624.1"
FT                   /translation="MRERPDTQAERFRREWWLLAGLWLALGALIAVVLILERRDTEARE
FT                   RQQVAHQVHIVHENLERQLHAVNQALGDIVANLAQWRARPEGALPFNERLRAFSDAMTG
FT                   VRTLTVLDAEGTVVASSRAELLGENFAYRDYFQSARRLASREQPSLIVSAPMRTVLGIW
FT                   AITLSRPVVAEDGLPGGVVAATLDPDEFKTLLDSVRYAPDVESTLVHGDGVRFLRVPER
FT                   AGLLGATLAQPGTLFQAHLDSGRMESLFVGAMEPDPAERLVALRTIFPAHLHMDKPLVA
FT                   AVARDWSQVFAAWRARAWTLGVAWLLTGVAIGLGLGFMQRRRRQLWRREQALAAQEAAL
FT                   QARWQAVLHATQQGVWDWDVAAGTVYFSPVWKTMLGYAEGDIGDSLQEWESRVHPDDLA
FT                   RVQADVARHLAGETPVYENVHRLRCEDGSYKWVQDRGQVTARDASGRPTRLIGTHTDVT
FT                   AQRQHQETLDRLAENVPGALYQYQREPDGRSHFPYVSSGVQDIYGLPPQALCVDAEQVF
FT                   ARIHPDDLQALRESVLASAQTLELWRTEYRVLVPGERERWVSGQARPARTASGAVLWHG
FT                   YIHDVTLAKQQALQQQETERLLTHLMQEMPIGLCMINAAGVIYFRNRRFQDLFGYTEAE
FT                   VPTLGQWWPRAYPDPHYREQVIAAWNADLAQAGAQGGEIADREYRVTDRDGRLHTMTIG
FT                   GLAFGDHCMATFVDVTEQRAQHELLRKLAFMDGLTGLANRRQLDRTLKAEWRRCRRSGQ
FT                   PLSVVMVDIDHFKQFNDLYGHQQGDDCLRAVAAALRGGLGRSHDLVARYGGEEFVCLLP
FT                   ECDLDGARAKAQALCRAVHARQMEHRGSPVAPVVTVSAGVACVVPGAEDTPEQLLARAD
FT                   ANLYRAKAAGRNRVHDGMD"
FT   gene            383100..383813
FT                   /locus_tag="Ajs_0372"
FT   CDS_pept        383100..383813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0372"
FT                   /product="uracil-DNA glycosylase"
FT                   /note="TIGRFAM: uracil-DNA glycosylase; PFAM: Uracil-DNA
FT                   glycosylase superfamily; KEGG: pol:Bpro_4450 uracil-DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40625"
FT                   /db_xref="GOA:A1W300"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A1W300"
FT                   /protein_id="ABM40625.1"
FT                   /translation="MLNTPAATQLQSADPADWPVAPGWQPLVDTFFASARGRQLLAFLQ
FT                   ARLEAGAAIFPPQPLRALQLTAPEDTRVVILGQDPYHGRGQAEGLAFSVAPGVRLPPSL
FT                   QNIFKEMQRDMGVPFPPFPNPGGSLVKWAQNGVLLLNTCLTVEEGQAASHAGKGWEQLT
FT                   DAVIREVAEGPRPVVFMLWGSHAQSKRAFIPQDRGHLVLTSNHPSPLSALRPPVPFIGN
FT                   GHFGQARAFRQQYGY"
FT   gene            complement(383814..384701)
FT                   /locus_tag="Ajs_0373"
FT   CDS_pept        complement(383814..384701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0373"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: pol:Bpro_1004 putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40626"
FT                   /db_xref="GOA:A1W301"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1W301"
FT                   /protein_id="ABM40626.1"
FT                   /translation="MSAAPAGHSPRTALAGIALTVGACASFALLDTATKLVSATTPLLL
FT                   ALWLRYVFQSLVTSAYVLPRSGWRPPRTDHPRYQLLRAVLFAATSLFGIFSIRAMPLAE
FT                   FTAIVAATPLCVTLVAALWLRQPVSPLRWLLVATGLASVLLILRPGGQSFSGVLVLPLG
FT                   MLACGTGYQILSSRMAGQEAPTTTQFYTSWIAAGLMTLAVPFVWTAITSAWVWLGLVVM
FT                   GLSSALGHLLLLRAYACAAPATIAPFLYTQIAFAMLAGWAVYGHMPDRWSLLGICLIAA
FT                   SGAASAWLTVRERR"
FT   sig_peptide     complement(384609..384701)
FT                   /locus_tag="Ajs_0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.608 at
FT                   residue 31"
FT   gene            complement(384698..385798)
FT                   /locus_tag="Ajs_0374"
FT   CDS_pept        complement(384698..385798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0374"
FT                   /product="S-adenosylmethionine--tRNA-ribosyltransferase-isomerase"
FT                   /note="TIGRFAM:
FT                   S-adenosylmethionine--tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein; KEGG: rfr:Rfer_0628
FT                   S-adenosylmethionine"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40627"
FT                   /db_xref="GOA:A1W302"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:A1W302"
FT                   /protein_id="ABM40627.1"
FT                   /translation="MSSASTAPRTFTLSDFDFELPELLIAQHPAPQRSGSRLLDGRTAP
FT                   PTDRIFRELPDLLQPGDLLVFNDTRVVKARVFGEKASGGKLELLIERVLTGNEVVAHMK
FT                   VSKKPLPGATLHLAGGAAAGGFDATLLGRYPDADGPLFRLALRGPAGESPWELMERHGH
FT                   LPLPPYIERQQAGGNDPHAGEDSERYQTVFARAPGAVAAPTAALHFDDAVLARLAERGI
FT                   ERASVTLHVGAGTFQPVKTENLAEHRMHSEWYEVPLATLAALERCRQRGGRVVAVGTTT
FT                   VRTLESWAASGQATGDTSIFITPGFSFQVVDLLLTNFHLPKSTLMMLVSAFAGYEHIMH
FT                   LYRHAVAQRYRFFSYGDCMLLERPRA"
FT   gene            complement(385902..387103)
FT                   /pseudo
FT                   /locus_tag="Ajs_0375"
FT   gene            387162..389333
FT                   /locus_tag="Ajs_0376"
FT   CDS_pept        387162..389333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0376"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: rfr:Rfer_3688 ATP-dependent DNA helicase RecG;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG; PFAM: helicase
FT                   domain protein; nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40628"
FT                   /db_xref="GOA:A1W303"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A1W303"
FT                   /protein_id="ABM40628.1"
FT                   /translation="MPRPTRSSTSASSSAKPAPSPAQQALVKLGLVRDIDLALHLPLRY
FT                   EDETRITPIRSARDGDTVQIEATVTASEVQMRPRRQLVVTVEDGTGSCELRFFSFYPSH
FT                   QKTMAVGARLRVRGEIKGGFWGRQMLHPAFRKAEGDLPAALTPVYPTVAQLPQAYLRRA
FT                   VASALTRVELPETLPPGLEPPAVPSWVRGNGQNGLQRPWSLRESLLFLHHPTPDVALAT
FT                   LQDHSHPAWQRLKAEELLAQQLSQLTAKRERARLRAPALRPQAQAGSTPLHEQLLGVLP
FT                   FSLTAAQRRVGEEIARDLARPVPMHRLLQGDVGSGKTVVAALAATVCMDAGWQCALMAP
FT                   TEILAEQHFAKLIGWLQPLLAARGRQVAWLVGGQKKKERAEMLARIESGEAALVVGTHA
FT                   VIQEQVRFKNLALAVIDEQHRFGVAQRLALRKKLQHAGMEPHLLMMSATPIPRTLAMSY
FT                   YADLDVSTIDELPPGRTPIVTKLIADSRKDEVVERIGAQVAAGRQVYWVCPLIEESEAL
FT                   DLSNATATHAELSEALQGDAAPGRAPVMVGLLHSRMPAAEKKAVMDLFKGGQMGVLVST
FT                   TVIEVGVDVPNASLMVIEHAERFGLSQLHQLRGRVGRGAAASACVLLYSTGDSGRLGET
FT                   ARDRLKAMAETTDGFEIARRDLEIRGPGEFLGARQSGDALLRFADLATDTLLLEWARET
FT                   APQMLDRHPLLAERHIQRWLGGKSDYLKA"
FT   gene            389402..390367
FT                   /locus_tag="Ajs_0377"
FT   CDS_pept        389402..390367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0377"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rfr:Rfer_3681 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40629"
FT                   /db_xref="GOA:A1W304"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W304"
FT                   /protein_id="ABM40629.1"
FT                   /translation="MTLTELKYIVAVAREKHFGRAAEACYVSQPTLSVAVKKLEDELEV
FT                   KLFERSAGDVSVTPLGEEIVRQAQSVLEQAAAIKEIAKRGKDPLAGALTLGVIYTIGPY
FT                   LLPELVRHAIARTPQMPLMLQENFTVKLLEMLRTGEIDCAIMAEPFPDTGLAIAPLYDE
FT                   PFLAAVPSSHPLAERDAVSASELKNETMLLLGAGHCFRDHVLGVCPEFARYASNAEGIR
FT                   RTFEGSSLETIKHMVSAGMGVTLVPRLSVPRDALHTGARRRKSDDTHIRYLPIKESDGS
FT                   PPPMRRVVLAWRRSFTRYEAIAALRNAVYACELPGVTRLS"
FT   gene            390445..390963
FT                   /locus_tag="Ajs_0378"
FT   CDS_pept        390445..390963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0378"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG: bbr:BB2935
FT                   putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40630"
FT                   /db_xref="GOA:A1W305"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A1W305"
FT                   /protein_id="ABM40630.1"
FT                   /translation="MAKPSSKSVSTKSGAPRINIGISDKDRAAIAQGLSRLLADTYTLY
FT                   LTTHNFHWNVTGPMFNTLHTMFMAQYTELWNAVDPVAERIRSLGHVAPGSYAQFGQLTS
FT                   LPDVPAQPPKATEMIRILVEGHEAVARTARELFPLADKASDEPTADLLTQRLTVHEQTA
FT                   WMLRSLLED"
FT   gene            390990..392528
FT                   /locus_tag="Ajs_0379"
FT   CDS_pept        390990..392528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0379"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: CHAD domain containing protein; adenylate
FT                   cyclase; KEGG: rfr:Rfer_2024 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40631"
FT                   /db_xref="GOA:A1W306"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:A1W306"
FT                   /protein_id="ABM40631.1"
FT                   /translation="MSATETELKLALPPRDAAALAVRLMRVPALARATPVREHLVSLYH
FT                   DTPAQDLLRQRVALRLRREGPEGAGARWLQTLKTAGDTTSALSQRGEWEMPVAGPALEL
FT                   HRLEGTPWPAMDPDGVLAAALQPCFTTDFVRTRWRVRVRGGAVVEVALDVGAVTATVDG
FT                   AAHATPLCELELELLQGPPEALLALARRIARHVPVLPLAASKAARGYALLHPPASPALE
FT                   AQPPALKRGMTVAQVAERVLQEPFHQFCANLFALQQGSDAPEVVHQARVGWRRLRSLAR
FT                   LFAPACAARPAPAAAALAPLLQSLGHLRDLDVARTQTLPALAAHYAQGGARQAAAWAAA
FT                   QAALDAAADQARAQTRAALHRPAVGAALLAWQDWLHGWALAAQGECGVDACASDALAGA
FT                   PARHWVRKRVQRLVRRLGAALKTAGDDEGLHHARILAKRLRYGSTSLAPLLPRRMGRHR
FT                   GAAEQWQERLGAQRDWAQAAALVAGCGGDAAVVAFLRGAALGRGWDPLRDAARR"
FT   gene            392732..393604
FT                   /locus_tag="Ajs_0380"
FT   CDS_pept        392732..393604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0380"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: pol:Bpro_0474
FT                   4-hydroxybenzoate polyprenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40632"
FT                   /db_xref="GOA:A1W307"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W307"
FT                   /protein_id="ABM40632.1"
FT                   /translation="MSAVAPRSRLSLYLDLIRWNRPAGWLVLVWPTLAALWVAADGFPG
FT                   WHLLAVFVAGTVLMRSAGCTINDIADRDFDRHVKRTTQRPITSGQLGVREAALVGVVLT
FT                   LVAFVLVLTTRWEAVAWSVPAVLFTILYPFTKRFFAMPQAFLGIAFNFGIVIAFAAVQG
FT                   RVPATAWVLWLANLFLVLAYDTEYAMVDRDDDLKIGMKTSAITLGRFDVAAIMGFFVLC
FT                   LGLTAWVLAPYGLGWPLWLGLGVAAAQVAWHFTLIKDRTREGCFTAFSKSHWIGAAIFA
FT                   GVALGYLLR"
FT   gene            complement(393659..394525)
FT                   /locus_tag="Ajs_0381"
FT   CDS_pept        complement(393659..394525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0381"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: pol:Bpro_0475 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase, coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40633"
FT                   /db_xref="GOA:A1W308"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W308"
FT                   /protein_id="ABM40633.1"
FT                   /translation="MPPDLIASPPHPMTASASPLPPIAFIGGGNMASAIIGGLLQRGLP
FT                   AGQIEVVEPFEPARAALREKFGITAQPAAGDALARAALVVWAVKPQTFKEAAAATRAHT
FT                   ATALHLSVAAGIPTDSIARWLDTQHIVRAMPNTPALVGKGITGLFARPQVDPQGKALVE
FT                   RVIATTGQFVWVEAEEQLDAVTALSGSGPAYVFLFLEAMTQAGVDMGLPPAQAYQLAVA
FT                   TFQGASELAARSPESAEVLRQRVTSKGGTTHAAITHLQAAQVPAHFIAAMRAAEARAKE
FT                   LAAEFGA"
FT   gene            complement(394655..396151)
FT                   /locus_tag="Ajs_0382"
FT   CDS_pept        complement(394655..396151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0382"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: pol:Bpro_0476 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40634"
FT                   /db_xref="GOA:A1W309"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W309"
FT                   /protein_id="ABM40634.1"
FT                   /translation="MTYLLALDQGTSSSRSIVFDERGHIVAQAQLELPQIYPQPGWVEH
FT                   DPLEIWRTQIATARDALAKAGIAANAVRAVGITNQRETTVLWNRKTGQPVHHAIVWQDR
FT                   RAEPACAQLREQGHAATIQAKTGLLIDAYFSGTKLQWLLDHVPGARDAAEAGELAFGTV
FT                   DSWLIWQLTGGKRHVTDVSNASRTMLFNVHTNQWDDELLQLLRIPRALMPEVLPSASDF
FT                   GATDAALLGGPIAIGGVAGDQQSALFGQACFTAGMAKNTYGTGCFMLMHTGSRFQKSEN
FT                   GLLTTSAAQAGQSPEYAMEGSVFVGGAVVQWLRDGLRAISASSEVQALAESVPDSGGVM
FT                   MVPAFTGLGAPYWKPDARGTITGLTRGTTIAHIARAALESIAYQSAALLAAMSRDAVAA
FT                   GGAPVSELRVDGGACVNDLLMQFQADLLGIPVVRPAVVETTALGAAYLAGLASGVYAST
FT                   DELSALWQAERRFTPTLPRSQAEALMARWEHAVAQAVLPG"
FT   gene            complement(396171..396935)
FT                   /locus_tag="Ajs_0383"
FT   CDS_pept        complement(396171..396935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0383"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; Helix-turn-helix,
FT                   type 11 domain protein; KEGG: pol:Bpro_0477 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40635"
FT                   /db_xref="GOA:A1W310"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1W310"
FT                   /protein_id="ABM40635.1"
FT                   /translation="MNTNPRQLQLLEEVRARKSATVEQLADTLGVTLQTVRRDVQRLAE
FT                   SGLLTRFHGGVRVPSSTVENLAHTQRETLHADGKARIARAVAEQVPNDCSLILNIGTTT
FT                   EAIAKALLHHRGLRVITNNLNVAAILSSNPECEVIVAGGVVRGRDRGIVGEAAVDFIRQ
FT                   FKVDIALIGISGIEPDGSLRDFDYREVKVAQTIIEQAREVWLAADHSKFNRPAMVQLAT
FT                   LNQIGRLFTDAPPPEPFPTLLQDAGVICTVAA"
FT   gene            397171..398244
FT                   /locus_tag="Ajs_0384"
FT   CDS_pept        397171..398244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0384"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_0478 ABC transporter related; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40636"
FT                   /db_xref="GOA:A1W311"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W311"
FT                   /protein_id="ABM40636.1"
FT                   /translation="MQLALDSISKKVGAQTWLYDMSLALQSNAVTVLLGATQAGKTSLM
FT                   RIMAGLDVPTQGRVLVDGKDVTGTPVRERNVAMVYQQFINYPSMKVFDNIASPLKLRGE
FT                   KNIDARVRELASRLHIEMFLDRLPAELSGGQQQRVALARALAKGAPLMLLDEPLVNLDY
FT                   KLREELREELTQLFAAGQSTVVYATTEPGEALLLGGYTAVMHEGRLLQYGPTAEVFHAP
FT                   NSLSVARAFSDPPMNLMTATRQDGGVRLSDGTVLPLPLPPTTSASLTVGVRASALRVQA
FT                   RPGDVEVQGVVELAEISGSDTFVHVDTPWGELVAQLTGVHYFELGAQVRLHLNPAQAYV
FT                   FGADEALVLAPQRAGGR"
FT   gene            398248..399321
FT                   /locus_tag="Ajs_0385"
FT   CDS_pept        398248..399321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0385"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_0479 ABC transporter related; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40637"
FT                   /db_xref="GOA:A1W312"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W312"
FT                   /protein_id="ABM40637.1"
FT                   /translation="MAHIQLDLAHSYRPNPQQDSDYALLPLKMDFEDGGAYALLGPSGC
FT                   GKTTMLNIMSGLLVPSHGKVLFDGRDVTRATPQNRNIAQVFQFPVIYDTMTVAENLAFP
FT                   LKNRKVPEAQIKQRVGQIAEMLEMSHQLDMRAAGLSADQKQKISLGRGLVREDVAAVLF
FT                   DEPLTVIDPHLKWQLRRKLKQIHHELKLTLIYVTHDQVEALTFADKVVVMSRGRVMQLG
FT                   TPDALFEKPAHTFVGHFIGSPGMNFLPAVVDGATLQVAGQRMALPARSLPAGALQVGVR
FT                   PEYLALSAPQAAGALQCRVAQVQDIGTYQMLTAQVGDHTIKARVAPEVALPAVGDSIWL
FT                   QVLGEHTCFYQNEELLA"
FT   gene            399470..400366
FT                   /locus_tag="Ajs_0386"
FT   CDS_pept        399470..400366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0386"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rfr:Rfer_3674
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40638"
FT                   /db_xref="GOA:A1W313"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1W313"
FT                   /protein_id="ABM40638.1"
FT                   /translation="MSVTTKPVNQKAWFLILPVIICVAFSAILPLMTVVNYSVQDIISP
FT                   ERRVFVGTEWFVQIMRDEELHAALLRQITFSLAVLAVEIPLGILLALSMPAQGWKSSAV
FT                   LVVVALSLLIPWNVVGTIWQIYGRADIGLMGRMLQEMGIEYSYTGNATQAWLTVLLMDV
FT                   WHWTPLVALLAFAGLRSIPDAYYQAARIDGASKFAVFRYIQLPKMRGVLMIAVLLRFMD
FT                   SFMIYTEPFVLTGGGPGNATTFLSQYLTTKAVGQFDLGPAAAFSLIYFLIILLLCFILY
FT                   NWMQRVGTTPKEGAGHE"
FT   sig_peptide     399470..399550
FT                   /locus_tag="Ajs_0386"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.761) with cleavage site probability 0.577 at
FT                   residue 27"
FT   gene            400359..401171
FT                   /locus_tag="Ajs_0387"
FT   CDS_pept        400359..401171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0387"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pol:Bpro_0481
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40639"
FT                   /db_xref="GOA:A1W314"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1W314"
FT                   /protein_id="ABM40639.1"
FT                   /translation="MNEPRFQKRTLFLIAYLVFAVLPIYWMVNMSFKTNEEILSSFSLW
FT                   PQHFTWANYQTIFTDESWYSGYINSLIYVAINTVISLSVALPAAYAFSRYQFLGDKHVF
FT                   FWLLTNRMTPPAVFLLPFFQLYTTVGLMDTHIAVALAHLLFNVPLAVWILEGFMSGIPR
FT                   EIDETAYIDGYSFPRFFLTIFLPLIKAGVGVAAFFCFMFSWVELLLARTLTSVNAKPIV
FT                   ATMTRTVSASGMDWATLAAAGVLTIVPGAIVIWFVRHYIAKGFAMGRV"
FT   gene            401184..401492
FT                   /locus_tag="Ajs_0388"
FT   CDS_pept        401184..401492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0388"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: rfr:Rfer_3672 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40640"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:A1W315"
FT                   /protein_id="ABM40640.1"
FT                   /translation="MFDWMAWTTPVAVFFTCIVLMLIGMTVWEIQSPTVERKGFLPMTT
FT                   TRGDRLFIGLLTAAYINLAWVGLGEKMAQWFSLEAEPSVWISFVLSMLVLALVLRKG"
FT   gene            401667..403400
FT                   /locus_tag="Ajs_0389"
FT   CDS_pept        401667..403400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0389"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: pol:Bpro_0483 twin-arginine translocation pathway
FT                   signal; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40641"
FT                   /db_xref="GOA:A1W316"
FT                   /db_xref="InterPro:IPR014597"
FT                   /db_xref="UniProtKB/TrEMBL:A1W316"
FT                   /protein_id="ABM40641.1"
FT                   /translation="MKMQFKAIAFAAAALALGQAAWAGEAEAKKWIDSEFQPSTLSKDQ
FT                   QMAEMKWFIDAAKKLQAKGVKEIAVVSETITTHEYESKTLAKAFSEITGIQVKHDLIQE
FT                   GDVVEKLQTSMQSGKSIYDGWISDSDLIGTHYRYGKILNLSDYMAGPGKDYTNPGLDLQ
FT                   DFIGTKFTTAPDGKLYQLPDQQFANLYWFRADLFDRKDLKDKFKAKYGYDLGVPLNWSA
FT                   YEDIAEFFTNDVKNIDGKPIYGHMDYGKKDPSLGWRFTDAWLSMAGSADIGTPNGLPID
FT                   EWGIRVADDKCTPVGASVARGGATNSPAAVYALTKYVDWMKKYAPKEAMGMTFGEAGPV
FT                   PAQGQIAQQIFWYTAFTADMTKPGLPVVNADGTPKWRMAPGPNGPYWKQGMQNGYQDVG
FT                   SWTFFKDHNPDRLAAAWLYAQFVTAKTTSLKKTVVGLTPIRESDIRSKAMTDMAPKLGG
FT                   LVEFYRSPARVAWSPTGTNVPDYPKLAQLWWKNVAQAVTGEKTPQAAMDTLADEMDQVM
FT                   ARLQRAGMERCAPKLNAKGDPAKWLSDQHAPWKKLANEKPKGETINYNTLLQAWKDGKV
FT                   R"
FT   sig_peptide     401667..401738
FT                   /locus_tag="Ajs_0389"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            403503..405101
FT                   /locus_tag="Ajs_0390"
FT   CDS_pept        403503..405101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0390"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pol:Bpro_0484 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40642"
FT                   /db_xref="GOA:A1W317"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A1W317"
FT                   /protein_id="ABM40642.1"
FT                   /translation="MTSDTSTPLATVRADLLARLAQPVTYDLAVVGGGATGLGVALDAA
FT                   ARGFSVVLLESHDFAKGTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLRNAPHLA
FT                   QPLAFVMPSYKVWETPFYGVGLKMYDALAGKAGLGPTEFLGRMETLRCLPTAMADGLKG
FT                   GVKYWDGQFDDARLALALARTAAQRGALLLNYCPVDDLLYDGGKVAGVVCQDAETGRRY
FT                   EVRARCVVNATGVWVDALRQRDGDVSGQPVKPMVAPSQGVHIVVDREFLPSDHALMVPK
FT                   TADGRVLFAVPWLGKVILGTTDSPRQDLAREPQAMREEVAFILGESARYLRRAPQASDV
FT                   RSIWVGLRPLVKPSDEDAAATKSISREHTVLASRSGLVTVTGGKWTTYRAMAEDVLLKC
FT                   MDEHLLPRRPGGITVALPLVGAGATRERQGMNAPQGLHSYGDEAARVQALPGSQVQLAE
FT                   GLSEAMVRFAARHEYARTVEDVLARRSRVLFLDARLAAALAPRVADILREEIPGQDPQL
FT                   PAFLELAAHYATVPA"
FT   gene            405293..405661
FT                   /locus_tag="Ajs_0391"
FT   CDS_pept        405293..405661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0391"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: pol:Bpro_0485 ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40643"
FT                   /db_xref="GOA:A1W318"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W318"
FT                   /protein_id="ABM40643.1"
FT                   /translation="MIQTESRLDVADNTGAKSVLCIKVLGGSKRRYASVGDIIKVSVKE
FT                   AAPRGRVKKGEVYSAVVVRTAKGIRRGDGSLVKFDGNAAVLLNSKLEPIGTRIFGPVTR
FT                   ELRTERFMKIVSLAPEVL"
FT   gene            405672..405992
FT                   /locus_tag="Ajs_0392"
FT   CDS_pept        405672..405992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0392"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="KEGG: pol:Bpro_0486 ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40644"
FT                   /db_xref="GOA:A1W319"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W319"
FT                   /protein_id="ABM40644.1"
FT                   /translation="MNKIRKGDEVIVLTGRDKGKRGTVSLRKDDSHLVIEGINLVKKHV
FT                   KPNPMKGTTGGIVEKAMPIHQSNVAIFNAATGKADRVGIKVQADGTRVRVFKSSGAEIK
FT                   AA"
FT   gene            406002..406541
FT                   /locus_tag="Ajs_0393"
FT   CDS_pept        406002..406541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0393"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: pol:Bpro_0487
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40645"
FT                   /db_xref="GOA:A1W320"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W320"
FT                   /protein_id="ABM40645.1"
FT                   /translation="MARLQEIYRDKIAPELVKQFGYTSPMQVPRLTKITLNMGVSEAVA
FT                   DKKIMDNAVADLTKIAGQKPVVTKAKKAIAGFKIREGQAIGCMVTLRGAQMYEFLDRFV
FT                   TIALPRVRDFRGISGRAFDGRGNYNIGVKEQIIFPEIEYDKVDALRGLNISITTTAKTD
FT                   EEAKALLTAFRFPFKN"
FT   gene            406551..406856
FT                   /locus_tag="Ajs_0394"
FT   CDS_pept        406551..406856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0394"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: pol:Bpro_0488
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40646"
FT                   /db_xref="GOA:A1W321"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W321"
FT                   /protein_id="ABM40646.1"
FT                   /translation="MAKVALIQRELKREKLAAKYAAKYAELKAIAGDAKRSDEEREAAR
FT                   LGLQKLPRNANPTRQRNRCEITGRPRGTFRQFGLGRAKIRELAFAGDIPGVTKASW"
FT   gene            406877..407272
FT                   /locus_tag="Ajs_0395"
FT   CDS_pept        406877..407272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0395"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: pol:Bpro_0489
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40647"
FT                   /db_xref="GOA:A1W322"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W322"
FT                   /protein_id="ABM40647.1"
FT                   /translation="MSMSDPIADLLTRIRNAQMVSKATVSVPSSKVKVAIAQVLKDEGY
FT                   IDGFEVKSESGKTELEITLKYYAGRPVIERIERVSRPGLRVYKGCGSIPQVMNGLGVAI
FT                   VTTPKGVMTDRKARATGVGGEVLCYVA"
FT   gene            407297..407830
FT                   /locus_tag="Ajs_0396"
FT   CDS_pept        407297..407830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0396"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: rfr:Rfer_4228
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40648"
FT                   /db_xref="GOA:A1W323"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W323"
FT                   /protein_id="ABM40648.1"
FT                   /translation="MSRVGKSPVSIPAGVDVSIKDDQISVKGAGGVLSLAQNALVKVSN
FT                   NEGKLSFEPVNDSREANAMSGTVRQLVNNMVVGVSKGFEKKLTLIGVGFKAAASGNKLN
FT                   LAIGFSHPVNFEMPTGITVATPTPTEIVIKGADRQVVGQLAAEIRAVRPPEPYKGKGIR
FT                   YADEKVTIKETKKK"
FT   gene            407842..408207
FT                   /locus_tag="Ajs_0397"
FT   CDS_pept        407842..408207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0397"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="PFAM: ribosomal protein L18P/L5E; KEGG:
FT                   rfr:Rfer_4227 ribosomal protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40649"
FT                   /db_xref="GOA:A1W324"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W324"
FT                   /protein_id="ABM40649.1"
FT                   /translation="MLTKKEQRLRRARQTRIRIAQQGVARLTVNRTNLHIYASVISGDG
FT                   SKVLASASTAEADVRKSLGGSGKGGNAAAAQIIGKRIAEKAKAAGVEKVAFDRAGFAYH
FT                   GRVKALADAAREAGLQF"
FT   gene            408225..408746
FT                   /locus_tag="Ajs_0398"
FT   CDS_pept        408225..408746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0398"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like; KEGG:
FT                   pol:Bpro_0492 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40650"
FT                   /db_xref="GOA:A1W325"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W325"
FT                   /protein_id="ABM40650.1"
FT                   /translation="MAKFQPKVQSEGQDDGLREKMIAVNRVTKVVKGGRILGFAALTVV
FT                   GDGDGRVGMGKGKSKEVPAAVQKAMEEARRNMVKVSLKNGTIHHNVTGHHGAAVVMMAP
FT                   APKGTGIIAGGPMRAVFEVMGITDIVAKSHGSSNPYNMVRATFDALTNSTTPAEVAAKR
FT                   GKTVEDLFAA"
FT   gene            408761..408943
FT                   /locus_tag="Ajs_0399"
FT   CDS_pept        408761..408943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0399"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30; KEGG: rfr:Rfer_4225
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40651"
FT                   /db_xref="GOA:A1W326"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W326"
FT                   /protein_id="ABM40651.1"
FT                   /translation="MTTQQTIKIQLVRSPIGTKESHRATVRGLGLRKLNSINELKDTPE
FT                   VRGMINKISYLVKVL"
FT   gene            408954..409385
FT                   /locus_tag="Ajs_0400"
FT   CDS_pept        408954..409385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0400"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15; KEGG: pol:Bpro_0494
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40652"
FT                   /db_xref="GOA:A1W327"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W327"
FT                   /protein_id="ABM40652.1"
FT                   /translation="MELNSIKPADGAKHAARRVGRGIGSGLGKTAGRGHKGQKSRSGGY
FT                   HKVGFEGGQMPLQRRLPKRGFKSHLLKFNAEISLTALENLGLAEVDVLALKNAGLVGEL
FT                   AKVVKVIKSGEISKAVKLSGITATAGAKAAIEAAGGSLA"
FT   gene            409409..410728
FT                   /locus_tag="Ajs_0401"
FT   CDS_pept        409409..410728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0401"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: pol:Bpro_0495 SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40653"
FT                   /db_xref="GOA:A1W328"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A1W328"
FT                   /protein_id="ABM40653.1"
FT                   /translation="MATNAAQLAKTGKFGDLRRRLVFLLLALVVYRIGAHIPVPGIDPA
FT                   QLQQLFSGQQGGILNLFNMFSGGALSRFTVFALGIMPYISASIIMQLMTYVVPTFEQLK
FT                   KEGEAGRRKITQYTRYGTLGLAIFQSLGIAVALESSAGLVLSPGFGFRLTAVVSLTAGT
FT                   MFLMWLGEQITERGLGNGISILIFAGIAAGLPSSIGGLLELVRTGAMSILAAIFIVIVV
FT                   GLVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVIPPIFASSIILL
FT                   PATIVNWFSAGESMRWLRDISAALTPGQPVYVMFYAAAIIFFCFFYTALVFNSRETADN
FT                   LKKSGAFIPGIRPGEHTARYIDKILVRLTLAGAVYITFVCLLPEFLILKYNVPFYFGGT
FT                   SLLIIVVVTMDFMAQVQNYMMSQQYESLLKKANFKTTLGT"
FT   gene            410873..410986
FT                   /locus_tag="Ajs_0402"
FT   CDS_pept        410873..410986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0402"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: ribosomal protein L36; KEGG: pol:Bpro_0497
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40654"
FT                   /db_xref="GOA:A1W329"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W329"
FT                   /protein_id="ABM40654.1"
FT                   /translation="MRVSASVKKICRNCKIIRRKGVVRVICTDQRHKQRQG"
FT   gene            411010..411375
FT                   /locus_tag="Ajs_0403"
FT   CDS_pept        411010..411375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0403"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13; KEGG: pol:Bpro_0498
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40655"
FT                   /db_xref="GOA:A1W330"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W330"
FT                   /protein_id="ABM40655.1"
FT                   /translation="MARIAGINIPPHQHTEIGLTAIYGIGRTRARKICEACGIAYSKKV
FT                   KELTDADLEKIRDQIAQFTIEGDLRRETTMNIKRLMDIGCYRGFRHRRGLPMRGQRTRT
FT                   NARTRKGPRKGAAALKK"
FT   gene            411393..411797
FT                   /locus_tag="Ajs_0404"
FT   CDS_pept        411393..411797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0404"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: pol:Bpro_0499
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40656"
FT                   /db_xref="GOA:A1W331"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W331"
FT                   /protein_id="ABM40656.1"
FT                   /translation="MAKSPANNAAQRVRKKVRKNISDGIAHVHASFNNTIITITDRQGN
FT                   ALSWASSGGQGFKGSRKSTPFAAQVASEVAGRAAIEQGIKNLDVEIKGPGPGRESSVRA
FT                   LGALGIRITSISDVTPVPHNGCRPQKRRRI"
FT   gene            411886..412509
FT                   /locus_tag="Ajs_0405"
FT   CDS_pept        411886..412509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0405"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: rfr:Rfer_4218 ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40657"
FT                   /db_xref="GOA:A1W332"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W332"
FT                   /protein_id="ABM40657.1"
FT                   /translation="MARYLGPKAKLSRREGTDLFLKSARRSIADKAKFDSKPGQHGRTS
FT                   GARTSDYGLQLREKQKVKRMYGVLEKQFRRYFEAAERLKGNTGANLLGLLECRLDNVVY
FT                   RMGFGSTRAEARQLVSHKAITVNGQSVNIASYLVKAGDVVAVRDKSKKQARIVEALQLA
FT                   QQVGMPVWVEVNADKVEGTFKKVPDRDEFGADINESLIVELYSR"
FT   gene            412621..413613
FT                   /locus_tag="Ajs_0406"
FT   CDS_pept        412621..413613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0406"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: pol:Bpro_0501 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase, alpha subunit domain
FT                   protein; RNA polymerase, dimerisation; RNA polymerase,
FT                   insert; SMART: RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40658"
FT                   /db_xref="GOA:A1W333"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W333"
FT                   /protein_id="ABM40658.1"
FT                   /translation="MQTNLLKPKAINVEQLGPNRAKVALEPFERGYGHTLGNAIRRVLL
FT                   SSMVGYAATEVTIAGVLHEYSSIDGVQEDVVNILLNLKGVVFKLHNRDEVTLSLRKDGE
FT                   GVVTARDIQTPHDVEIVNPEHVIATLSAGGKLDMQIKVEKGRGYVPGNLRRYADEATKS
FT                   IGRIVLDASFSPVKRVSYTVESARVEQRTDLDKLVVEIETNGAITAEDAVRASAKILVE
FT                   QLAVFAQLEGGELAAFDAPASSRGAATFDPILLRPVDELELTVRSANCLKAENIYYIGD
FT                   LIQRTENELLKTPNLGRKSLNEIKEVLASRGLTLGMKLENWPPAGLDKR"
FT   gene            413703..414092
FT                   /locus_tag="Ajs_0407"
FT   CDS_pept        413703..414092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0407"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17; KEGG: rfr:Rfer_4216
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40659"
FT                   /db_xref="GOA:A1W334"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W334"
FT                   /protein_id="ABM40659.1"
FT                   /translation="MRHGHGLRKLNRTSSHRLAMLQNMMNSLIEHEAIKTTLPKAKELR
FT                   RVIEPMITLAKEDSVANRRLAFNRLRDRDSVTKLFNDLGPRFKTRPGGYTRILKMGFRV
FT                   GDNAPMAYVELVDRAETPEVSSTEA"
FT   gene            414117..414193
FT                   /locus_tag="Ajs_R0002"
FT                   /note="tRNA-Met1"
FT   tRNA            414117..414193
FT                   /locus_tag="Ajs_R0002"
FT                   /product="tRNA-Met"
FT   gene            complement(414342..415682)
FT                   /locus_tag="Ajs_0408"
FT   CDS_pept        complement(414342..415682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0408"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   xcb:XC_2733 UDP-glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40660"
FT                   /db_xref="GOA:A1W335"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W335"
FT                   /protein_id="ABM40660.1"
FT                   /translation="MKVTVFGTGYVGLVQGAVLADVGHDVICVDVDAAKVAALQAGHIP
FT                   IHEPGLEPLVKANQAAGRLRFTTDAAQGVAHGELIFLAVGTPPDEDGSADLQHVLAVAR
FT                   TIATHMTEPKTIVNKSTVPVGTADKVADTVRKVLETRGVALAFEVVSNPEFLKEGAAVA
FT                   DCKRPDRIVIGTRAPQAERQLRELYAPFNRNHDRIVMMDVRSAELTKYAANAMLATKIS
FT                   FINEMANLAEQLGADIEDVRRGLGSDPRIGYHFIYPGVGYGGSCFPKDVKALIHTAQSI
FT                   GFTPDLLLAVESRNDAQRQLLARRIIAHYGGSLRGKTIAVWGLAFKPETDDMREAPSRY
FT                   LLQSLWAAGAQVRAHDPAAMDEARRIFGERDDLVLCGSPTEALEGADALAIVTEWKIFR
FT                   VPDFAQMAHALHDRMVFDGRNLYDPETITRFGLGYVSIGRAPVVGMS"
FT   gene            complement(415679..416689)
FT                   /locus_tag="Ajs_0409"
FT   CDS_pept        complement(415679..416689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0409"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: eba:ebA1639 predicted
FT                   nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40661"
FT                   /db_xref="GOA:A1W336"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W336"
FT                   /protein_id="ABM40661.1"
FT                   /translation="MSVTLVTGCAGFIGMHCVQRLLERGERVVGIDNLNAYYDVGLKHA
FT                   RLDRLHCQSDFTFEQIDVADRDAMHALFARVRPHRVLHLAAQAGVRYSIDQPDDYTDSN
FT                   LLGFGNILQGCRAQQVEHLVFASSSSVYGGNAKLPFSERDAVDHPVSYYAATKKANEVM
FT                   AHAYAHLYGIPTTGLRFFTVYGPWGRPDMALFKFTRAMLAGETIDVYGEGQLVRDFTYI
FT                   DDIVEGVLRVLDKPATPDAAFDPLSPSPGTGLAPYRIFNIGNSAPTLLMDYIQALEEAL
FT                   GMVALKRMRPLQPGDMHSTAADMSALASWVGFAPHTPVRDGVARFVHWYKDFYPS"
FT   gene            complement(416686..418203)
FT                   /locus_tag="Ajs_0410"
FT   CDS_pept        complement(416686..418203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0410"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase and
FT                   related glycosyltransferases of PMT family-like protein"
FT                   /note="KEGG: sme:SMc02383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40662"
FT                   /db_xref="GOA:A1W337"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A1W337"
FT                   /protein_id="ABM40662.1"
FT                   /translation="MTASTAPRALSSRLPWTHPLFWFAAISLAHVAMRLLASPALKWDE
FT                   AEQILWTQELALGYGPQPPLYTWLQWAMNQVFGPSVLALSLLKHGLLALTYSLMYLAGR
FT                   ELLDERGAFWASASMVLMPALGWYSVRDQTHTILVTAMACGAWWLLLRIVRRPRPLDFA
FT                   LLGLVCGFGMLAKYSFALVAGAMLLAALSVPEARRALLSRGWWWAPLVGLLVVLPHVAW
FT                   LLSHLTEATSGTISKMNIQPENGLVKGLLRLLEGVVPSTLLLWALFALWAFRSAWWQRP
FT                   LAPVSPPMHRVFVRYLGLVLLALAGMVVFAGVSNFKGRWILPLLCMAPLAAFSARPELQ
FT                   HHPRARRYTIAVATMAVILLVAAGIRPWFSGLRGEVDELNHPSIELADALRAAGYDGTS
FT                   PIVASDHMLAGMLRVRFPDALVDACAPGEDEIPTCVADHLRRSVQRGQGLLLISRTDYV
FT                   PSSWWDQAQARIAPRALQSIHLPFHMVRAGTPLAHYEYIWSPRGTQP"
FT   gene            418307..419338
FT                   /locus_tag="Ajs_0411"
FT   CDS_pept        418307..419338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0411"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   ana:alr3380 dolichol-phosphate mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40663"
FT                   /db_xref="GOA:A1W338"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1W338"
FT                   /protein_id="ABM40663.1"
FT                   /translation="MNTAPTPTPDVSIVVPIYNEVENLPDLVERIAQAMSAQPLSFELL
FT                   AVDDGSRDGSADTLRELAATRPWLRPVFLARNYGQSSALQAGFDRVRGRYVVTLDADLQ
FT                   NEPGDIPLLLERLETDSSVDMVSGWRKDRQDAELSRKLPSRIANRLISSATGVHLHDYG
FT                   CALKAYRRPIIDRIRLYGEQHRFIPSLAKEAGARITEVPVRHHARTRGVSKYGIDRTFR
FT                   VILDLILIVFFMRYRQRPLHAFGGLGLWLAAPGVLILAWLLLQKVLGEDIGGRPLLLAG
FT                   VMLVLMGVQMVVAGLIGELLMRIYHKAGGAPQFHAQEYVPDSRVNMPAARDQQAQAATN
FT                   KIA"
FT   gene            419335..420264
FT                   /locus_tag="Ajs_0412"
FT   CDS_pept        419335..420264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll0941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40664"
FT                   /db_xref="GOA:A1W339"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A1W339"
FT                   /protein_id="ABM40664.1"
FT                   /translation="MKRPFKALLRGLVGLALLGAVVALADPSRVWGQLRQAQPVWLLAG
FT                   LLAGIASNLVSALRWRALARWLGADASARDACRWYFQAIGLNALLPGAVVGGDVYRAVV
FT                   LRGSGQDTAASSWSVVLDRLSGLWMLCAIGGLGAAACADVLAPWLRLPRGLFIALMLGG
FT                   TLLWLALPWCLPALLRSRRFAGGWLAPLREAATRPDFPRQLVWQAGASAAVQLLSAAAL
FT                   AGGGLALGVALPASVWAWAIAPVFLMAALPVSVGGWGTREAAAVAALAPFGVAASAAVG
FT                   VGVVYGVYGLAQGALGALAFGLPRSAGR"
FT   sig_peptide     419335..419412
FT                   /locus_tag="Ajs_0412"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(420503..421441)
FT                   /locus_tag="Ajs_0413"
FT   CDS_pept        complement(420503..421441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0413"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: rfr:Rfer_3872
FT                   protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40665"
FT                   /db_xref="GOA:A1W340"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1W340"
FT                   /protein_id="ABM40665.1"
FT                   /translation="MSASFASALSAARDAAAAQHYPHGALYVVATPIGNLADITLRALH
FT                   VLQLADTLACEDTRHTQSLLRAYGIDKPSDRLLALHQHNEAQAAQMVVQQLQAGQRVAY
FT                   VSDAGTPGVSDPGARLVAAVQAAGLRCIPLPGASSVTSALSVAGAVAPTADSGGFLFAG
FT                   FLPPKGAERTAAVQRLAAEPRCVVLLEAPHRIAALADTLADLGERPVTLARELTKQFEE
FT                   VSTHPARELAAWLAGAPQRVKGEFVVLLHPLAATQGDGAEVERVLRLLLDELPTKTAVK
FT                   LAADIAHASRNTLYERALQIKRDAEAAGEHG"
FT   sig_peptide     complement(421388..421441)
FT                   /locus_tag="Ajs_0413"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.669) with cleavage site probability 0.450 at
FT                   residue 18"
FT   gene            421441..421839
FT                   /locus_tag="Ajs_0414"
FT   CDS_pept        421441..421839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0414"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   rfr:Rfer_3873 protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40666"
FT                   /db_xref="GOA:A1W341"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W341"
FT                   /protein_id="ABM40666.1"
FT                   /translation="MGFLGKKVNGSAPARTTRAAGQAGEDRALAHLTAAGLALVERNYR
FT                   TPGRGGGEIDLILRERDGTLVFVEVRSRGASAYGGAGGSIGVAKQRRIVFAAQHYLLRW
FT                   PAPPPCRFDAVLIEGDRLQWLRGAFDAA"
FT   gene            421898..422491
FT                   /locus_tag="Ajs_0415"
FT   CDS_pept        421898..422491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0415"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="KEGG: pol:Bpro_0392 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40667"
FT                   /db_xref="GOA:A1W342"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:A1W342"
FT                   /protein_id="ABM40667.1"
FT                   /translation="MLEQRIQQHFIDSADLKYQSAQALSHPISAAVQAIWACVTNGAKV
FT                   LACGSGPSSAQALQFAAFCVAGFERDRPELAALALLPDALATGTSAVADSAVLARQVRA
FT                   LGQAGDLLLVITIGGNEPALLQAVQAAHERDMTVVALCGRDGGALGALLHETDVQICVP
FT                   HDRAARVREVHALVLHCLCDGVDAQLLGEQEIPL"
FT   gene            422488..423162
FT                   /locus_tag="Ajs_0416"
FT   CDS_pept        422488..423162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0416"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region, bacteria; KEGG:
FT                   rfr:Rfer_3875 transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40668"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A1W343"
FT                   /protein_id="ABM40668.1"
FT                   /translation="MTFPLLRISSAALAAAALAGSLAGCAPLVIGGGAVVGTLMATDRR
FT                   TTGTQVEDEGIEMRTASRIRETLGDRVHVNVTSYNRQVLLTGEVPTAADGQKVEQIAQG
FT                   VDNVRSVVNDLGVMPASSLTQRSRDTFISTKVRASLVDAKDLSANAFKVVTERDVVYLM
FT                   GRVTQREAKRSAEIARGVDGVRKVVRVFEVVSEEELIRGGAAQQPAPVSQDPAAAAQPV
FT                   KP"
FT   sig_peptide     422488..422562
FT                   /locus_tag="Ajs_0416"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.332 at
FT                   residue 25"
FT   gene            complement(423260..424189)
FT                   /locus_tag="Ajs_0417"
FT   CDS_pept        complement(423260..424189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0417"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding; KEGG:
FT                   rfr:Rfer_3876 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40669"
FT                   /db_xref="GOA:A1W344"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W344"
FT                   /protein_id="ABM40669.1"
FT                   /translation="MSSSINPRTYDPVPARRVAFLGLGVMGYPMAGHLASAGHTVTVYN
FT                   RTATKSEAWCAEFKGVATVKHAKTPREAAQGADIVFCCVGNDDDLRSVVLGADGAFAGM
FT                   QQGAVFVDHTTASAAVARELYGAARTLGLQFIDAPVSGGQAGAQNGQLTVMCGGDAAAF
FT                   DAVRPTAMAFSRAFTRIGDSGAGQLAKMVNQICIAGLVQGLSEAIAFGQHAGLDMPLVL
FT                   DVIGKGAAQSWQMDNRGKTMVEGRFDFGFAVDWMRKDLGLVLDEAKRNGARLPVTALVD
FT                   QFYADVQLAGGNRWDTSSLITRLAPKKD"
FT   gene            complement(424254..425390)
FT                   /locus_tag="Ajs_0418"
FT   CDS_pept        complement(424254..425390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0418"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: pol:Bpro_0395 twitching
FT                   motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40670"
FT                   /db_xref="GOA:A1W345"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W345"
FT                   /protein_id="ABM40670.1"
FT                   /translation="MERDQASKFINDLLKLMVSRGGSDLFITAEFPPAIKVDGKVTKVS
FT                   PQPLTPNHTLTLARAIMSDKQVADFERTKECNFAISPAGVGRFRVNAFVQQGRVGMVLR
FT                   TIPLTLPTIDGLGVPQVLKEVTMTKRGLCILVGATGSGKSTTLAAMLDWRNENSFGHII
FT                   TVEDPVEFVHPHKNCVITQREVGLDTDSWEAALKNTLRQAPDVILMGEIRDRETMEHAV
FT                   AFAETGHLCLATLHANSANQALDRIINFFPEERRAQLLMDLSLNLKALVSQRLIPKQDG
FT                   KGRAAAVEVMLNTPLIADLIFKGEVAEIKEIMKKSRNLGMQTFDQALFDLFEANVISYE
FT                   DALRNADSVNDLRLQIKLSSQRAKTTDLASGTEHFAIV"
FT   gene            complement(425437..426066)
FT                   /locus_tag="Ajs_0419"
FT   CDS_pept        complement(425437..426066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0419"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG:
FT                   psp:PSPPH_1557 cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40671"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A1W346"
FT                   /protein_id="ABM40671.1"
FT                   /translation="MKGILGLLKSKNRKSGEESTDSVFFTTAFAGQGVEQSQLVPWEAR
FT                   AVEVDAKRLPQSRGGRLLQSLWSKHKYMAHLDHDAVERMERFFEFASVAPNRDLIRQDE
FT                   YGNFMVVLLTGTIAVDRVQPWGEQLRLAETRPGDILGEMSLLDSGIRFSACTTLTECEI
FT                   AVLSAEALDEMMAHDPQLAASLVALLARKLSQRLRVVSARLSENQR"
FT   gene            complement(426143..427186)
FT                   /locus_tag="Ajs_0420"
FT   CDS_pept        complement(426143..427186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0420"
FT                   /product="pilus retraction ATPase PilT"
FT                   /note="KEGG: pol:Bpro_0396 twitching motility protein;
FT                   TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40672"
FT                   /db_xref="GOA:A1W347"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W347"
FT                   /protein_id="ABM40672.1"
FT                   /translation="MDITQLLAFSVKNKASDLHLSAGLPPMIRVHGDVRRINVDALDHK
FT                   TVHAMVYDIMSDAQRKTYEEFLEVDFSFEIDGLARFRVNAFNQNRGAAAVFRTIPSKIL
FT                   TLEQLNAPKIFADLALKPRGLVLVTGPTGSGKSTTLAAMVNYLNESEYGHILTVEDPIE
FT                   FVHESKKCLINQREVGPMTLSFAAALKSALREDPDAILVGEMRDLETIRLAMTAAETGH
FT                   LVFGTLHTSSAAKTIDRIIDVFPAEEKEMVRAMLSESLQAVISQTLCKTKDGSGRVAAH
FT                   EIMLGTSAIRNLIREAKVAQMYSTIQTSNSVGMQTLDQNLSDLVRRNIISPAEARSKAK
FT                   IPENFPG"
FT   gene            427226..427942
FT                   /locus_tag="Ajs_0421"
FT   CDS_pept        427226..427942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0421"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   pol:Bpro_0397 protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40673"
FT                   /db_xref="GOA:A1W348"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A1W348"
FT                   /protein_id="ABM40673.1"
FT                   /translation="MTTIASNLQNVRERIARACTAAGRPPDAVALLAVSKTFGPEAVRD
FT                   AALAGQRRFGENYIQEAVEKMALVAALGLPQPLEWHCIGPVQSNKTRLVAQHFDWVHTV
FT                   DRPKTAQRLSDQRPDNLPALQVCIQVNVDGGATKAGVPAEEALALAQAVAALPRLTLRG
FT                   VMSIPDPVPDEAAQLAVLLRVRQVFDTLRAQGGPGFEAVDTLSLGMTGDLEAAVRAGST
FT                   MVRVGSGIFGARHYPA"
FT   gene            427981..429117
FT                   /locus_tag="Ajs_0422"
FT   CDS_pept        427981..429117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0422"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; aminotransferase
FT                   class-III; KEGG: rfr:Rfer_3691 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40674"
FT                   /db_xref="GOA:A1W349"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A1W349"
FT                   /protein_id="ABM40674.1"
FT                   /translation="MSGLLPDVDPDGLLEFSVVYTDRALNHMSRRFVGVMQDILATLKE
FT                   VYRAHTAVLVPGSGTFGMEAVARQFANREKVLIVRNGWFSYRWSQIFDAGGLGDGAAVC
FT                   QARRQGDGPQAPWAPCPASEVAAAIRAERPKVVFAPHVETASGILLPDDYLRTVSDAAH
FT                   EVGALFVLDCVASGAMWVDMEKTGVDVLISAPQKGWSGSPCCAMVMLSARAREAIEQTQ
FT                   SSSFSCDLKKWMQIAEGYEKGQHAYHTTMPTDALVRLRDVMLETRDYGFAKVRDEQIAL
FT                   GAKVRALLQARGFPSVAAAGYEAPGVVVSYTTDPGIQSGKKFAEAGLQTASGVPLQCGE
FT                   GADFQTFRLGLFGLEKWHNVDRTVGHLAAALDQVAPAR"
FT   gene            429185..430543
FT                   /locus_tag="Ajs_0423"
FT   CDS_pept        429185..430543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0423"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   bxe:Bxe_B1234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40675"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:A1W350"
FT                   /protein_id="ABM40675.1"
FT                   /translation="MLSRMHASPLEPGAQAAASAEPAALAGRASQLSRAKRQATGLLLA
FT                   VVVVFALTYFFPPSLGVACVRAVAEAAMVGALADWFAVSALFRRIPLPLVQRHTDIIAR
FT                   NKDRIGGNLAVFVRDKFLDAPSLVTMIRRHDPANMLAQWLTAPANARLLGRQVARLALT
FT                   ALDTVEDAKIQAFLSQAARTLVGKIDLSRSMASALGALTYQGRHQALLDDLLERLGGMV
FT                   RSEDTRAFVADTLLQWIKREHPLKQKVLPTDWLSGKGASAITHAVDTLLKAVAEDPQHE
FT                   LREALDGAVQRLIARLQTDPDWARRGDEVRGYLQNDEVLGRYVRDLWSDLRQKLRDDLM
FT                   NEDSALSARVADMGQWLGLSLAGDAALRVRLNVRLELWAATFAPDVAQSVAEHIRATVQ
FT                   RWDAQEMARLVELHIGSDLQYIRINGTVVGGCIGLLLFAVSHAGALWAAVAGP"
FT   gene            complement(430603..431091)
FT                   /locus_tag="Ajs_0424"
FT   CDS_pept        complement(430603..431091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB3068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40676"
FT                   /db_xref="UniProtKB/TrEMBL:A1W351"
FT                   /protein_id="ABM40676.1"
FT                   /translation="MALLPLTRRCAMPVLSPLPFRLPRRLAPLGLCALLTSGASAVQAQ
FT                   ADSAPRPAVLPPVQTAGALHYQCGGIGTDESTAMRAAMKDYPLSLLFARADGAYEANVD
FT                   VRITPQGGGDAMQLRAGGPVCLLQLPAGSYRVEVQGAGQNHSRTVQVGRAPQTLDFRF"
FT   sig_peptide     complement(430951..431091)
FT                   /locus_tag="Ajs_0424"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.541 at
FT                   residue 47"
FT   gene            complement(431151..432635)
FT                   /locus_tag="Ajs_0425"
FT   CDS_pept        complement(431151..432635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0425"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   pol:Bpro_0433 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40677"
FT                   /db_xref="GOA:A1W352"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1W352"
FT                   /protein_id="ABM40677.1"
FT                   /translation="MPNAELPHRAQRQSEVVQALSACVPQHALLWQAEDTTPYECDGLT
FT                   AYRERPLVVCLPETEEQVQAVLQTCHRLGVPVVARGAGTGLSGGAMPHALGVTLSLAKF
FT                   NRILQVDPVARTARVQCGVRNLAISEAAAPYNLYYAPDPSSQIACTIGGNVAENSGGVH
FT                   CLKYGLTVHNVLRVRGYTMEGEPITFGAEALDAPGYDLLAAVIGSEGMLAVALEVTVKL
FT                   VPKPQLARCIMASFDDVRKAGDAVAAVIAAGIIPAGLEMMDKPMTAAVEDFVKAGYDLT
FT                   AEAILLCESDGTPEEVEEEIARMSEVLRGSGATAISVSTSEEERMRFWSGRKNAFPASG
FT                   RISPDYMCMDSTIPRKRLADILLAIQEMEKKYQLRCCNVFHAGDGNLHPLILFDANDPD
FT                   QLHRCELFGADILETSVAMGGTVTGEHGVGVEKLNSMCAQFTVEENAQMFALKEAFDPQ
FT                   GLLNPGKVIPTLNRCAEYGKMLVRNGKMSHANLPRF"
FT   gene            complement(432693..433382)
FT                   /locus_tag="Ajs_0426"
FT   CDS_pept        complement(432693..433382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0426"
FT                   /product="MT-A70 family protein"
FT                   /note="PFAM: MT-A70 family protein; KEGG: nmu:Nmul_A2608
FT                   MT-A70"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40678"
FT                   /db_xref="GOA:A1W353"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1W353"
FT                   /protein_id="ABM40678.1"
FT                   /translation="MSNADAIGDFRERTMGRKFSTVLADPPWQFQNRTGKMAPEHKRLN
FT                   RYGTMDLDAIKALPVAEVCADTAHLYLWVPNALLPDGIEVLRAWGFQYKSNLVWHKIRK
FT                   DGGSDGRGVGFYFRNVTELILFGVRGKNARTLAPGRSQVNLLATQKREHSRKPDELYPL
FT                   IEACSPGPFLEMFARGSRPGWTTWGNQADDYYPDWPTYSNHSQSDPGQAVTSTAAQPTL
FT                   FEFAKAV"
FT   gene            complement(433385..433972)
FT                   /locus_tag="Ajs_0427"
FT   CDS_pept        complement(433385..433972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_1080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40679"
FT                   /db_xref="GOA:A1W354"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011338"
FT                   /db_xref="InterPro:IPR015278"
FT                   /db_xref="UniProtKB/TrEMBL:A1W354"
FT                   /protein_id="ABM40679.1"
FT                   /translation="MTVDLLPDFIRTHYEVHESKHACAILKHDFPQEWDDIVHVLGNFR
FT                   LRRSWLTVGGGRKSKVSDAIDSGLYALGWKEKQFQTEILLDGQRQESPTHQIDCFKNRV
FT                   ALEIEWNNKDPFYDRDLNNFRLLFDLRAVSVGVIVTRCDHLQEIFDAIGRGPSFGASTT
FT                   HMSKLLPRIRGGGGGGCPILVLGISRSLYLED"
FT   gene            complement(434125..434973)
FT                   /locus_tag="Ajs_0428"
FT   CDS_pept        complement(434125..434973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0428"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: pol:Bpro_0438 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40680"
FT                   /db_xref="GOA:A1W355"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:A1W355"
FT                   /protein_id="ABM40680.1"
FT                   /translation="MTHSYILTLSCPDRLGLVHAVSGFLLDHGGNIEEAAQYNDQGTGL
FT                   FFMRVQFACESTDEATLKAELATFAEEHSMRWSLHATSAAMKTVLMVSKEGHCLNDLLF
FT                   RYKSGLLPIDIRAIISNHRDFYQLAASYNIPFHHIPVTAATKAQAEAKQYEIIQAEGAE
FT                   LVVLARYMQVLSNDLCTKLSGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVT
FT                   ADLDEGPIIEQDVTRADHTDTVEDLTARGRDTESQVLARAVKWHSEHRVLLNGHKTVVF
FT                   R"
FT   gene            435092..437343
FT                   /pseudo
FT                   /locus_tag="Ajs_0429"
FT   gene            complement(437371..438225)
FT                   /locus_tag="Ajs_0430"
FT   CDS_pept        complement(437371..438225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40681"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="UniProtKB/TrEMBL:A1W356"
FT                   /protein_id="ABM40681.1"
FT                   /translation="MPTLPLYRFLFATLALAFAAGCTTLLEQSAPTTAGNAAWDAQLER
FT                   WPPVDALLLGEQHDAAAHQQWQRHTVQWLAARQRLAALVLEMAPEGAGTDGLPPDADAA
FT                   QVRAALQWDEQAWPWDRYAPVVMAAVAAGVPVRGGNLPRSQMPQAMRDAALDTHLPPAA
FT                   LARQRTAIEEGHCGLVPAQRLMPMVRIQLARDARMARAVQAAHRPGRTVLLVAGFGHVQ
FT                   RSLGVPTWLPSDFTSKVAIAQAGQARPAIESEADYIHRTPALTPHDPCAELRERWPGPP
FT                   PAP"
FT   sig_peptide     complement(438142..438225)
FT                   /locus_tag="Ajs_0430"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.527 at
FT                   residue 28"
FT   gene            438515..440950
FT                   /locus_tag="Ajs_0431"
FT   CDS_pept        438515..440950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0431"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit, N
FT                   terminal domain protein; KEGG: bte:BTH_II1936
FT                   ribonucleotide reductase system"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40682"
FT                   /db_xref="GOA:A1W357"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="UniProtKB/TrEMBL:A1W357"
FT                   /protein_id="ABM40682.1"
FT                   /translation="MQREITDLAPALSTQPISMDVLKEKYFKDGESDVEDLFRRVARAL
FT                   ASVEREDMRQALEARFLDNLRAGAIGAGRIMSAAGTDIQATLINCFVQPVGDCIQGVDD
FT                   AGYPGIYEALREAAETMRRGGGVGYDFSRIRPRGALVKGTASMASGPCSYINVFDQSCS
FT                   TVESAGARRGAQMGVLRIDHPDVLDFITAKRTPGRWNNFNVSVGVPDAFMEAVEQDRDW
FT                   ELVHGAAPGAELQAQGAHQRADGQWVYRTVRARELWDTIMKSAYDFAEPGILFLDQINT
FT                   DNNLHYTETIQATNPCGEQPLPPYGCCDLGPIILTRFVRNPFGLHGEASFDFDAFEQAV
FT                   ATQVRALDNVLDVTFWPLPQQQAESAAKRRIGVGFTGMGNTLAMLCKRYDRQEGRDMAV
FT                   QIAERMRNAAYRASVELAKEKGAFPKFDADGYLAKGTFASRLPADIQKAIRKHGIRNSH
FT                   LLSIAPTGTVSLAFADNASNGIEPPFSWTYTRRKREADGSKSEYVVEDYAWRLYKTLGG
FT                   DVNHLPAYFVSAMDMAAADHVAMMEAVQPYVDTAISKTVNVPEDYPYDDFKGLYMQAWH
FT                   SGLKGLATYRPNSILGAVLEVPAAEAKPAKSEPAPEPVQPFDPMRVVIESRPKGGLSAV
FT                   AEKIEYWTQEGHKRLYLIVSFLPVPDGHGGTVDRAIEFFMPVGQSSESQQWITSSMRLL
FT                   SLAARGGFLERALSDMRKVAWDRGPVRLGTYQRADGAQVPLWHDSEVAAVAYAVQNILA
FT                   RRAEAPQQQVLPLDEPDMPAGMPPAMAGKKCQECGAHAVIRKDGCDYCTQCGALGSCG"
FT   gene            441129..443045
FT                   /locus_tag="Ajs_0432"
FT   CDS_pept        441129..443045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0432"
FT                   /product="signal transduction histidine kinase,
FT                   nitrate/nitrite-specific, NarQ"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: GAF domain protein; ATP-binding region, ATPase
FT                   domain protein domain protein; histidine kinase, HAMP
FT                   region domain protein; histidine kinase, dimerisation and
FT                   phosphoacceptor region; KEGG: pol:Bpro_4599 signal
FT                   transduction histidine kinase, nitrate/nitrite-specific,
FT                   NarQ"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40683"
FT                   /db_xref="GOA:A1W358"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1W358"
FT                   /protein_id="ABM40683.1"
FT                   /translation="MRKKPTLSTKLLAMGTVFLLVALASIGFTLWVTWKLEGGAAAVNE
FT                   AGRLRMNMLRMVLAQQNESPQEFARLETRFNEGLELLRTGDPARPLFVPWSDDTRERYE
FT                   HIRRQWLLIENDWKAAAHYESSAEAVARADAFVLDLDSFVEAIEIQIVRLTAVLHLFHL
FT                   FMVALAIGSAVAFMALSYLLVLNPVTRLQQALARLRKGDLGTRLEVEADDEFGQLTAGF
FT                   NLMAHALQTSHEDLERKVREKTATIEVRNQRLAALYAVSALAAEAGSLEELTQGFVQQI
FT                   RRVAECDAAAVRWSDEANERYVLLASDGLPQSLVEHEHCVVTGACECGQAQGQARMRVI
FT                   PIMPVGGLQLPHCREAGFETVVSIPVQMHQRLLGEVTLLYRSPLELSAEMRELLSTMAH
FT                   HLATSMESLRASALEREAAVAQERSLIARELHDSIAQSLAFLKIQTQLLRDAVAKDNTE
FT                   ARDRSMAELDTGVRECYADVRELLVHFRTRTQDEDIEAALRATLSKFEHQTGAATALSM
FT                   AGHGLPLAQDVQIQVLHILQEALSNVRKHADARRVELRVQRHPRWRFEVQDDGRGFDPD
FT                   SVPPDSLHVGLGIMRERAQRIGAHLELVSRPGGGGTCVVLELPPTTREEPALPFSLVSS
FT                   AAA"
FT   sig_peptide     441129..441212
FT                   /locus_tag="Ajs_0432"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.448 at
FT                   residue 28"
FT   gene            443042..443713
FT                   /locus_tag="Ajs_0433"
FT   CDS_pept        443042..443713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0433"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2; KEGG: rfr:Rfer_1869
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40684"
FT                   /db_xref="GOA:A1W359"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1W359"
FT                   /protein_id="ABM40684.1"
FT                   /translation="MNAPTTLFLIDDHTLLRRGLVALLSQQPDLRVVGEAGDAAEALRL
FT                   LPALRPDVILLDNHLPGVRGVDAIAGLREASQGSRVLMLTVSEDGQDLAAALRNGAQGY
FT                   LLKTIDGDLLAQAIRRAARGEPVVSPEMMGKLVAAFQSQGAPTPEPLPEEEEPASVLSP
FT                   REEDVLREIARGLSNKEIARALDIAETTVKIHVQHILRKLGLSSRVQAAVYASDRHRLT
FT                   E"
FT   gene            443860..445167
FT                   /locus_tag="Ajs_0434"
FT   CDS_pept        443860..445167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0434"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_4597 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40685"
FT                   /db_xref="GOA:A1W360"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1W360"
FT                   /protein_id="ABM40685.1"
FT                   /translation="MAQLPQRAAPSASTIGEDPRHTRKAWSVLIVSTLAFTVCFMVWMM
FT                   FGVIGIPIKKMLNLSSTQFGLLTAMPVLTGSLVRVPLGIWTDRYGGRIVMALLMAATVP
FT                   AIWMMGYATEYWHFLVIGLFVGLAGGSFSVGTPYVARWFPKHRQGMAMGVYGAGNSGAA
FT                   VNKFIAPVILVAFGWQAVPQVYAAIMLGTLVLFWLFSHSDPAHLVPSNVSFGEQLKALK
FT                   DPKVLKYCQYYSIVFGGYVALSLWMVQYYVGEYGLDIRVAALLAACFSLPGGVLRAIGG
FT                   VLSDKFGAHSVTWWVMWVSWICLFLLSYPQTDFTIQTVNGPITLHVGLNVYMFTALMFV
FT                   LGIAWAFGKASVFKYISDDYPKNIGAISGIVGLAGGMGGFVLPIMFGALMDWTGIRSSA
FT                   FMLMYGVVWVSLIWMYFTEVRRTDVMGSGGSAPAAR"
FT   gene            445188..446633
FT                   /locus_tag="Ajs_0435"
FT   CDS_pept        445188..446633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0435"
FT                   /product="nitrite transporter"
FT                   /note="TIGRFAM: nitrite transporter; PFAM: major
FT                   facilitator superfamily MFS_1; KEGG: gme:Gmet_0334 nitrate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40686"
FT                   /db_xref="GOA:A1W361"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1W361"
FT                   /protein_id="ABM40686.1"
FT                   /translation="MSNNNVSQGSGRKGRVLTLWTPEDKTFWAREGEAVAKINLWISVP
FT                   ALFLAFAIWQVWSVVAVNLPGLGFKYSTNQLFWLAAAPALSGATLRIFYSFMVPVFGGR
FT                   RWTALSTASLLIPAIGIGYAVQDNTTSYPTMLLLALLCGLGGGNFSSSMANISFFFPKE
FT                   RKGSALGVNAGLGNLGVSVVQFLSPLVITAGIFGIFGGEPQTIVKNGQEQMVWAQNAAF
FT                   IWVPWIALAAVAAWFGMNDIADARASFAAQAAIFKRKHNWIMCVLYLGTFGSFIGFAAG
FT                   FPLLIKALFPEVNPLAYAWLGPLVGAVVRPLGGWLADKVGGARVTVWSFLVMALAVVGV
FT                   LFFLPKGSGGFALPFGPAEGSFTGFFLMFLVLFFTTGIGNGSTFRMIPVIFLTQKLREL
FT                   RTDDEASRAQAIKDGNTEGAAAVGFAGALGAYGGFFIPKSYGSSIAATGGPEFALWMFA
FT                   VFYVLCIIITWWYYSRKHAEMPC"
FT   gene            446670..450470
FT                   /locus_tag="Ajs_0436"
FT   CDS_pept        446670..450470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0436"
FT                   /product="respiratory nitrate reductase alpha subunit
FT                   apoprotein"
FT                   /note="TIGRFAM: nitrate reductase, alpha subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: rfr:Rfer_2792 nitrate
FT                   reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40687"
FT                   /db_xref="GOA:A1W362"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR028189"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:A1W362"
FT                   /protein_id="ABM40687.1"
FT                   /translation="MSHFLDRLSYFAQPRETFSQGHGQTNGEDRTWEDAYRDRWAHDKI
FT                   VRSTHGVNCTGSCSWKIYVKGGIVTWETQQTDYPRTRPDLPNHEPRGCARGASYSWYLY
FT                   SANRVKYPMVRGRLLKHWRAALAIAKSPVDAWAAIVENDSARREWQKQRGLGGFVRSTW
FT                   DEVNQMIAAANVYTIKKHGPDRIIGFSPIPAMSMISYAAGSRYLNLIGGVPMSFYDWYC
FT                   DLPPSSPQVWGEQTDVPESADWYNSNYIIAWGSNVPQTRTPDAHFFTEVRYKGAKVVAV
FT                   TPDYSEVAKLADLWLHPKQGTDAAVAMAMGHVILKEFYFDKRSAYFDDYARRYTDLPLL
FT                   VVLQEKQLPDGRTVMVPGRYVRASDFADKLGQSNHPDWKTVAYDVDGRVALPNGSIGFR
FT                   WGKDGRDDKGLWNLESKEARTGNDVKLKLSVLEDGAQAHDVTDVAFPYFGGIDTPNFQS
FT                   NDQGGDVIVRRVPITHLDLQGEGVSGRVAVATVFDLQAANYGVLRGLPGEEKDGGEEGG
FT                   YNANAPYTPAWQERITGVPRDQVIAIARQFADNADKTHGKSMVIIGAAMNHWYHCDMNY
FT                   RGIINMLMMCGCIGQSGGGWSHYVGQEKLRPQTGWTALAFALDWIRPPRQQNSTSFFYA
FT                   HTDQWRYEKLGVEEVLSPLADPKDYQGSMIDFNVRSERMGWLPSAPQLQTNPLQVVRDA
FT                   QAKGVDPKDYVVQSLKNGSLTMSCEDPDNPMNWPRNMFVWRSNILGSSGKGHEYFLKHL
FT                   LGTTHGVQGKDLGKDEAKPQEVKWHANAPEGKLDLLVTLDFRMSTTCLYSDIVLPTATW
FT                   YEKNDLNTSDMHPFIHPLSAAVDPAWQSRSDWEIYKGFAKAFSEVCVGHLGVEKEVVLT
FT                   PIMHDTPAELAQPYGVKDWKRGECDLIPGVTAPQVTVVERDYPNTYKRFTALGPLMDKV
FT                   GNGGKGIAWNTETEVAQLGDLNGRVREEGVTQGRPRIVSDIDATEVVMMLAPETNGHVA
FT                   CKAWEALGKQTGREHVHLALHREDEKIRFRDIQAQPRKIISSPTWSGLESEKVSYNAGY
FT                   TNVHELIPWRTLTGRQQFYQDHPWMRDFGEGFVSYRPPVHLKALHEVEGKMPNGNPEIA
FT                   LNFITPHQKWGIHSTYSDNLHMLTLNRGGPVIWLSEDDAKRGGIVDNDWVELFNANGAI
FT                   AARAVVSQRVNPGMVLMYHAQEKIINTPGSEITGTRGGIHNSVTRIVLKPTHMIGGYAQ
FT                   YSYGFNYYGTIGTNRDEFVLVRKMRRVDWMDDEASTSAAHA"
FT   gene            450489..452012
FT                   /locus_tag="Ajs_0437"
FT   CDS_pept        450489..452012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0437"
FT                   /product="respiratory nitrate reductase beta subunit"
FT                   /note="KEGG: pol:Bpro_4594 nitrate reductase, beta subunit;
FT                   TIGRFAM: nitrate reductase, beta subunit; PFAM: 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40688"
FT                   /db_xref="GOA:A1W363"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:A1W363"
FT                   /protein_id="ABM40688.1"
FT                   /translation="MKIRAQIGMVLNLDKCIGCHTCSVTCKNVWTSRPGVEYAWFNNVE
FT                   TKPGIGYPKEWENQDKWNGGWVRNPDGSIAPRQGGKWKLLMRIFANPNLPQIDDYYEPF
FT                   TFDYDHLQSAPEMKAAPTARPRSLITGQRMEKIEWGPNWEEILGGEFSKRSADVNFEQV
FT                   QKDMYGQFENTFMMYLPRLCEHCLNPACVASCPSGSIYKREEDGIVLIDQDKCRGWRMC
FT                   VSGCPYKKIYYNWQTGKAEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADRIQE
FT                   AASVERDRDLYEAQLDIFLDPNDPDVIRQAKADGISDAWLEAAKNSPVYKMAVDWKIAL
FT                   PLHPEYRTLPMVWYVPPLSPITAAANAGHLGVNGEIPDVSQLRIPVQYLANLLTAGDTG
FT                   PVVRALERMLAMRAYQRGMHVDRQQNLAVLQQVGLTVHEVEDMYQVMAIANYEDRFVIP
FT                   SAHREYAENAFDLRGGCGFSFGNGCSDGSTDVSMFGGKKRRTIPIKATV"
FT   gene            452032..452730
FT                   /locus_tag="Ajs_0438"
FT   CDS_pept        452032..452730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0438"
FT                   /product="respiratory nitrate reductase chaperone NarJ"
FT                   /note="TIGRFAM: nitrate reductase molybdenum cofactor
FT                   assembly chaperone; PFAM: Nitrate reductase, delta subunit;
FT                   KEGG: pol:Bpro_4593 nitrate reductase molybdenum cofactor
FT                   assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40689"
FT                   /db_xref="GOA:A1W364"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A1W364"
FT                   /protein_id="ABM40689.1"
FT                   /translation="MFQKTPESLRLTLRALAHLLGYPDAALRANAPALLDALRLERALP
FT                   EARMQEIEALCRQLCAMEPYEAEARYVDTFDRGRQTSLHLFEHVHGDSRERGPALIDLM
FT                   QTYEKAGLQFDAQELPDHLAVVLEFASTQPPAVAREFLGEMAHILNALFTALTSKGNPY
FT                   ACVIAAVLEVAGQRVQAVAIAPEPGLDDAWAEPEAFDGCATRGQNRPDQPQPLHFVRNA
FT                   RANSSQGASV"
FT   gene            452727..453461
FT                   /locus_tag="Ajs_0439"
FT   CDS_pept        452727..453461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0439"
FT                   /product="respiratory nitrate reductase gamma subunit"
FT                   /note="TIGRFAM: respiratory nitrate reductase, gamma
FT                   subunit; PFAM: Nitrate reductase, gamma subunit; KEGG:
FT                   rfr:Rfer_2795 respiratory nitrate reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40690"
FT                   /db_xref="GOA:A1W365"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A1W365"
FT                   /protein_id="ABM40690.1"
FT                   /translation="MTAWIDNLLFGLYPYICLAVFFIGSWARFDRDQYSWKSDSSQLLR
FT                   RGSLRWGSNLFHVGVLVLFFGHFVGMLTPHALYEPFMSAGAKQIMAMVVGGVAGILGFI
FT                   GVTLLLHRRLTDARIRATSKTSDILLLWVLWVQLALGLATIPLSAQHLDGSMMMLLAEW
FT                   AQRIVTFRGGAVELLANAGWVFKAHMFLGMTVFLIFPFTRLVHVWSGFGTLAYITRPYQ
FT                   LVRARRMNLPAGHNQPGNRNAL"
FT   gene            453552..454388
FT                   /locus_tag="Ajs_0440"
FT   CDS_pept        453552..454388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0440"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: rfr:Rfer_2796 PpiC-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40691"
FT                   /db_xref="GOA:A1W366"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:A1W366"
FT                   /protein_id="ABM40691.1"
FT                   /translation="MSYTTCGSGGCGCAGSTDNLPQEEAAPVARINGVPLHADGEILPP
FT                   DVLRQRACTELLRQQAQREGLLSQDDAPGLDGATSAEASQAIERLLDQALQVPEPSEEA
FT                   CRRYHAAHPTLGGQGERVRMRHVLFAVTPGVDVKLLRQRAEGVLLDLRCADDDGARFAA
FT                   AAGQWSNCPSGQEGGDLGWLSAEDCAPEFAREVFGTQEVGVLSRLVHSRFGLHVVEVCE
FT                   RQPGQELPFEQVRASVALMLRQQAWVNALRQYLQLLAGEAEVEGVHLDAADTPLVQ"
FT   gene            454410..455087
FT                   /locus_tag="Ajs_0441"
FT   CDS_pept        454410..455087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0441"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: pol:Bpro_4590
FT                   carbonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40692"
FT                   /db_xref="GOA:A1W367"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A1W367"
FT                   /protein_id="ABM40692.1"
FT                   /translation="MPDDELLQRLRRFHLDAFPQYREQFQTLVDEGQHPTTLFIGCSDS
FT                   RLLPYLLTGAGPGELFLVRNVGAFVPPYDGSYGHHGTAAAIEFAVLELHVSRIVVCGHS
FT                   HCGAIKALYGEVSPEARNLQRWLDLGREAALPVQPGPEALRRTEQRAVVLQLERLMEYP
FT                   MVRRRVEDGSIALHGWHYVIEEGEVHVFDVATGGFVAASKAKSSGTGPYAPYVEHDGQV
FT                   LVD"
FT   gene            455124..456458
FT                   /locus_tag="Ajs_0442"
FT   CDS_pept        455124..456458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0442"
FT                   /product="NnrS family protein"
FT                   /note="PFAM: NnrS family protein; KEGG: rfr:Rfer_4151 NnrS"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40693"
FT                   /db_xref="GOA:A1W368"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:A1W368"
FT                   /protein_id="ABM40693.1"
FT                   /translation="MTEARRRTVPLRSEPAAPGRPSAEALARLDRRWRPRYLMLAPHRL
FT                   GFFLAMLLLMASGLWWALVQIDRVSGALALPYGVAPSLVHAAVMTFGFMPLFFAGFLFT
FT                   AGPKWLHVEPWPVSRVMPPLLLQAGGWLVWLAGGSWGLLVALAGCAVAFLGLAWMTVLF
FT                   IRLVQRSTLQDRLHARAIAAACLVGCVCIAALGLSLAGGRGDLARAWVLTGLWGFVAAV
FT                   FVVVAHRMIPFFTSAVLPMVQAWRPFWVLWLMLAAVVAEALAVWLPWLGWAPALDTGGL
FT                   LVRGALELSAGAVLLWLAYRWGLLQSLAQRLLAMLHIGFIWLGLAFVGHGLAHGAQGLY
FT                   GSAAGELGALHALTMGCLGSLMLAMVTRVSCGHGGRALVADRLVWTLFWVLQLATVVRL
FT                   AASAPLPWSPVLLAVAALLWAGIMAVWGLRLIGWYGRLRADGRPG"
FT   gene            456464..457126
FT                   /locus_tag="Ajs_0443"
FT   CDS_pept        456464..457126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0443"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: pol:Bpro_4587
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40694"
FT                   /db_xref="GOA:A1W369"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A1W369"
FT                   /protein_id="ABM40694.1"
FT                   /translation="MEQERPVPPQALNNAAATAELAAALLQARQTILPKRLGAPGPDAA
FT                   QLQAILAAAAHAPDHGCLLPWRFVLVPDAARAALGQAFADALRERDAQATPEQQEQARE
FT                   KALRAPVLLLVVVDECGGDPEIAPSERLVSAGCAVQNLLLMATALGFGSALTSGKALQS
FT                   QALRGLFALGEGERALCFVSVGTVVSRKPVRARPVPAQYVGTLVPGRGVQPWPQQGE"
FT   gene            457127..457552
FT                   /locus_tag="Ajs_0444"
FT   CDS_pept        457127..457552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40695"
FT                   /db_xref="UniProtKB/TrEMBL:A1W370"
FT                   /protein_id="ABM40695.1"
FT                   /translation="MQVKTEINSFDDLLRAARSHRERQRLLFVFAGTELPDEATPEQRE
FT                   RFAQGEGGVLVPLMCVDKLPEELESFDALVRESQQFEQPGQPWRLVFTAALSGTAAQAP
FT                   SDDDADKVLRRMVEAVKTGAFSAYLPFNRDGQPVRLG"
FT   gene            457557..458102
FT                   /locus_tag="Ajs_0445"
FT   CDS_pept        457557..458102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0445"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: pol:Bpro_4585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40696"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:A1W371"
FT                   /protein_id="ABM40696.1"
FT                   /translation="MASRVSLPGLHAPGAGFDEPFEMLGACHDRVRRSLDLLQRLRDYL
FT                   KTHACDDSARQAARDVLRYFDIAAPLHHEDEELHVFPPLLAGGDAALTDLVRQLQRDHV
FT                   LMAERWAAARVGLQALADGAVQAFTPQHETALDRFAQCYDDHLRHEDDRIYPAARALLD
FT                   DPAQQSMGQEMARRRGVR"
FT   gene            complement(458336..458626)
FT                   /locus_tag="Ajs_0446"
FT   CDS_pept        complement(458336..458626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40697"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:A1W372"
FT                   /protein_id="ABM40697.1"
FT                   /translation="MNMLYDSDSFVVVHMLADATPDSASDAATPAVPQLVRHGFEIVDK
FT                   RSGKEVYLDGSWAEMFQQQILAWQRNTPTQEEVEDTLDGYVGLAQNPVIVH"
FT   gene            complement(458803..460017)
FT                   /locus_tag="Ajs_0447"
FT   CDS_pept        complement(458803..460017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40698"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:A1W373"
FT                   /protein_id="ABM40698.1"
FT                   /translation="MPRRALLLLTAVVLALHWLVLVGLPRGGTDQGAPQRLAFHTRMVE
FT                   PPPPPPPPPEPQAAPVPPPASKPRPRPVRKPPPPPVEAPPPTRHAEPAPVMEAPAQAAP
FT                   SPAESPAEVPADSSTPPPEVPADAAAPSAPLSPASDPAMPAMAEASSASAPAAASQPAQ
FT                   EAPALTAGVEILPPGAAGAVAGTEPPPVRLPPSARLAFDVTGEVKKFHYNASAELLWRQ
FT                   DGTQYEARQQIKAFLLGARSQSSVGQITPQGLRPTRFGDKSRSERAAHFDFERGEVIFS
FT                   ANAPRAAIGSGAQDRLSVFIQLGALLAAAPERYPPGTRITLTTVGARSAERWTFTVEGP
FT                   QTLELPAGSTPALKLQRLPRPDQRYDQKAELWLGTDMGYLPVRIRLTQANGDFADLSLS
FT                   HHDTP"
FT   sig_peptide     complement(459946..460017)
FT                   /locus_tag="Ajs_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.452 at
FT                   residue 24"
FT   gene            complement(460022..460810)
FT                   /locus_tag="Ajs_0448"
FT   CDS_pept        complement(460022..460810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0448"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: pol:Bpro_0445
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40699"
FT                   /db_xref="GOA:A1W374"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W374"
FT                   /protein_id="ABM40699.1"
FT                   /translation="MDKERVGIQSVEVGFALLDALSRARGPLMLKDLAQEAGMSAAKAH
FT                   RYLVSFQRLGLVVQDARNARYDLGPAALKLGLASLARLDAMRLARERMAPLMDALGHTL
FT                   ALAVWGNHGPTIVHWEEAPRALTANLRLGDVMPLLSSATGRCFAAYLPREKTAALIAEE
FT                   LALATRQGRADLPHDEAGVQALLREVRERRCARVLDTLLPGIHAFCAPVFDAGGHLALA
FT                   ITTLGPAATFDAAWGGAIEAPLRAAAEQLSRDLGHAATPG"
FT   gene            460926..461909
FT                   /locus_tag="Ajs_0449"
FT   CDS_pept        460926..461909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0449"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   pol:Bpro_0446 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40700"
FT                   /db_xref="GOA:A1W375"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:A1W375"
FT                   /protein_id="ABM40700.1"
FT                   /translation="MKLATYKDGSRDGQLVVVSRDLGTAHYATGIASRLQQVLDDWNFM
FT                   APQLQDLYDQLNAGRARHPFPFDPQQCMAPLPRAYQWADGSAYINHVELVRKARNAEVP
FT                   ASFYTDPLMYQGGSDDFIGPCDDVVVPSEAMGIDFEAEIAVVTGDVKMGASPEQALDGI
FT                   RLVMLANDVSLRNLIPAELAKGFGFFQSKPATAFSPVAVTLDELGDAWQGGRVHLTLQS
FT                   TWNGRKVGMCDAGPEMTFHFGQLIAHIAKTRNVRAGSIVGSGTVSNKDWAKGYSCIAEK
FT                   RCIETIQDGQPSTEFMRYGDTIRIEMKNKAGQSLFGAIDQTIAAPQ"
FT   gene            461986..462954
FT                   /locus_tag="Ajs_0450"
FT   CDS_pept        461986..462954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0450"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   reu:Reut_A0112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40701"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W376"
FT                   /protein_id="ABM40701.1"
FT                   /translation="MERRTFLAACAATAAAPWTRADTGYPSQPIRWVVPYPAGGGTDVL
FT                   ARTVAEAMRGGLGQQIVVDNRPGASTNIGSQIVATAKPDGYTVMSADNALLAYNEHLYR
FT                   RLPFHPDKDFTYIGGLSRFPLVLVVNPAFAAQTFQDFLAHVKARPGQVNYASPGNGSPH
FT                   HLAMELFKHRTQTFLTHIPYRGAAPAVQDVMGGQVPCMFLDLAAGLPVIQSGKVRALAI
FT                   GAARRAAALPHVPTLAEVGVADAEVYAFQGLLGPAGLPTAITARLNAALNQALAAPEVV
FT                   ERMRAFGMEPLAGTPEQFHALARAEARRWGPVIAATGVKLD"
FT   sig_peptide     461986..462051
FT                   /locus_tag="Ajs_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.885 at
FT                   residue 22"
FT   gene            complement(463019..465085)
FT                   /locus_tag="Ajs_0451"
FT   CDS_pept        complement(463019..465085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0451"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: pol:Bpro_4032 molybdopterin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40702"
FT                   /db_xref="GOA:A1W377"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037920"
FT                   /db_xref="UniProtKB/TrEMBL:A1W377"
FT                   /protein_id="ABM40702.1"
FT                   /translation="MLPTPVPDASATHQVRGACPHDCPDTCALLTAVENGRAVRVQGNP
FT                   AHAQTGGVLCAKVSKYAERTHHAERILTPLKRTGPKGSGQFTPVSWDEALGDIAARLAH
FT                   IAARDPQAIQPYSYAGTMGLVQGESMDRRFFHRLGASLLARTICATAGGEGLVHTLGAK
FT                   VGMKVEFFAEAQLILIWGSNSIGSNLHFWRIAQQAKRDGARLVCIDPRKSETAEKCHEH
FT                   LQLRPGTDAALALALMHELIVHDWLDHDYLARHTLGWEQLRERALQWPPERAAEVCGLP
FT                   VEQIRRLAHDYGTTRPAAIRLNYGVQRAHGGANAVRAIASLPALTGAWRHRAGGVLLSS
FT                   SGSFPVDRAALQRPDLLAGRSPRTINMVTIGDDLLRDASPSFGPKIEALVVYNSNPVAV
FT                   APDSRQVVRGFAREDLFTVVLEHFQTDTADYADYILPATTQLEHWDVHLAYGHTDVLLN
FT                   RPAIAPQGQARSNAQIFRDLAARMGFTEPCFADSDEALCRQAYGDRVDFDLLLEQGFAP
FT                   LSVPDAPFADGGFPTPSGQCEFYSQRLADQGLDPLPGYVPNHEGAGTSADYPLAMISPP
FT                   ARNFLNSTFVNLQSLRDIEGRPLLEIHPEDAAARGIADGALVRVFNDRGSYACHAALNG
FT                   RARPGVVNGLGVWWRKLGHNGTNVNELTSQALTDLGAGPTFYDCRVQVEPLAS"
FT   gene            465207..466355
FT                   /locus_tag="Ajs_0452"
FT   CDS_pept        465207..466355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0452"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rso:RSc2864 probable LEU/ILE/VAL-binding signal peptide
FT                   protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40703"
FT                   /db_xref="GOA:A1W378"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1W378"
FT                   /protein_id="ABM40703.1"
FT                   /translation="MHSTRLSRRQFSAGMGAALLTGASLTRAQSDTRIVLGQSAALTGP
FT                   ASQLGLQFQAGAKLAFDQVNAQGGIGRRTIELRSLDDGYEPDRCAENTRRLINEDVLAL
FT                   FGYVGTPTSLAAQPLFTQAKVPFFAPVTGAESLRQPFNRLAFHVRASYADEAELIVRQL
FT                   TNLGLDRIGVFYQDDAYGKAGLDAVTRALATRKLAPVATGTVARNSANVTAAVAPLVAA
FT                   QPVAIVQIGAYAASAAFVLAARKAGYGGKFYNVSFVGTQALADALGANGAGVVVSQVVP
FT                   SPYQQSRQITREFQEAIKKGGNVQANYSSMEGYLAARVFIEGLRNAQAHASGKLTRESL
FT                   VAGLESLRGSVGGFTVNFSPSDHEGSRFVEMSMLTGDGRVRT"
FT   sig_peptide     465207..465293
FT                   /locus_tag="Ajs_0452"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.942 at
FT                   residue 29"
FT   gene            466471..467676
FT                   /locus_tag="Ajs_0453"
FT   CDS_pept        466471..467676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0453"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: pol:Bpro_2111 peptidase M20D, amidohydrolase;
FT                   TIGRFAM: amidohydrolase; PFAM: peptidase M20; peptidase
FT                   dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40704"
FT                   /db_xref="GOA:A1W379"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1W379"
FT                   /protein_id="ABM40704.1"
FT                   /translation="MNIIDSIAREAAAIAEVRRDIHAHPELCFQEVRTADVIAAKLTEW
FT                   GIPIHRGLGTTGVVGIVHGRDGGACGRAVGLRADIDALPMQEFNTFAHASKHQGRMHAC
FT                   GHDGHTAMLLAAAQYFSKHRDFDGTVYLIFQPAEEGGGGAREMIKDGLFEQFPMQAVFG
FT                   MHNWPGMPAGSFAVSPGPVMASSNEFKITIRGKGSHGAMPHMGIDPVPVACQMVQAFQN
FT                   IISRNKKPIEAGVISVTMIHAGEATNVVPDSCELQGTVRTFSTELLDMIERRMRQVAEH
FT                   TCAAFEARCEFEFVRNYPPTINSPAEAEFARQVMVGIVGEDKVLAQEPTGGAEDFSFML
FT                   QAKPGAYVFIANGDGDHRAMGHGGGPCTLHNPSYDFNDALIPLGGTYWVELARQWLAQP
FT                   TA"
FT   gene            467777..468877
FT                   /locus_tag="Ajs_0454"
FT   CDS_pept        467777..468877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_2110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40705"
FT                   /db_xref="InterPro:IPR021259"
FT                   /db_xref="UniProtKB/TrEMBL:A1W380"
FT                   /protein_id="ABM40705.1"
FT                   /translation="MIGIPQAFAASYAQARAQFVGAAAVAGLALQPQVHPLCGPNGETL
FT                   ALDVVREGPLDAHRLLIVSSGCHGVEGLCGSGVQVFALQDGEWRAKARAQRVAVLYLHA
FT                   LNPYGFAHLRRVTHENVDLNRNFVDFSQPLPANPAYSALHPVLLPPEWPPSEANTQALL
FT                   DLLNARGLQALQAAITRGQYQHPDGLYFGGTAPTWSNRTLRAVLRREGARAERIAWVDL
FT                   HTGLGPSGHGERIHAGRDEAQALARARRWWDGGGATPVTSTEDGSSTSAPLTGLMCHSA
FT                   YDECPQAEVTALTLEFGTQPAPAVLQALRADHWLHRHPEASPALAARVHAQMREAFYTD
FT                   TDAWKGQVISQARQVLFQAVDGLCMA"
FT   gene            468962..469219
FT                   /locus_tag="Ajs_0455"
FT   CDS_pept        468962..469219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0455"
FT                   /product="acyl-coA-binding protein, ACBP"
FT                   /note="PFAM: acyl-coA-binding protein, ACBP; KEGG:
FT                   rfr:Rfer_3532 acyl-coA-binding protein, ACBP"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40706"
FT                   /db_xref="GOA:A1W381"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:A1W381"
FT                   /protein_id="ABM40706.1"
FT                   /translation="MSDLNATFEAAVANSKNLSERPDNPTLLKIYALYKQATAGDNAEK
FT                   KPSFSDIVGRAKWDAWEKLKGTSGDAAKQQYIDLIESLRG"
FT   gene            complement(469304..470449)
FT                   /locus_tag="Ajs_0456"
FT   CDS_pept        complement(469304..470449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0456"
FT                   /product="putative zinc protease protein"
FT                   /note="KEGG: pol:Bpro_4033 putative zinc protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40707"
FT                   /db_xref="GOA:A1W382"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:A1W382"
FT                   /protein_id="ABM40707.1"
FT                   /translation="MSTSTPSPRRPWPLLAAALLLGGCAQSGGTLGYYWQSLRGHLEIM
FT                   NAARPVQEWITHPDTSAPLRERLQLAQRARAFAVDELALPDNASYRRYARLDRTAAVWN
FT                   VVAAGPYSLTLHRWCFPITGCIGYRGYFDEPGARAEAARLAATGLEVSVYGVPAYSTLG
FT                   YSNWMGGDPLLSTFIGWPEGDFVRLLLHELAHQVAYAEGDTAFNESYATAVERLGVQRW
FT                   LQQHATPATRAQFAASEERRAQWRALTQVTRQRLAEIYASNGAVAPDYQALSAMKKEAM
FT                   QDFRAAYATLRARWLAAHVPEAQLAALDRWVRDANNASFAAQAAYDEGVPAFMALFERE
FT                   GRDWPRFHAAVRALAQAPQAERTAALQALAPQPPRVAHGGG"
FT   sig_peptide     complement(470366..470449)
FT                   /locus_tag="Ajs_0456"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.859 at
FT                   residue 28"
FT   gene            470524..471195
FT                   /locus_tag="Ajs_0457"
FT   CDS_pept        470524..471195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0457"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="PFAM: methyladenine glycosylase; KEGG: pol:Bpro_3540
FT                   DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40708"
FT                   /db_xref="GOA:A1W383"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A1W383"
FT                   /protein_id="ABM40708.1"
FT                   /translation="MLETIEPPSPDEASGLFTDEGGHARCFWCRASPLYRHYHDHEWGF
FT                   PVTDERRLFEKLCLEGFQAGLSWITILNKREAFRAALAQFEAEPLADFGAAEVDQLMGN
FT                   AGIVRHRGKIESAINNARRVLELRREFGSLAHYVWRYAPLAAQQRPERMTLPAVRAMTT
FT                   SAASVALSKDLKKRGFSFVGPTTMYAFMQAMGLVNDHLEGCGARAAAEAARAAFTPPAA
FT                   G"
FT   gene            complement(471265..471882)
FT                   /locus_tag="Ajs_0458"
FT   CDS_pept        complement(471265..471882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA2796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40709"
FT                   /db_xref="UniProtKB/TrEMBL:A1W384"
FT                   /protein_id="ABM40709.1"
FT                   /translation="MGGTARRPCRTIAAFPLPEGPMPQTPAPLSPEDAAALYQALRAEG
FT                   MADALTTLHIGGAHTRLLSGAADAPALLRTLDIGARVTAATCFAHQPPTEAEMEHAIML
FT                   VEDAVMPVRALLAPGSTLYTADGGIRQIALAAGLPAQPELHLPLEAVEDTFNRLAALSL
FT                   GRPATQDTLAQDNAFAATLLILRECLHHLGFDHIVVRSDAVV"
FT   gene            complement(471935..472105)
FT                   /locus_tag="Ajs_0459"
FT   CDS_pept        complement(471935..472105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40710"
FT                   /db_xref="UniProtKB/TrEMBL:A1W385"
FT                   /protein_id="ABM40710.1"
FT                   /translation="MGNKIVTEADRKRTPRPTPMPGMAVTTHGRGQRVSLERGVATRSK
FT                   KNPGKRANQGG"
FT   gene            472395..473678
FT                   /locus_tag="Ajs_0460"
FT   CDS_pept        472395..473678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0460"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   pol:Bpro_3190 cyclopropane-fatty-acyl-phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40711"
FT                   /db_xref="GOA:A1W386"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1W386"
FT                   /protein_id="ABM40711.1"
FT                   /translation="MKHLLHSLEASLALSPVGVAVELPDGARLGDANADLRLRFRDRMA
FT                   VVALAMGEIGNVGAAIVEGRVALEGSMRQLMTAAAALLKQNPTHEGPATGWQRVLLRAR
FT                   SMAAHTLSHDARNIQFHYDLSDDFYALWLDPRRVYSCAYYRTPDMSLAQAQEAKLDHIC
FT                   RKLLLRPGDRFLDIGAGWGGLLLWAAQEYGVDATGITLSRNQHAHVQRLIAERGLQGRV
FT                   RMQLLDYRELQVEQPFDKIASVGMFEHVGRSQMERYFATVHRLLRPGGLLLNHGITSGG
FT                   LDNPRLGAGLGDFIERYIFPGGELLHVSAVLHDMARAGLEMVDTENLRPHYARTLWAWS
FT                   DALEARQDEARSVLVAQHGKERGEKALRAYRLYLAGCALAFERGWTALHQMLAVRPTGH
FT                   VEDGVLKGAQSDYPFSRAYMYEGPAATH"
FT   gene            473699..474022
FT                   /locus_tag="Ajs_0461"
FT   CDS_pept        473699..474022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40712"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:A1W387"
FT                   /protein_id="ABM40712.1"
FT                   /translation="MLFKFKSRATADVIMLEPNGKQLLEIIGKSPNEPHGIITAAQIPA
FT                   AIRALEEAVAVEEAAAAATAPDEDDQTEEEAPRGDGVRLRQRAAPFIDMLRRSAAEDCD
FT                   VVW"
FT   gene            complement(474060..475097)
FT                   /locus_tag="Ajs_0462"
FT   CDS_pept        complement(474060..475097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0462"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_0596 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40713"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W388"
FT                   /protein_id="ABM40713.1"
FT                   /translation="MPHTSSPRRTPPRRQALHAIAALLALGLGATGAAYAQASPWPAKP
FT                   VRIVVPFAAGGTTDILARAIAPELGKAFGQQFIVDNRGGAGGNIGAELVARSAPDGYTL
FT                   LMGTVGTHGINRALYKQLPYDPIKDFAPVTLVASVPNVMVMNTEKARSLGINTVQDFIR
FT                   YAQANPGKLNMASSGNGTSIHLAGELFKSMTGTYMLHMPYRGSAPALLDMVGGNMDVMF
FT                   DNLPSSMAHIKGGKLKALAVTSAKRSTALPDVPTVEEAGGPALKGFEASSWFGLLAPAG
FT                   TPADIVQRVQQEVAKALATPAVKERLLSQGAIPGGNTSAEFASLIDREHRKWAQVVKAS
FT                   GAKVD"
FT   sig_peptide     complement(474987..475097)
FT                   /locus_tag="Ajs_0462"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.801 at
FT                   residue 37"
FT   gene            complement(475263..476252)
FT                   /locus_tag="Ajs_0463"
FT   CDS_pept        complement(475263..476252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0463"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_0597 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40714"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W389"
FT                   /protein_id="ABM40714.1"
FT                   /translation="MRTTFKIAVGAAAILAAFGASAQAYPVKDKNITIVVPFSAGGPTD
FT                   RVARDLAEALRKPLGGATVVVENAAGAGSTIGAAKVARAQPDGYTLLLNHIGMATIPTL
FT                   YRKLSFNVLNDFEFLGIVNDVPMTIISRPTLEAKNYKELATWIAQNKEKVNLGHSGLGS
FT                   AGHLCGLMFQHALQSHMTPVAYKGAAPAITDLIGGQIDLMCDQTTNTTTQIEGKKVKAF
FT                   AVTTNQRLTMPSLKDLPTLQESGLKDFNVSVWHGLYAPKGTPAAVLTRINEALQVAVKD
FT                   PDFIKKQEGLGAVVVADKRVLPAEHKKFVQSEIEKWGMVIKAAGTYAD"
FT   sig_peptide     complement(476178..476252)
FT                   /locus_tag="Ajs_0463"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.603 at
FT                   residue 25"
FT   gene            complement(476444..477691)
FT                   /locus_tag="Ajs_0464"
FT   CDS_pept        complement(476444..477691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0464"
FT                   /product="putative phenylacetate-CoA ligase"
FT                   /note="KEGG: pol:Bpro_0598 putative phenylacetate-CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40715"
FT                   /db_xref="GOA:A1W390"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1W390"
FT                   /protein_id="ABM40715.1"
FT                   /translation="MSMFYDALETRAPAEREAALMAALPRQIAHAQQASPAFAGILAGV
FT                   DATTITDRAALARLPVTRKYELLERQQAQRGQNAFGGFSALAFGRHMPRVFASPGTIYE
FT                   PEGARPDYWRMARAMYAAGFRPGELIHNSFSYHFVPAGSMMETGAHALGCTVFPGGTGQ
FT                   TEQQVQAMAELRPAGYIGTPSFLKIILDKAHEHGVALPSVTKALVSGEAFPPSLRDWLA
FT                   ARGVTGYQCYATADLGLIAYETSAREGLVLDEGVIVEIVRPGTGDPVPEGEVGELVITT
FT                   LNPDYPLIRFGTGDLSAVLPGQCPTGRTNTRIKGWMGRADQTTKVRGMFVHPGQIASVV
FT                   KRFPQVQRARLVVSGEMANDQMVLQVETTETAAGMAQQLAEALREVTKLRGDVQMVPPG
FT                   SLPNDGKVIEDARSYR"
FT   gene            complement(477784..478593)
FT                   /locus_tag="Ajs_0465"
FT   CDS_pept        complement(477784..478593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0465"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_0599 ABC transporter related; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40716"
FT                   /db_xref="GOA:A1W391"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1W391"
FT                   /protein_id="ABM40716.1"
FT                   /translation="MESRNIVLSVNGIEVIYNHVILVLKGVSLQLPEKGIVALLGGNGA
FT                   GKTTTLRAISNLLKGERGEVTKGSIELRGEQIQNLSPADLVKRGVVQVMEGRHCFAHLT
FT                   IEENLLTGSYTRTDKAEIAANLEKVYNYFPRLKTRRTSQAAYTSGGEQQMCAIGRAIMS
FT                   NPSIVLLDEPSMGLAPQIVEEVFNIVKDLNAKEGTTFLLAEQNTNMALKYADYGYIMES
FT                   GRIVMDGAAQDLASNEDVKEFYLGVGGGERKSFKDVKSYKRRKGWLA"
FT   gene            complement(478790..480115)
FT                   /locus_tag="Ajs_0466"
FT   CDS_pept        complement(478790..480115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0466"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: rfr:Rfer_3538 hypothetical protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40717"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1W392"
FT                   /protein_id="ABM40717.1"
FT                   /translation="MKFTRLAAAATVACTLAGFAGAAAAQAKEQFFPLLSYRTGPYAPN
FT                   GVPWANGKQDYIKMINARDGGVNGVKLTWEECETGYATDRGVECYERLKSRPGVTLFDP
FT                   QATSITFALTEKAPVDKIPLMTLGYGLSVAQDGMAFKWNFPYMGSYWTGADILIQHIGK
FT                   NAGGLDKLKGKKIALVYHDSPFGKEPIPLLQERSKMHGFELQMLPVTAPGVEQKATWLQ
FT                   VRQSRPDYVLLWGWGVMNSTALKEAQATGYPRDKMYGVWWAGAEPDVRDVGDGAKGYHA
FT                   LALNGHGTQSKVMQDILKHVHGANQGTGPKDEVGSVLYTRGVIIQMLGVEAVRRAQERF
FT                   GKGKVMTGEQVRWGMENLALDQKKLDALGFTDLMRPLSTSCADHMGSTWARVHTWDGKQ
FT                   WKFSSDWYQADEQVIKPMVKAGADKYLADKKMSRREAGDCQS"
FT   sig_peptide     complement(480032..480115)
FT                   /locus_tag="Ajs_0466"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.665 at
FT                   residue 28"
FT   gene            complement(480192..481268)
FT                   /locus_tag="Ajs_0467"
FT   CDS_pept        complement(480192..481268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0467"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   pol:Bpro_0601 inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40718"
FT                   /db_xref="GOA:A1W393"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1W393"
FT                   /protein_id="ABM40718.1"
FT                   /translation="MFYRENGQFKTTYKADQQIFPITQDRIAILLLLAVAFVAVPAMAS
FT                   DYFYRAILIPLVIMSMAALGVNILVGYCGQISLGSGAFMAVGAYGAFNFFVRFPGMPLV
FT                   AALILGGLCATFFGILFGLPSLRVKGLYLAVATLAAQFFSDWMFLRIKWFTNNSDSGSV
FT                   SVSNLQVFGMPLDSAMAKYLFCLTLLVVVALLAKNLVRGAIGREWMAIRDMDVAAAVIG
FT                   IRPMYAKLSAFAVSSFIVGMAGALWAFVHLGSWEPAAFSVEVSFRLLFMVIIGGMGSIM
FT                   GAFFGAAFIVVLPIFLNQFLPAVAGLFGVDISTAAVSHAELMIFGALIVWFLIVEPHGL
FT                   AKLWSIGKQKMRVWPFPH"
FT   sig_peptide     complement(481134..481268)
FT                   /locus_tag="Ajs_0467"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.991 at
FT                   residue 45"
FT   gene            complement(481387..482316)
FT                   /locus_tag="Ajs_0468"
FT   CDS_pept        complement(481387..482316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0468"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   pol:Bpro_0602 inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40719"
FT                   /db_xref="GOA:A1W394"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1W394"
FT                   /protein_id="ABM40719.1"
FT                   /translation="MAFFLETLIGGLMAGMLYALVALGFVLIFKASGVFNFAQGAMVLF
FT                   AALAMARFAEWIPAWTGISNPIVANLAAFLIAGLCMFAVAWFIERLVLRHLVNQEGATL
FT                   LMATLGITYFLEGLGQTLFGSDIYKIDIGMPKDPVFLLDTVFEGGVLVNKEDVIAAGIA
FT                   AALVVVLSIFFQKTKTGRALRAVADDHQAAQSIGIPLNHIWVIVWCVAGVVALVAGMIW
FT                   GSKLGVQFSLTTVALRALPVVILGGLTSVPGAIIGGLIIGVGEKLSEVYLGPFVGGGIE
FT                   IWFAYVLALVFLLFRPQGLFGEKIIDRV"
FT   sig_peptide     complement(482242..482316)
FT                   /locus_tag="Ajs_0468"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.724) with cleavage site probability 0.577 at
FT                   residue 25"
FT   gene            complement(482327..483112)
FT                   /locus_tag="Ajs_0469"
FT   CDS_pept        complement(482327..483112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0469"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rfr:Rfer_3541 ABC transporter related; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40720"
FT                   /db_xref="GOA:A1W395"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1W395"
FT                   /protein_id="ABM40720.1"
FT                   /translation="MTSKKIGDVILDVKNISLRFGGVKALTDISFNVREHEIRSIIGPN
FT                   GAGKSSMLNCINGVYTPSEGSITFRGQTFGHMNSRQVAEMGIARTFQNLALFKGMSVID
FT                   NIMTGRNLKIKSNLLLQALRIGPAEREEIAHREKVEHIIDFLEIQAHRKTPVGQLPYGL
FT                   QKRVDLGRALAMEPQVLLLDEPMAGMNVEEKQDMCRFILDVNDEFGTTIVLIEHDMGVV
FT                   MDISDRVVVLDYGKKIGDGAPDEVRNNEDVIRAYLGTSH"
FT   gene            complement(483135..485183)
FT                   /locus_tag="Ajs_0470"
FT   CDS_pept        complement(483135..485183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0470"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   dar:Daro_0249 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40721"
FT                   /db_xref="GOA:A1W396"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1W396"
FT                   /protein_id="ABM40721.1"
FT                   /translation="MSSQRQDNVKVVPTIGCKPAADFVFPVRCPPQTLIGTGMKTTFPH
FT                   LLLQHAAQRPDAAALREKEYGIWQTWSWKDAAAEVRHMACGLLSLGFAKGQNLALISDN
FT                   RPHLYMGFVAVQSVGGVPIPLYQDAVAAEMTFVIQDAEIAFAFAENQEQVDKLLEVRES
FT                   VSGIQHIIYDDPRGLRHYDQPGLISTAQLVARGAEWDKAHPGAWDALVEQIDPQDVSVI
FT                   LYTSGTTGKPKGVCQTHASFIASAQGAVEVDRLGPQDNVISYLPPAWVGDHLFSLAQWM
FT                   VAGFTINCPESASTVSIDLREIGPTYYFAPPRVFEGMLTSVSIRMEDAAAPKRWLFEKC
FT                   MQLARRVGSDLLDGKPVGAIDRLKYRLADLAIYGPLRNVMGLSRIRVAYTAGAAIGPDL
FT                   FRFFRSIGINLKQLYGQTETCAYVCLQRDGQVDLNTVGQAAPGIELKIADNGEVLVKGV
FT                   SVLKEYYKRPDATAEVIDAEGYFHTGDAGVIDANGQLRIIDRAKDVGKTASGAMFAPNY
FT                   IENKLKFFPHIKEAVCFGNQRDQVCAFINIDYEAVGNWAERQGIPYGGYVDLASKPKVI
FT                   ELIADCISQVNADLAAEAGMADTQVARFLVLHKELDPDDDELTRTRKVRRNFIAEKYGV
FT                   LVDALYTGKAEQFIETQVKFEDGRKGSVSATLKITDAKTFPATRAAA"
FT   gene            485258..487000
FT                   /locus_tag="Ajs_0471"
FT   CDS_pept        485258..487000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0471"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; SMART:
FT                   AAA ATPase; KEGG: pol:Bpro_2822 peptidoglycan-binding
FT                   domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40722"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A1W397"
FT                   /protein_id="ABM40722.1"
FT                   /translation="MGATGEGAMLAAMYAPFFGLEHPPFSIAPDPRYLFMSERHREALA
FT                   HLLYGLDAGGGFVLLTGEIGTGKTTVCRCFLEQIPPQCNVAYIFNPKLTVPELLRSICD
FT                   EFGVAHRPAIPGAETVKDCLDPLNDFLLQQHAAGRNNVLIIDEAQNLAPDVLEQLRLLT
FT                   NLETSERKLLQIILIGQPELRAMVAAPELEQLAQRVIARYHLDALSADETRQYIAHRMA
FT                   VAGLQGPLPFQQRALARVHALTGGVPRRINLLCDRALLGAYGAGVREVTDAMVRRAARE
FT                   VFDAPATVRPGAAGRWLAAGTGGLVGAAALGGLAWALGWWPLADGGAGSTQAQAQTQRP
FT                   AMAASAAAVPASSPASAASAPDAPALPPTLAQFLAIQPVAQAPAAWQALARQWQASVPD
FT                   GAADPCAALASEGLRCYRSRRASLNLLRQLDRPVLLMLRPAEGDAQGEALAPEVAVLLR
FT                   RLDDGTATLEGVQGQTLQVRVTELAPLWRGEVATLWKAPAELADSGDVTATAAGAAWLD
FT                   QQLAAAGAGTAAARTATPAARRARIHQFQLGQGLTPDGRAGPLTLMLLNRAAGVPEPRL
FT                   LSGA"
FT   gene            487005..487814
FT                   /locus_tag="Ajs_0472"
FT   CDS_pept        487005..487814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40723"
FT                   /db_xref="GOA:A1W398"
FT                   /db_xref="InterPro:IPR032389"
FT                   /db_xref="UniProtKB/TrEMBL:A1W398"
FT                   /protein_id="ABM40723.1"
FT                   /translation="MSYILDALRRAQAERGRGSVPGLHTPASPVAVPTVQRAAPARGLP
FT                   WMVLAALAGVGAAAGAWWLVRAPSATVAAVVPAPAPAIPAPAAPAAAAPMAVPAHGAAP
FT                   APETAPASTPTPTLTPTPTPTPTPTPTPTPAPAPARAPAPASKPTPERSARAEAPAPRP
FT                   ERSAPAPAAPARAPAPRAAPPAPAPQESTGTVFAQADLPASVREQLPTLQLAGVTYSSN
FT                   PVYRMVIVNGQVLHEGDTAAPGLVLERIEPARTVWAFRGYRYALPTQ"
FT   gene            487961..488779
FT                   /locus_tag="Ajs_0473"
FT   CDS_pept        487961..488779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0473"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: regulatory
FT                   protein, Crp; KEGG: pol:Bpro_0605 transcriptional
FT                   regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40724"
FT                   /db_xref="GOA:A1W399"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W399"
FT                   /protein_id="ABM40724.1"
FT                   /translation="MLARMSQDASLHQRRRPPTAQELSGIPWMALLQPAERERAVAALA
FT                   VGDAQPGDYVCRVGRPVTYWFGVVEGLLKMSADNADGLTMTFTGVPPGGWFGEGTAVKR
FT                   EPYRYNIQALRRSVVAGLPIDTFHWLLDHSIGFNRFVMNQLNERLAQFIAAREIDRLNS
FT                   PDLRVARNLAALFNPVLYPGVGEVLRITQQELAYLVGLSRQRVNEALATLEAQGAIRVE
FT                   YGGLRVLDLQALRTSLFRRMEPADAGRHGPRRRASPRRAPADENEPAAMI"
FT   gene            488791..489873
FT                   /locus_tag="Ajs_0474"
FT   CDS_pept        488791..489873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0474"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; KEGG: pol:Bpro_0606 pseudouridine synthase, Rsu"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40725"
FT                   /db_xref="GOA:A1W3A0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3A0"
FT                   /protein_id="ABM40725.1"
FT                   /translation="MGRGAARSTARDNSAMPETPARPPAPSVPAPSASASPSPLRPRLV
FT                   LRKPTAPAAPVATGKAPGRSAGRTAGTAAPSGAAGAPRTASRHAPATPRPPATRAPAGA
FT                   AQAPADGRMRLNKRMADLGLCSRREADDWIAQGWVRVNGQVAAMGLQVGPHDRIDVDRA
FT                   AQGHQRQQVTILLHKPMGYVSGQAEDGHTPAVALINPRTHWKDDESRTRFSPAQLKGLA
FT                   PCGRLDIDSVGLLVLTQDGRVARQLIGEDSTVDKEYLVRVQYGDRAQDVRAVFPADKLA
FT                   LLNHGLALDGQQLKPAVVEWQNPEQLRFVLREGKKRQIRRMCELVGLKVVGLKRIRIGQ
FT                   VLLGKLPPGQWRYLAPGERF"
FT   gene            490220..492172
FT                   /locus_tag="Ajs_0475"
FT   CDS_pept        490220..492172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0475"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region,
FT                   ATPase domain protein domain protein; KEGG: rfr:Rfer_3551
FT                   heat shock protein HSP90"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40726"
FT                   /db_xref="GOA:A1W3A1"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W3A1"
FT                   /protein_id="ABM40726.1"
FT                   /translation="MSKHTHSFQAEVAQLLHLVTHSLYSNKEIFLRELVSNASDACDKL
FT                   RFEALNNAALYEDAPNLEVRVSFDKEARTLTITDNGIGMSEQEAIDHLGTIAKSGTRDF
FT                   MNRLSGDQKADAQLIGQFGVGFYSGFIVADRITVESRRAGLPASEGVRWASGGAGDFEV
FT                   EAIERAARGTSVILHLREDAEEFLNAWKIKQVIGKYSDHISLPILMEKEEWKESEKEGE
FT                   PGQMVKTGEWETVNKASALWTRPKKDITDEQYQDFYKSISHDFENPLTWSHNRVEGNTE
FT                   YTQLLYIPAKAPFDLWNRDKKAGVKLYVKRVFIMDDAESLMPSYLRFVKGVIDSADLPL
FT                   NVSRELLQESRDVRLIRDGSVKRVLSMLEDLAKHDKHEAAAEGADGVQDVVSAEDKAKE
FT                   GKYTQFYAEFGAVLKEGLGEDFANRERLAKLLRFASTTSDTPSVSFADYKARMKEGQEA
FT                   IYYITADTLAAAKNSPQLEVFKKKGIEVLLMTDRVDEWALNYLQDFDGTPLQSVAKGAV
FT                   DLGKLQDEAEKKAAEEAAEAFKPMLAKLKEALKDKAEDVRVTTRLVDSPACLVVQDGGM
FT                   STQLARLLKQAGQSAPDAKPVLEVNPEHALVKKLDGSVHFHDLAHILFDQALLAEGGLP
FT                   EDPAAYVKRVNALLA"
FT   gene            492376..493368
FT                   /locus_tag="Ajs_0476"
FT   CDS_pept        492376..493368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0476"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   reu:Reut_B4856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40727"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3A2"
FT                   /protein_id="ABM40727.1"
FT                   /translation="MGIKTSLVFSALVWGCSGLALAQNAAAPQDYPRRPITMVIPAAAG
FT                   GGTDVVGRVLADELGKRLGQPVVVDNKSGASGMLGANAVARAAPDGYTVLVSYSTPVFY
FT                   AHHMFSKVPYDIRKDFEFITQIAATSLVLMVNANVPVKNMKEFMAWAQQNKGKINYGSY
FT                   GTGSPGHLMSAYLSDSRKLEMTHVAYKSEAPHIQDLSAGVVSWGMGTLAAAQPQIKAER
FT                   LRPLAILGPRRLADLPDVPTMAEAGFPDPEFKTIAWFTMLAPAGTPKPILARLEKEAVQ
FT                   IIHSTAMKARLQVFGLEGVEGGAAQFRKDFEASNPIIDKLVKISGAKQD"
FT   sig_peptide     492376..492444
FT                   /locus_tag="Ajs_0476"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 23"
FT   gene            493585..494184
FT                   /locus_tag="Ajs_0477"
FT   CDS_pept        493585..494184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0477"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sru:SRU_0623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40728"
FT                   /db_xref="GOA:A1W3A3"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="InterPro:IPR026441"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3A3"
FT                   /protein_id="ABM40728.1"
FT                   /translation="MLRFFLLFLAIQLSLFGINMLNWVQQHLVLPWTALLARICAGLVT
FT                   WFDTTAAAQGKVLWNTLTGFGVSIEPGCNGIEACIVLFAAVIAFPSSLRHKLLGLVAGF
FT                   AAVQALNVVRVISLFYLGQWNTAVFNFAHEFLWQGLIMLDVLIVWLLWVRAGAKAQPPQ
FT                   ETPPPDEPPAPPMPLAMPRLDKGQGQVSTSLDLSPR"
FT   gene            494329..494880
FT                   /locus_tag="Ajs_0478"
FT   CDS_pept        494329..494880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40729"
FT                   /db_xref="GOA:A1W3A4"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3A4"
FT                   /protein_id="ABM40729.1"
FT                   /translation="MALLPCGMLSHVALEQAAPMWVRGVHQQLGRMEVDTAVEIAVPNS
FT                   GGRRAEVTLEADPGRYAYGLPIFAALLVAAWGAARAPGRASRAALGYVLLLPAQAFSLV
FT                   MYLLMQLAGAAQFDVRVLRVDQWQLEAIVYGYQVGVLVLPTLVPVLVWLWLDRQFFTDV
FT                   IVRGWKQSLAASPAPQRPAG"
FT   gene            complement(494887..495927)
FT                   /locus_tag="Ajs_0479"
FT   CDS_pept        complement(494887..495927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0479"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   rfr:Rfer_0576 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40730"
FT                   /db_xref="GOA:A1W3A5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3A5"
FT                   /protein_id="ABM40730.1"
FT                   /translation="MTAPHTDDTLHPYASLTPDLVLDALASVGLYGDGRLMALGSYENR
FT                   VYQATLEDGSRVVAKFYRPGRWSEAQILEEHAFSQELADAEVPVVAPLLLHGRSLHRHA
FT                   GFDFAVSPWRGGRTPELDDFEVLEWLGRYLARIHNVGAARPFAQRPALDLQTLGQEPRD
FT                   WLLGAQIIPLDQQTAWRDACEQALELIAAGACLSGATGQFGLKDASNIRLHGDCHPGNV
FT                   LWTPVDDAGHGGPHFVDLDDARMGPAVQDLWMLLSGERRQRTVQLSALLDGYEQLRPFD
FT                   RRELALIEPLRTLRLIHYSAWLARRWSDPIFPINFPWFGSSDYWRGQVDMLHEQIEAMQ
FT                   EPPLVA"
FT   gene            complement(495963..497402)
FT                   /locus_tag="Ajs_0480"
FT   CDS_pept        complement(495963..497402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0480"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; UspA domain protein; SMART:
FT                   tyrosine protein kinase; serine/threonine protein kinase;
FT                   KEGG: ade:Adeh_3699 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40731"
FT                   /db_xref="GOA:A1W3A6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3A6"
FT                   /protein_id="ABM40731.1"
FT                   /translation="MKLLTPGTEIDGFVVHECIHAGGMAHIYRVGYANASRDPGFPMAM
FT                   KIPRMTAGDGAENIVGFEVELTILPTLSGHHAPRFVAAGDLMRLPYLVMEYVQGDTLQH
FT                   WLDDRPPGDTAARSAETIARIGGAMALAAHSIHQQNVCHLDLKPANVLLRPDGSVVLLD
FT                   FGLSCHAHYPDLLAEEMRQAVGSPTWIAPEQVVGVRGDLRSDIFAIGVMLYEMATGELP
FT                   FGSPTTQGGMRQRLWMTPAPPRQYRPDLPEWLQEVILRCLEPEAAQRYPSAAHLAFDLA
FT                   NPDQVPITERGRRLRGPGVGAHFKRWIKAAGMHYQPSPLPARQIAEVPILMVAVPHDDV
FT                   TDATLYSLREAVARSLGIRPGARLAYVTVISPSASSTSDSTRSETMLHRTHLARLKQWA
FT                   AGLDLSRHSASYHVLEASDVAQALVRYAEGNRVSMMILGAATHGLQLQRFIDTVPIRVA
FT                   RDAPCTVILVKQQLPFDALGQ"
FT   gene            complement(497446..498204)
FT                   /locus_tag="Ajs_0481"
FT   CDS_pept        complement(497446..498204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0481"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ade:Adeh_3700
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40732"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3A7"
FT                   /protein_id="ABM40732.1"
FT                   /translation="MKIALLSDIHANLPAFDACLEHARAHGAQQFALLGDLVGYGADPG
FT                   PVLDRAMQLAAAGALCVRGNHDAAALAPPAVAQNLGDQSAQWTHPHLDERQRAFLAGLP
FT                   LTERLGPDALLVHASADGPERWHYITDSNAAERCMTAATRIDPAIRYVFCGHVHEQALY
FT                   FLTPTAKLMRFSPQPGVPVPVPPHRQWLAIAGSCGQPRDGDTRAMYALFDPDAATITFQ
FT                   RVAYNHAAAAAAVRASGLPTFFADRLERGR"
FT   gene            complement(498335..498751)
FT                   /locus_tag="Ajs_0482"
FT   CDS_pept        complement(498335..498751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0482"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: pfo:Pfl_2206
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40733"
FT                   /db_xref="GOA:A1W3A8"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3A8"
FT                   /protein_id="ABM40733.1"
FT                   /translation="MTTLDKVLYTARAHTTGGRDGASRSDDGRLQVQLSSPGGSGTGTN
FT                   PEQLFAAGYSACFIGAIKAVAAKQKLTLPQDLAIDAEVDLGTIPNAYGIAARLKVHLPG
FT                   MDRAQAQQLVNDAHQVCPYSNATRGNIDVTLTLA"
FT   gene            complement(498813..499268)
FT                   /locus_tag="Ajs_0483"
FT   CDS_pept        complement(498813..499268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0483"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: pol:Bpro_0623
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40734"
FT                   /db_xref="GOA:A1W3A9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3A9"
FT                   /protein_id="ABM40734.1"
FT                   /translation="MNYTPPSPPELLLDNQLCFALYSASLAMTKLYKPLLDTLGLTYPQ
FT                   YLVMLALWERDGLTVSELGERLFLDSGTLTPLLKRLEAAGLLVRLRDVQDERRVRITLT
FT                   GQGRALRDGAQPIPHCVLARTQCTPADIGALTAQLHALRDRLVQPQA"
FT   repeat_region   complement(499288..499618)
FT                   /rpt_unit_range=499288..499316
FT                   /note="CRISPRs"
FT   repeat_region   complement(499830..503884)
FT                   /rpt_unit_range=499830..499858
FT                   /note="CRISPRs"
FT   gene            complement(504022..504597)
FT                   /locus_tag="Ajs_0484"
FT   CDS_pept        complement(504022..504597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0484"
FT                   /product="CRISPR-associated protein, Csy4 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csy4 family;
FT                   KEGG: eca:ECA3684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40735"
FT                   /db_xref="GOA:A1W3B0"
FT                   /db_xref="InterPro:IPR013396"
FT                   /db_xref="InterPro:IPR042564"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3B0"
FT                   /protein_id="ABM40735.1"
FT                   /translation="MTTHYINITLLPDPEFSHAHLLGALVAKLHRALVQGHTTDIGVSY
FT                   PQHVSQPLTKRTLGAVLRLHGTPEALQRLMEEDWLKGMRDHTQVGELLPVPANAQHRTV
FT                   RRRQFKTNADRLRRRRMQRKGETAEQAAAAIPDTVERRPDLPFVQLRSSSTGQSFCLCV
FT                   EHGPLQPLPVAGAFNAYGLGHDATVPWF"
FT   gene            complement(504611..505636)
FT                   /locus_tag="Ajs_0485"
FT   CDS_pept        complement(504611..505636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0485"
FT                   /product="CRISPR-associated protein, Csy3 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csy3 family;
FT                   KEGG: cvi:CV1752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40736"
FT                   /db_xref="InterPro:IPR013399"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3B1"
FT                   /protein_id="ABM40736.1"
FT                   /translation="MTDKLTTASVLAFERKLDPSDAVFHAGRWDDRAQSHAWQPVTVRE
FT                   KSVRGTISNRLKAKDQDPAKLDAAIENPNLQTVDVAALPAEADTLKVQFTLRVLGGAGT
FT                   PSACNSAAYQAKLLATVQGYVQQHGFGELARRYAANLANGRFLWRNRAGAEQVEVTVEQ
FT                   MQNGQAAQIWSFDALALNTRAVGAINTEAKGLDELGQAMAAGLAGSQHVLLRITAFVRQ
FT                   GAGQEVFPSQELILDKDSAGKSKTLYHVDGVAAIHSQKIGNAIRTIDTWYEGAEELGPI
FT                   AVEPYGSVTTQGKAYRQPKQKLDFYTLLDNWLLKDQVPPVEQQHFVMAVLIRGGVFGDA
FT                   S"
FT   gene            complement(505693..506775)
FT                   /locus_tag="Ajs_0486"
FT   CDS_pept        complement(505693..506775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0486"
FT                   /product="CRISPR-associated protein, Csy2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csy2 family;
FT                   KEGG: cvi:CV1753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40737"
FT                   /db_xref="InterPro:IPR013398"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3B2"
FT                   /protein_id="ABM40737.1"
FT                   /translation="MSPQQTQAILVLPHLRIQNANAIGSPLTHGFPSITAFTGVMWALE
FT                   RKLAEAGVPLQLHGVGVVCHHHQEQVTQGYVRNFNLTRNPVDKDGSTAAIVEEGRMHLQ
FT                   ITLVLAVSEKRAPGTPAALVQSNQAKLDEWAAQAGHILAGMRVAGGSVLPSRPVPGKRV
FT                   RPWMAVVPEDPVAAEKEFRQWRRQWLPGFALVGRDDLLAQYLQALRTAQPDATLLDAWL
FT                   HAARFNYAPVVPDGEASAPDGQVKWEDPQRRKGSGWVVPIPVGYAALTPSHAPGTVRNA
FT                   RDASVPMRFVESVYALGEWISPHRLTHLAQLLWHAEANEAQGLYRCRNGYQPAQSEDAN
FT                   SNSNTETLDEWDDDEAYAYT"
FT   gene            complement(506772..508217)
FT                   /locus_tag="Ajs_0487"
FT   CDS_pept        complement(506772..508217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0487"
FT                   /product="CRISPR-associated protein, Csy1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csy1 family;
FT                   KEGG: cvi:CV1754 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40738"
FT                   /db_xref="InterPro:IPR013397"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3B3"
FT                   /protein_id="ABM40738.1"
FT                   /translation="MESHRETTERCQRIRLAMHEHVAHRLAHALRKLQGKDDAAAKQRR
FT                   IEAQEKYQLVHILERGVRTVEQIAVASHIAKGVHPDLPVKKTTNLAVDFSSLPMVDVVG
FT                   SHVLSKRDGLHDTTGNGSYNSAAYELYLLLECRVEGQKLIDLLRLEDPDATEAVNSSAQ
FT                   LDNAAALCIQLLEPKCTAVSANTLSKQIYWLTGPDASDDTHYTLLAPLYATSLAHAVHA
FT                   QVQEDRFGEANKAARQARRERKMHDGVFHDYPGLAVQNMGGTKPQNISQLNSERRGVNY
FT                   LLSSLPPQWQASAVRLPVHATSVFDRLFIARPEVRRTVRALRVFLESNPDANLATRDRR
FT                   EELLDALVDELVSLAAELQQMLPPGWSRDDQRFKELAYEEALWLDPLRAEIPEEAQFAH
FT                   DWQYMDWPAAIGKAFAGWLNAQLRDKLPVGDAEAREWKKVLLTDEDGFKQQLRELRNKL
FT                   DAPHYIPIRKTHAELVALREENP"
FT   gene            complement(508222..511758)
FT                   /locus_tag="Ajs_0488"
FT   CDS_pept        complement(508222..511758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0488"
FT                   /product="CRISPR-associated helicase, Cas3 family"
FT                   /note="TIGRFAM: CRISPR-associated helicase Cas3 family;
FT                   KEGG: cvi:CV1755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40739"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR013395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3B4"
FT                   /protein_id="ABM40739.1"
FT                   /translation="MNVLFVAQCTKRALTETRRILDQFAERRGERTWQTPITQAGLDTV
FT                   RKLLRQTARKNTAVACHWIRGRDHSELLWVVGDASQFNDQGAVPTNTTASSVLRAGDEN
FT                   AWHHLPLMTALAALAALLHDLGKATQAFQDRLQNPGLRERNHYRHEWVSVRLFQAFVGQ
FT                   DDDAGWLQRLAAYADADTDAQALEAAWLDHAGGRLLRDGLDEPQAKQHLPFARLPLLAQ
FT                   AVAWLVFSHHRLPCLPVEQAQGVDAEDMEDGRRTYRRFGARPGFINTGDLDDVLLRINA
FT                   DWNEPRESAAPSTVQAHWHFPHGLPVTQPAWRKQAARYARKLLELSQIAGQGAVLHDPF
FT                   AMHVARLCLMLADHHYSSLTDAAPRAPYLSPGYPLYANTRSNHYQNNSCSRLMDKRQSP
FT                   IFNQTLDEHLLGVQAHATLVARSLPSLTRSLPALKNHKPLKKRSADPRFAWQDKAADLA
FT                   ASVRARAAHQGAFIVNMASTGCGKTLGNARIMNALADPATGLRCAFAMGLRTLTLQTGR
FT                   VFQNDLQLSDEQLAIQVGGAASRALFEYWEQQAEATGSASSQALLDEAGTVLYEGNDQH
FT                   PLLQRLTDDAQARTLIAAPLLVCTVDHLTPATESLRGGRQIAPMLRLLTSDLVLDEPDD
FT                   FDMADLPALTRLVHWAGLLGSRVLLSSATLPPALVEGLFLAYRAGRAVYQRHRSERPSE
FT                   PVNICCLWVDEFRQTTQDCADGSAFREAHTQYVQKRVTKLQQAEVRRLAQIAPLPDTWH
FT                   GMQEAERRKDFARLMLEQAWQLHQQPHNHSTDADADDHTASGKRVSLGLIRMANIAPLY
FT                   DVALAMYAPDALPPALQGLVRIHLCVYHSQFPLLLRSAIEQQLDTLLNRRGAKDGHDPA
FT                   LHRPDLRALIDAHPEPHHLFIVLGSPVTEVGRDHDYDWAVVEPSSMRSLIQLAGRVRRH
FT                   RPGAIGGVNMVVLDSNLRHYKKPGQPAYEKPGFETAHAPFQLKSHYLHDLLAREMCQTT
FT                   AWAVDAQPRIALPADKLLPSRRWTDLEHARMHDSLLPKPQGTATPTRAACLQWHEPQPD
FT                   TPRSLWLTGLLPQFQRFRQDDQKRDDVALLPDEEEETLQLHRVQDGERRYDKLYVPIHQ
FT                   SLCHPVPAAQLVSPSVSPWPQLGLMEELAALAQARGLSLEQCAERYATASLPESQAGWR
FT                   WHEQLGFNRKEG"
FT   gene            complement(511755..512759)
FT                   /locus_tag="Ajs_0489"
FT   CDS_pept        complement(511755..512759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0489"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; KEGG:
FT                   cvi:CV1756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40740"
FT                   /db_xref="GOA:A1W3B5"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019857"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3B5"
FT                   /protein_id="ABM40740.1"
FT                   /translation="MEDIAAGDLKAILHSQRANIYYLEHCRVLVNGGRVEYVTDAGKRS
FT                   LYWNIPIANTTSILLGTGTSITQAAMRELAKAGVLVGFCGGGGTPLFAANEVDVEVAWL
FT                   TPQSEYRPTEYLQYWVKFWFDEELRLHAAKQLQTWRLQRLAAEWNSRSLREAGFSIDLG
FT                   RLQSLVQQFTPLISNAPDVTALLTDEARLTKALFRLAVEAVGYGEFTRAKRGTGTDAAN
FT                   RFLDHGNYLAYGLGATATWVLGLPHGLAVLHGKTRRGGLVFDAADLIKDAAILPQAFLS
FT                   AMRGDDEQQFRRQCIEALTRSESLDFIIDTLKHIASTTSRLADAPPPVREPNA"
FT   gene            complement(512795..513976)
FT                   /locus_tag="Ajs_0490"
FT   CDS_pept        complement(512795..513976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0490"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   pol:Bpro_4092 putative threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40741"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3B6"
FT                   /protein_id="ABM40741.1"
FT                   /translation="MRSTPEHLPEHLRATVGLRVDLIDTPALVVDLDAMERNIQRMAEF
FT                   AHKHQVRWRPHAKMHKSAEIALQLEWSGARGHCVQKVSEAEALAAGGVADLYISNEVLG
FT                   GAKLLRAARLAAQLAARGGRLGIAVDSAEGITRLAEAMRVAGSDAGIDVFVEIDVGQGR
FT                   CGVPPGPAALALAQAIAAQPRLHFAGLQAYHGSAQHLRSAAERRAAIAHAVQAAADTRT
FT                   LIEAAGLPVPLVTGSGTGTLVHEAASGVYGELQAGSFLFMDADYAANEREGAQPAFEHA
FT                   LFVKTQVISAQHTHVVCDAGHKSHAIDSGLPLVWGLPPERALRYANGGDEHGVLHAAGP
FT                   KARLPALGRMLWLVPGHCDPTVNLHDYLIGVRGGLAHGVVERVIRVDARGAVT"
FT   gene            complement(513960..514604)
FT                   /locus_tag="Ajs_0491"
FT   CDS_pept        complement(513960..514604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0491"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: rfr:Rfer_0816
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40742"
FT                   /db_xref="GOA:A1W3B7"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3B7"
FT                   /protein_id="ABM40742.1"
FT                   /translation="MHATRIIAIRHGETAWNVDTRIQGHLDIPLNDTGLWQARQVGQAL
FT                   ADEAVAAIYSSDLQRAYATAEAVARTTGAPLTPVPGLRERSFGSFQGRTFQQIETESPE
FT                   QALRWRKRDPHFVPDGGGESLDMLRERIAVTVDGIAARHAGEQIVLVAHGGVMDVLYRL
FT                   ATRLDLQAPRTWQLTNAAINRLLWTEGNGLTLVGWADTQHLENASRDEIHS"
FT   gene            complement(514627..515091)
FT                   /locus_tag="Ajs_0492"
FT   CDS_pept        complement(514627..515091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A2600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40743"
FT                   /db_xref="InterPro:IPR019637"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3B8"
FT                   /protein_id="ABM40743.1"
FT                   /translation="MRSSIRHLVLCACLGTASLVAQASGLGDTLRGATGGGASPSTLGG
FT                   MLGGGAAPSALSAMGLSGSATPSNAAGVITYCMKNNYLNADKAALVKQQLLGKMGLGAA
FT                   QPEPRDEGYLSGLSGMVSGSNGKQFNLNRLKGDLKEKACDFVLDNASSLL"
FT   sig_peptide     complement(515020..515091)
FT                   /locus_tag="Ajs_0492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 24"
FT   gene            complement(515118..515753)
FT                   /locus_tag="Ajs_0493"
FT   CDS_pept        complement(515118..515753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40744"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3B9"
FT                   /protein_id="ABM40744.1"
FT                   /translation="MPRGDTAMAFLRHIPALALCAAAALLAGCAGPRLVESDVSSFSTL
FT                   SALPSPPTYRFERLPSQQAQAAAFAPIEALAEQALARVGLRRDDTQPRLVAQIGAEGGY
FT                   ATPRYWPYAPDPFYGRFGWGLGYGGGWGFGGMGWMMDGPPTLYHRKVSLMLRDAASQQV
FT                   VYETSAVYEDVWTDDPAIYGVLFDQALTGFPRPPAGQRKVRTEITPQR"
FT   sig_peptide     complement(515646..515753)
FT                   /locus_tag="Ajs_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.560 at
FT                   residue 36"
FT   gene            complement(515798..516751)
FT                   /locus_tag="Ajs_0494"
FT   CDS_pept        complement(515798..516751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0494"
FT                   /product="tRNA s(2)C-32 sulfurtransferase"
FT                   /EC_number="2.8.1.4"
FT                   /note="PFAM: PP-loop domain protein; KEGG: pol:Bpro_4089
FT                   PP-loop"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40745"
FT                   /db_xref="GOA:A1W3C0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W3C0"
FT                   /protein_id="ABM40745.1"
FT                   /translation="MNTANNTLPTAADWAGEDAAPDAADTRKIERESHKLEKRLCREVG
FT                   RAITDFNMIEEGDKIMVCMSGGKDSYTLLDILRKLQKRAPVKFDIVAVNLDQKQPGFPE
FT                   HVLPDYFKSIGVQYHIENQDTYSVVKRVVPEGKTTCSLCSRLRRAILYKVADDLGCTKL
FT                   ALGHHRDDIVATLMLNMFYGGRMKGMPPKLVSDDGKHVVIRPLCYVPEKDTARWAQYQQ
FT                   FPIIPCNLCGSQDGLQRVAVNEMLREWDKKFPGRIESMLRAMGHVVTTHLMDPHLHDFK
FT                   NAKATGIADPNGDMAFDHEEFPVAPALPGLQVVQLG"
FT   gene            complement(516756..517127)
FT                   /locus_tag="Ajs_0495"
FT   CDS_pept        complement(516756..517127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0495"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG: pol:Bpro_4088
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40746"
FT                   /db_xref="GOA:A1W3C1"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3C1"
FT                   /protein_id="ABM40746.1"
FT                   /translation="MHTAAGTQILTLTGLRFDANLGILAHEKNAPQPIQVDAELNLGTQ
FT                   PLAPRDDDIQHVLDYRKVRQIIIDECTAEHVNLLESLIGKLANRLMQLPGVLGVRVKIA
FT                   KLEIFDDCEVAIRVETGQW"
FT   gene            complement(517145..517930)
FT                   /locus_tag="Ajs_0496"
FT   CDS_pept        complement(517145..517930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0496"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: pol:Bpro_4087 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40747"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3C2"
FT                   /protein_id="ABM40747.1"
FT                   /translation="MTSPARPRTVLVTGAARRLGRSIALALAAGGWQVAVHYRSSQQDA
FT                   LETVAACAELAGASAHFDADFADEAAARALLPRVVAHFGAVDAVVNSASLFEHDTASSF
FT                   SYALLEQHLRSNTGAPVLLAQALHAHLEQRAAAGEADVQGAVVNLLDQKLWNLNPDFLS
FT                   YTLSKAALEAAGTMLAMALAPRVRVVGVAPGLTLTSHLLTGERFERMHALSPLGRSSTP
FT                   EDVAAAVRFALDNRSLTGTTLLVDGGQHLMRFERDFSLM"
FT   gene            517949..519049
FT                   /locus_tag="Ajs_0497"
FT   CDS_pept        517949..519049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0497"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   pol:Bpro_4086 protein of unknown function DUF185"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40748"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3C3"
FT                   /protein_id="ABM40748.1"
FT                   /translation="MTSKPTILPSALQTHVAKAIAEAGGWIGFDRFMALALYTPGLGYY
FT                   AGDLPKFGAMPASGSDFVTAPELSPVFGRVLARQVREALDATATDEVWEFGAGSGALAA
FT                   QLLGALDDRVRRYTIVDLSGSLRARQQATLAAWGDRVHWVDRLPDQMQGVVVGNEVLDA
FT                   MPVQLLQRRAGLWHERGVALDESGNGFVWQDRPTPLRPPVEIDGPHDYLTEIHPQGEAF
FT                   MRTLAQHLVRGAAFLIDYGFGEDEYYHPQRHMGTLVCHRGHQVDSDPLADVGLKDITAH
FT                   VNFTAMALAAQDAGLQVLGYTTQAHFLINCGLLSELERLTQAQRAQAAKLMMEHEMGEL
FT                   FKVLAVGAGAPWRPLGFAQGDRSHRL"
FT   gene            519061..519441
FT                   /pseudo
FT                   /locus_tag="Ajs_0498"
FT   gene            519517..519711
FT                   /locus_tag="Ajs_0499"
FT   CDS_pept        519517..519711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40749"
FT                   /db_xref="GOA:A1W3C4"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3C4"
FT                   /protein_id="ABM40749.1"
FT                   /translation="MLRWLLVVFLALVLINGLTPWLRRLGLGRLPGDFQFRLFGRDWFI
FT                   PLASTVLLSFLLSLAVKWL"
FT   gene            519808..520818
FT                   /locus_tag="Ajs_0500"
FT   CDS_pept        519808..520818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0500"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="PFAM: ROK family protein; KEGG: pol:Bpro_4084
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40750"
FT                   /db_xref="GOA:A1W3C5"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3C5"
FT                   /protein_id="ABM40750.1"
FT                   /translation="MMGPMPQQSPTSQSPGLHAGVDIGGTKVAVCLADPANGSGPPVLL
FT                   TRVAEPTAKTGVPDALAQQVLRLLDAACTQQGITRSDLAGVGVASCGPFVRSAGMVEVV
FT                   NPNICGGLAGAPRGLGNDWTRVPLQAPLAQALGADRVHVANDAVAALQAERLWGALRGE
FT                   DDCAYVTWSTGIGVGLCVDGCVLRGKNGNAGHAGHSYVGDPDAGSDVALCGCGNQGDVE
FT                   SLVAGSALPRRLGREAPALMAAADAGDEAALAEVQALCVLMGRLLYNLVATLDLRRISL
FT                   GGAVFLHHQALLLPLLRAQLARYFPALTAGVELVPAGLGGQVGDYAALALLQQPG"
FT   gene            complement(520894..522312)
FT                   /locus_tag="Ajs_0501"
FT   CDS_pept        complement(520894..522312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0501"
FT                   /product="trehalose 6-phosphate synthase"
FT                   /EC_number="2.4.1.15"
FT                   /note="KEGG: reu:Reut_A0416 glycosyl transferase, family
FT                   20; TIGRFAM: alpha,alpha-trehalose-phosphate synthase
FT                   [UDP-forming]; PFAM: glycosyl transferase, family 20"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40751"
FT                   /db_xref="GOA:A1W3C6"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3C6"
FT                   /protein_id="ABM40751.1"
FT                   /translation="MSRLVVISNRLADPRKSAAGGLAVALGDALARTGGLWFGWSGTVT
FT                   ADGTPGEGALQTHQAGNVTLATVDLCQADHAAYYQGYANSVLWPVLHYRLDLADFSANY
FT                   SEGYRRVNQMFARKLLPLLREDDVIWVHDYHLIPLAAELRALGCRQRIGFFLHVPVPPP
FT                   LILAALPQHEWLMRSFFAYDLVGLQSEADVVHFTRYMVNEAHAQELDGQRLRAFNATVR
FT                   VAAFPIGIDVQEFQRLGRAPDAVHTCEALRAEYSRRQLLLGIDRLDYSKGIPHRVRAFR
FT                   QLLERYPENEHSATLVMIASPSRDDVHAYADLRQELEGLCGAINGDYGDLDWMPLRYIH
FT                   RTVARKRVPGLCRAARVGLVTPLRDGMNLVAKEYVVAQEPEDPGVLVLSRFAGAAEQLK
FT                   EALLVNPYDTQGMADAIQTALRMPLSERQWRHERLMERIQRQDVHWWRNSFLQALRDEA
FT                   APPVTAPAGAVAAT"
FT   gene            complement(522329..524149)
FT                   /locus_tag="Ajs_0502"
FT   CDS_pept        complement(522329..524149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0502"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   reu:Reut_A0415 glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40752"
FT                   /db_xref="GOA:A1W3C7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3C7"
FT                   /protein_id="ABM40752.1"
FT                   /translation="MTSKAPHVGATAMAAPSLALGMIGNCTISALVDARACIVWSCMPR
FT                   FDGDPVFNALVQPGPDGSRFAIELEDFASSEQWYEPNTAVLRTHLTDAHGNCLEVTDFC
FT                   PRFFARSRAFRPVMLVRRVRPVRGAPRIRVLVQPRYDWGMAQPALTRGSNHIRYVGGDF
FT                   TLRLNTDAPVAYVLSGEPFVAGREYNFLLGADETLSGGIGDTARHYEQETVSYWKHWTQ
FT                   RLHLPLQWQEAVIRSAITLKMSLFEDTGAIVAAMTTSIPESAHSGRNWDYRYCWLRDAF
FT                   FVVRALNSLSEVGTMEDYLRWLGNIVAKTGSGHIQPLYGIGLEHELPESVLPHLAGYRG
FT                   MGPVRVGNQAAEHFQHDVYGNIVLGAAQSFHDRRLLHPAGAAEFERLERVGELAVQVYG
FT                   KPDAGMWELRTRARIHTSSALMSWAACDRLAKIARALQLPERAHYWQQHAQRMHGEILE
FT                   RSWHAKRRVFAESFGGSELDASVLLMAEVGLIHPTDPRFVSTLDAMEHTLCDGPFMRRY
FT                   EAADDFGKPETAFNICTFWRIDALARTGRREQAQEIFEAMLAVRNPLGLLSEDTHAATG
FT                   EMWGNFPQTYSMVGIINAAMRLSAPWDSVI"
FT   sig_peptide     complement(524084..524149)
FT                   /locus_tag="Ajs_0502"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.406 at
FT                   residue 22"
FT   gene            complement(524146..524877)
FT                   /locus_tag="Ajs_0503"
FT   CDS_pept        complement(524146..524877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0503"
FT                   /product="trehalose 6-phosphatase"
FT                   /EC_number="3.1.3.12"
FT                   /note="KEGG: pol:Bpro_3915 HAD-superfamily hydrolase
FT                   subfamily IIB; TIGRFAM: HAD-superfamily hydrolase,
FT                   subfamily IIB; PFAM: trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40753"
FT                   /db_xref="GOA:A1W3C8"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3C8"
FT                   /protein_id="ABM40753.1"
FT                   /translation="MPTPPLPTSRHALFLDFDGTLADIAAQPHAVQLPPGVVDCLQALH
FT                   VRLEGALAIVTGRTMADIDHFLDPLRLPVACEHGAQYRLGNGRSGGLPALPLQPLLAAL
FT                   RPLMAQHPELLLEAKSAGLALHYRQAPQLQALCLQAITQALREVPGAELLHGKFVYEVK
FT                   PVGPDKGRAITDFMRLAPFAGRAPLFVGDDVTDEAGFAAAQSLGGLGIKVGEGATRAHA
FT                   RLATPAAVRQWLQHAVGEEIT"
FT   gene            525004..525441
FT                   /locus_tag="Ajs_0504"
FT   CDS_pept        525004..525441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0504"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; MJ0042 family finger-like
FT                   protein; PFAM: Thioredoxin domain; KEGG: pol:Bpro_3369
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40754"
FT                   /db_xref="GOA:A1W3C9"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3C9"
FT                   /protein_id="ABM40754.1"
FT                   /translation="MSSPEALHVVCPHCHTTNRVQAAQLGSAPDCGSCHRPLFTGEPLA
FT                   LDAASFDRHVARSHLPVVVDFWAPWCGPCRQMAPAFAQAARELEPRMRLAKLDTEAHPA
FT                   IAARYGIRSIPTMILFRGGQEAARISGALGAADIARWVQSV"
FT   gene            complement(525586..526863)
FT                   /locus_tag="Ajs_0505"
FT   CDS_pept        complement(525586..526863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0505"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase, HD sub domain; KEGG:
FT                   rfr:Rfer_1090 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40755"
FT                   /db_xref="GOA:A1W3D0"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W3D0"
FT                   /protein_id="ABM40755.1"
FT                   /translation="MQIYMVGGAVRDRLLGRPVNDHDWVVVGATPDDMVARGYLPVGRD
FT                   FPVFLHPETREEYALARTERKSGRGYRGFVVQTSPDVTLEEDLSRRDLTINAIAASAAW
FT                   TGAEDLFDPYGGARDLQARVLRHVTDSFREDPVRILRVARFAARFTDFTVAPETMQLMR
FT                   EMVHDGEADHLVPERVWQELARGLMEPQPSRMFDVLRDCGALAVVLPEVERLWGVPQRP
FT                   EYHPEVDTGVHLMMVLDMAAHLQAPLTVRFACLTHDLGKGTTPHDVLPRHIGHEQRSAR
FT                   LLKAVCERLRVPVECRELADVVAREHGNIHRSGDLGAAALVRLLERCDAIRKPARLDEI
FT                   LLACECDARGRLGFADRPYPQRARINAALAAVQSVTTSSVAAHAAQLGLSGPKVGEMIH
FT                   AARVQAVADWLHATAQPAPEPQGNAG"
FT   gene            complement(527175..527942)
FT                   /locus_tag="Ajs_0506"
FT   CDS_pept        complement(527175..527942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0506"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: rfr:Rfer_4142
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40756"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3D1"
FT                   /protein_id="ABM40756.1"
FT                   /translation="MKLHILSDLHLGVQGMEHPRTDADVVILAGDIARPAAAVAWAQGF
FT                   AKPVLYVPGNHEFYGSSLQDTAQELRRLREGSPVHLLDNRSLVLQGVRFIGSTLWSDFR
FT                   VAGDGAARTEAMAQAQQFMRDFSRIRAGGEDGGALFTPQHAAELFDANARWLARELAQP
FT                   FAGPTVVVTHHAPSPHSIHPRFAGSPINAAFVSDAQALVEGSGARLWVHGHTHDSFDYR
FT                   LHGTRVLCNPRGYAKDGQVENARFNPHLVVEVA"
FT   gene            complement(527960..528646)
FT                   /locus_tag="Ajs_0507"
FT   CDS_pept        complement(527960..528646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0507"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   KEGG: rfr:Rfer_1089 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40757"
FT                   /db_xref="GOA:A1W3D2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3D2"
FT                   /protein_id="ABM40757.1"
FT                   /translation="MLQLYIGNKNYSSWSMRPWVLLRQAGIAFEEVPVRFDSFDANSQF
FT                   KRQLKAVTPVAKVPVLVDGDITVWDSLAIAEYLAEQYPDKHLWPQDKAARARARSVVAE
FT                   MHSGFGALRSHCGMNIEARLPEVGEIVWRDQPAVRADVQRLVDMWSELLDQHGGPMLFG
FT                   QFSIADAFYAPVCMRLATFALPVPEHITPYVQRVQQLPGVKAWIDGALAEQDFVPFDEP
FT                   YRARRG"
FT   gene            complement(528776..529348)
FT                   /locus_tag="Ajs_0508"
FT   CDS_pept        complement(528776..529348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0508"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   rfr:Rfer_1087 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40758"
FT                   /db_xref="GOA:A1W3D3"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3D3"
FT                   /protein_id="ABM40758.1"
FT                   /translation="MDKAALRRALVEQRLNLPDRLQRADQLQRVMRIWLVDRPDTIIGA
FT                   YWPIKGEFDPLPALHRWKEDGELLDEPQLRRIGLPVVDKVHKTLTFHAWYPGCPMEEDA
FT                   YGIPKPKDTELIHPTLLFVPCVGYGPGGYRLGYGGGFYDRTLATLQPRPATVGLGFTHG
FT                   YLDDFEPEAHDLPLDAILNDNGVVWPV"
FT   gene            529372..531345
FT                   /locus_tag="Ajs_0509"
FT   CDS_pept        529372..531345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0509"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   pol:Bpro_0652 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40759"
FT                   /db_xref="GOA:A1W3D4"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3D4"
FT                   /protein_id="ABM40759.1"
FT                   /translation="MKILTPLIAGAALATAAPWAGAQNRGDDTVLEMQKAFRKGDKQRL
FT                   AALLPAARGHALEPWAAYWELRARLEEAQPSEVTAFLQRWAGTYQEDRLRNDWLLLLGQ
FT                   RRDWDQFAEFHPQFRMGDDREVHCYALAIEQIKGTAAESAGAEMLRHWYALRELDDGCS
FT                   SAAAEMLAAKKIKPLDVWRKARLGAEANRLRVVRKAVEIVAPDALPQLREALDSPTKYL
FT                   TGRATARGKERQELVVLALTRMAMSDVANAASLLDSKWGPHLSAEERNWLWGLIGKQAA
FT                   TALSPDALSYYANVGRDADLTDDMLAWRARAALRAGQWKLVGRSIDAMSPAARQESVWT
FT                   YWKARALMANRPGDEDRAAARQLYARIAGTTGFYEQLALEELGERVTLPPAPAPLTEEE
FT                   KATARANPGLNRALYAILMGLRSEGVREWNYTTNLHTPGGMGERELLAAADFACQREVW
FT                   DRCINTSERTKGVIDAAQRFPMPFRSAVVERARGIGLDPAYVYGLIRQESRFIMDARSG
FT                   VGASGLMQVMPATARWTARKIGLEGFSPQQLYDRDTNITIGTAYLKLALDDFDGSMPLA
FT                   AAAYNAGPGRPRNWRNGPVLDAAIWAENVPFSETRDYVKKVLANTVNYAAILTGQPQSL
FT                   KSRLGTVGPRDARAPEPNKDLP"
FT   sig_peptide     529372..529434
FT                   /locus_tag="Ajs_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.818 at
FT                   residue 21"
FT   gene            complement(531421..531993)
FT                   /locus_tag="Ajs_0510"
FT   CDS_pept        complement(531421..531993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0510"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: rsp:RSP_2807 putative
FT                   cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40760"
FT                   /db_xref="GOA:A1W3D5"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3D5"
FT                   /protein_id="ABM40760.1"
FT                   /translation="MSAFKTDGARAAGAPLRVWDRPVRLLHWGLAACVAMAWWSSDDTG
FT                   PLHERVGYVALALLAARVAWGFGGSRYARFAQFVRTPAATLAYARLALAGHAPRYLGHN
FT                   PLGAWMVLALLAIMALLGFTGWLYTTDRFWGYGWLAHLHQSLGWALLACVALHVGGVLW
FT                   TCLQHRENLVRAMVTGRKAPPRGDDVA"
FT   gene            complement(531974..532243)
FT                   /locus_tag="Ajs_0511"
FT   CDS_pept        complement(531974..532243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0511"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RSc2353 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40761"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3D6"
FT                   /protein_id="ABM40761.1"
FT                   /translation="MTSWIPHIAALALAVSASSAFAHGKVTCPEHPPAEWRPHTELEQK
FT                   LVKEGWTVRRMEKTETCYEVYGKDPQGKRVEAFFDPKTLERVQD"
FT   sig_peptide     complement(532175..532243)
FT                   /locus_tag="Ajs_0511"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 23"
FT   gene            complement(532302..533006)
FT                   /locus_tag="Ajs_0512"
FT   CDS_pept        complement(532302..533006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0512"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase, alpha subunit; KEGG: pat:Patl_2273
FT                   2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40762"
FT                   /db_xref="GOA:A1W3D7"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W3D7"
FT                   /protein_id="ABM40762.1"
FT                   /translation="MPHTATTMLISIDQVLSKTEVRDFRAQLDAAAWEDGAATAGTLAK
FT                   SVKRNQQITDGSELCQRLGQHILRRLSSTPLFISAALPRTIYPPKFNRYADGGTYGAHV
FT                   DSALMFLPGSHQQMRTDLSATLFLAEPEEYDGGELEVEGPFGVQAVKLAAGDMVLYPSS
FT                   SLHRVTPVTRGARVASFFWIESLVPDEGERTLLFDLDQSIQQLTPLVAPDDPRLVQLTG
FT                   VYHNLLRRWARP"
FT   gene            complement(532979..534076)
FT                   /locus_tag="Ajs_0513"
FT   CDS_pept        complement(532979..534076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0513"
FT                   /product="(S)-2-hydroxy-acid oxidase"
FT                   /EC_number="1.1.3.15"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: pat:Patl_2274 (S)-2-hydroxy-acid
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40763"
FT                   /db_xref="GOA:A1W3D8"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3D8"
FT                   /protein_id="ABM40763.1"
FT                   /translation="MTPHIPAGVWNAIDYERLAPQHMDAGRLAYVAGGCGWDRTVAANR
FT                   AAFTAWAIVPRLLRDVRGGHTRLTLGGLDLPHPLLLAPVAHQRLAHSEAEVATARAAQA
FT                   TGTCLVASTLSSCTLETIAGAAGPARWFQLYLQPEREHTLALLRRAEAAGYRAIVLTLD
FT                   ASIQLASRSALQAGFVMPADCTPANLAAYPPPAPPVLGADDSRIFQGAMRHAPTWDDLR
FT                   WLLGETRLPVWIKGVMHPDDARALQAAGAAGLIISNHGGRSLDGAPASLHRLPAVRAAV
FT                   GEGYPVLLDGGVRSGADAFKALALGADAVLIGRLQMYALAVAGALGVAHMLQLLTEELH
FT                   ACMAQAGCAQLCDITPNCLTPQPPC"
FT   gene            complement(534129..536435)
FT                   /locus_tag="Ajs_0514"
FT   CDS_pept        complement(534129..536435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0514"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: pat:Patl_2275 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40764"
FT                   /db_xref="GOA:A1W3D9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030148"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3D9"
FT                   /protein_id="ABM40764.1"
FT                   /translation="MPSSSPLKKPKSLRMAAALLPLSAIAQVQPTPAPVTTLPTVTVQE
FT                   QAIDPNPNAEVGAPYKAKTSADTRHTRPLAETPQTIQVVTGEAIRDSGATDLKQILAAQ
FT                   PGITLGTGENGNAFGDRYIIRGQEARSDVFVDGLRDPGMTTRESFAIEQVEVTKGPNSS
FT                   FAGRGSAGGAVNAVTKQATLDYDFTRVSAGVGTDSHHRVTLDMNKGFTDKFALRANALT
FT                   SGEDVPGRSPSQRRRDGLALSGLWELNQDLSVTLDYYGLRAKDKHPDLGGYLVGTVPNR
FT                   RPATGVPVYAQNSDFLNSDVDTVTARIAYRFAPDLKLTSLTRYGQSDNRYATTGASNGT
FT                   VLDAANNPIGTAGVLDGGHTGWQDVKYFAHQSNLRWDKQIGSLKHEFIFGFEYTDHKVK
FT                   SGNYGVTNTGATNCRVSGRNGPQAGWCITDLNGNPVSNLGDLAGRSYERRSWTRDWRVK
FT                   TFALSAMDTVDLTDQWTVFGGLRADHYDLSLDTRNNQTGAITGNYGFNDTLLNGHLGVS
FT                   YKINPMGMVYASYGTAQDINGGEPDTGTSSGYGGLVIHNGSAAGAKPETSQNIELGTKW
FT                   NLLDDKLLATAAVFQTTKDDVMEGANYDTEGTFNTGKNRVRGIELGLAGNLTKNFQLQA
FT                   GAAIMKSKVLRSAVASNVGNPLSNFADRSFTVQGKYQLTRDFSFGAVARYESSRCGGQP
FT                   DTGAGYTNGMCSQPVPSFSVYDLFASYRINKHADLRLNVLNVTDKDYYTAVYRSGAFLY
FT                   KGDGRAVRLTLNLDL"
FT   sig_peptide     complement(536355..536435)
FT                   /locus_tag="Ajs_0514"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.850 at
FT                   residue 27"
FT   gene            complement(536686..537612)
FT                   /locus_tag="Ajs_0515"
FT   CDS_pept        complement(536686..537612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0515"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pol:Bpro_4226 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40765"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3E0"
FT                   /protein_id="ABM40765.1"
FT                   /translation="MPLIPPALPPEIIVIERGWLSANNVLLLGRDSTALVDSGYCAHAP
FT                   QTVALVESALDGRVLDQLLNTHLHSDHCGGNAALQARWPQLATRIPPGQWAQVQDWDPV
FT                   ALSYVPTGQECPRFRADGVLPPGTEVQLGDRAWQVHAAPGHDTHAVVLFEPHARVLISG
FT                   DALWENGFGVVFPELDGEQAFAEVGATLDLIERLNPLTVIPGHGSVFGDVPAALARARR
FT                   RLAGFEADPVKHARHAAKVLLKYKLLEWQQAPLAQVHAWLAATPYFGLLHQRHFAQQTA
FT                   SVWAEQLMQELVDAGAARREGGALLNA"
FT   gene            complement(537647..539332)
FT                   /locus_tag="Ajs_0516"
FT   CDS_pept        complement(537647..539332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0516"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   pol:Bpro_4225 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40766"
FT                   /db_xref="GOA:A1W3E1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3E1"
FT                   /protein_id="ABM40766.1"
FT                   /translation="MERIWLKNYPAGVPHDVDADAYPSVAQMLEESFHRHADSPFSVCM
FT                   DRWMSYRELDRLSARLGAWLQGQGLAPGARVAIMLPNVPQFAVTMAAVLRAGYTCVNVN
FT                   PLYTARELEHQLKDSGASAIVILENFAHTLAEVIDHTAVQHVVIASMGDLLGAWYGRWI
FT                   TFAVRHLAKMVPAYELPLTGGRQVISFKRALALGERRTLTPARVAPDTPAFLQYTGGTT
FT                   GLSKGAVLTQRNIVAATLQAEAWFTPALGKIGDLSRANSIAALPLYHIFALTLCLLAIR
FT                   QGSRLTLIPNPRDIPKFVEVLKKRPFHMLPAVNTLFNALLQNPQFRHLDFSQLCVAQAG
FT                   GMAATEATAQQWKAVTGATMIEGWGMSETCAIGTNNPVNSTAFSGSIGLPLPGIDIAIK
FT                   DDAGASLPIGSAGEICIKGPNVMPGYYNQPEENAKAFTPDGFMRTGDIGVMDEEGYTRI
FT                   IDRKKDMILVSGFNVFPNELEQVVALCPGVLECAAVGVADDKQGEAIKVFVVRSDPSLT
FT                   EDDVVRYCHEHLTGYKRPKYIEFRDELPKTNVGKILRRELRDGK"
FT   gene            539473..540384
FT                   /locus_tag="Ajs_0517"
FT   CDS_pept        539473..540384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0517"
FT                   /product="PGAP1 family protein"
FT                   /note="PFAM: PGAP1 family protein; KEGG: pol:Bpro_4221
FT                   putative lipase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40767"
FT                   /db_xref="GOA:A1W3E2"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3E2"
FT                   /protein_id="ABM40767.1"
FT                   /translation="MTNARWQRWAVAVHLLLIAGWMAWFWGRSPALALAGVAAVPLMFR
FT                   LGMAPQFFLMAWVCRGDATPRPRAGQLLRAWWAESRWASLVFGWWQPFRHQAVADWLPP
FT                   RASDVPGPRGVVLVHGFLCNRGFWTPWLALLRARGHAFVAVTLEPAFGSIDDYCRTIDD
FT                   AVRSVAEATGRAPLIVGHSMGGLAARAWLRAVPGSEQRVHRIVTLGSPHHGTWPARGAR
FT                   STNGRQMRLHGPWVRQLGQDEPPARAAVFVCWYSNCDNVVYPPAAAMLQGADNRFIEGV
FT                   AHVEMAFHPRVLQDCLALLEQP"
FT   sig_peptide     539473..539574
FT                   /locus_tag="Ajs_0517"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.698 at
FT                   residue 34"
FT   gene            complement(540403..541242)
FT                   /locus_tag="Ajs_0518"
FT   CDS_pept        complement(540403..541242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0518"
FT                   /product="Phenylalanine 4-hydroxylase"
FT                   /EC_number="1.14.16.1"
FT                   /note="KEGG: pol:Bpro_4215 phenylalanine-4-hydroxylase,
FT                   monomeric form; TIGRFAM: phenylalanine-4-hydroxylase; PFAM:
FT                   aromatic amino acid hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40768"
FT                   /db_xref="GOA:A1W3E3"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3E3"
FT                   /protein_id="ABM40768.1"
FT                   /translation="MGQAPVVYGQSSRPPRGDYSRAQEDYTCAQNFAAYTAADHDTYHR
FT                   LYQRQSAQLQGLASEAFIQALPLLGAKERIPRFDDVNERLYRATRWELVAVPGLIPEVP
FT                   FFSLLANRKFPVTDWIRTPQEFDYIVEPDVFHDLFGHVPLLFNPVFADYVQRYGEGGLK
FT                   AAGLGACEMLSRLYWYTIEFGLIREQGGLRAYGAGILSSRGELPYAVHSPEPQRLPLEL
FT                   ERTMRTRYKIDTYQQTYFVIDSFEQLFELTAQDFAPIYERLRGQPEFAADAREPLPA"
FT   gene            complement(541328..542296)
FT                   /locus_tag="Ajs_0519"
FT   CDS_pept        complement(541328..542296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0519"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_3791 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40769"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3E4"
FT                   /protein_id="ABM40769.1"
FT                   /translation="MLRRRQLVGSLALCMACAVQAQNASAPMTIVVPYAAGGPLDKSAR
FT                   ILAEGAQAQLGPIQVQNKPGAGGNLGADTVAKAPKGGNLLVMGAVATHAVNPWLYKNFP
FT                   YNPVKDFTPIVLVARTPNVLVMSAERAKALDISTTTDLVKYMKAHPDQLKYGSGGNGSI
FT                   GHIAGEMFKSLTNTRMPHAPFQGAGPALKALQDGGVDIVFDNLASSLPLIQGGKLKALG
FT                   VTSLGSDDALPHVPSINSEVPGFNVSTWFGLFAPATLPAADAQKYATAFSKAMHSPAGK
FT                   AQFQKMGLTPEELTLGGFGSFVRSELGKYEFLIKAAKIHID"
FT   sig_peptide     complement(542231..542296)
FT                   /locus_tag="Ajs_0519"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.795 at
FT                   residue 22"
FT   gene            complement(542387..543505)
FT                   /locus_tag="Ajs_0520"
FT   CDS_pept        complement(542387..543505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0520"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="KEGG: reu:Reut_B4501 4-hydroxyphenylpyruvate
FT                   dioxygenase; TIGRFAM: 4-hydroxyphenylpyruvate dioxygenase;
FT                   PFAM: Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40770"
FT                   /db_xref="GOA:A1W3E5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3E5"
FT                   /protein_id="ABM40770.1"
FT                   /translation="MTAALPLRATHDADAWENPMGLMGFEFVEFTSPTPGLLEAVFEKL
FT                   GFTLVARHRSKDVLLYRQNQINFILNREPASQAAYFGAEHGPSACGLAFRVKDSHQAYR
FT                   RALELGAQPIEIPTGPMELRLPAIKGIGGAPLYLIDRFEDGKSIYDIDFDFLPGVDRRP
FT                   VGHGLNEIDHLTHNVYRGRMGFWANFYEKLFNFREIRYFDIQGEYTGLTSKAMTAPDGK
FT                   IRIPLNEEAKQGGGQIEEFLMQFNGEGIQHIALICDSLVEVVDKLGLAGVPLAPAPNDI
FT                   YYDMLDTRLPSHGQNVAELQARGILLDGTTADGTPRLLLQIFSTPMLGPVFFEFIERQG
FT                   NYREGFGEGNFKALFESLERDQIRRGVLQTQA"
FT   gene            543691..544176
FT                   /locus_tag="Ajs_0521"
FT   CDS_pept        543691..544176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0521"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   pol:Bpro_4212 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40771"
FT                   /db_xref="GOA:A1W3E6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3E6"
FT                   /protein_id="ABM40771.1"
FT                   /translation="MSERTPALDKLDRAILRRLQDNGRETYDVIGEQVGLSPSAVLRRA
FT                   KRLEEEGVIDRYVALVRPERVGLGLTAYLNVRLEKHTESHKRNPMDLFRASVQTWPEVV
FT                   ECASLTGEMDYLLRVVVADMAHYSRFIMDTLLKHPSVQDCKTSFVLDRVKATTALPV"
FT   gene            544408..545085
FT                   /locus_tag="Ajs_0522"
FT   CDS_pept        544408..545085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0522"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pol:Bpro_4211 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40772"
FT                   /db_xref="GOA:A1W3E7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3E7"
FT                   /protein_id="ABM40772.1"
FT                   /translation="MLRPTAEGRFHRGFAMNTVMVPIRSLGPQHRERIAAHLLRLEPRD
FT                   RYLRFGYAANDDQVRRYAELLDFSRDEVFGIFNRRLELIAMAHVAFAPSGEYESCAEFG
FT                   VSVSATARGRGYGARLFERAVMLARNRGVSMMFIHALTENTAMLKIARNAGATVRRDGS
FT                   ESEAYLQLPPARFDTRVSEIMAEHFGEVDYQLKKQARQFWRFLADLQEIRQGVRDGRHQ
FT                   AAE"
FT   gene            545137..546057
FT                   /locus_tag="Ajs_0523"
FT   CDS_pept        545137..546057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0523"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: rfr:Rfer_3698 CBS"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40773"
FT                   /db_xref="GOA:A1W3E8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3E8"
FT                   /protein_id="ABM40773.1"
FT                   /translation="MGADPLPAQPAPVPVSDPHPARASDKEDKRTFLQRLVEFINPGPD
FT                   STAELIATLAEAEDNDVINADARVMLERVLRMAEMTAGDVLVPAPRMDMLDIDAPVDEL
FT                   MHQVLHTAHSRFPVYQGERDNIIGILLAKDLLKLWRSPGLNVRTLVRPALFVPESKGLH
FT                   DLGREFRNTRNHMAIAIDEFGRIAGLVTFEDVIEQIVGEIEDEFDIPEDEGDIFGLADR
FT                   TFRVSGDTPVERVAEAFGVALQGSDPDESFDTIGGLIAHELGRMPRKGESVVLGGLQFV
FT                   VMHTKGGSVRWFKVAPAAATPESER"
FT   gene            546057..547655
FT                   /locus_tag="Ajs_0524"
FT   CDS_pept        546057..547655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0524"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: pol:Bpro_4208 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40774"
FT                   /db_xref="GOA:A1W3E9"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3E9"
FT                   /protein_id="ABM40774.1"
FT                   /translation="MAVAPPLAAHAPRRGPLPWVLALVAGLAQAASLAWPWGGQPLWWL
FT                   QILSLALWAHVLLGAGGTRRAGLLGWVFATAWLAGTFWWLFISMHTYGGLAAPLAVLAV
FT                   LGLAAFLGSYYAAVSACFWALAPVHRALAAIVFAALWLLAELARGQWWTGFPWGAGGYA
FT                   HVQGPLAALARSVGVYGIGAAAALLAMLLAQARRADLRNARAWALVLALTAVGAGAAWQ
FT                   RHCAVEGCGAPPPVHAPLSLALLQGNIPQDEKFQPGSGVPMALQWYYDQIHAAKASLVV
FT                   APETAIPLLPQQLVPGYLEGMAERYAAGGQALLLGIPLGSLEEGYTNSVLGFAPEQPQP
FT                   YRYDKHHLVPFGEFIPPFFRWFTEMMNIPLGDFNRGAVGQPSLAWAGERIAPNICYEDL
FT                   FGEEIGVRFLDPASSPTILVNLSNIGWFGNTVAVDQHLAISRLRALEFERPMVRATNTG
FT                   ATAVIDHRGQVTHRMPAYQRGVLRAQVQGRGGAATPYARWVARWGLWPLWALGFAVAGL
FT                   AWCLRGRTGRARAGN"
FT   sig_peptide     546057..546149
FT                   /locus_tag="Ajs_0524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.708) with cleavage site probability 0.661 at
FT                   residue 31"
FT   gene            547836..548360
FT                   /locus_tag="Ajs_0525"
FT   CDS_pept        547836..548360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0525"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.59"
FT                   /note="KEGG: xac:XAC3623 beta-hydroxydecanoyl-ACP
FT                   dehydratase; TIGRFAM:
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA;
FT                   PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase,
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40775"
FT                   /db_xref="GOA:A1W3F0"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3F0"
FT                   /protein_id="ABM40775.1"
FT                   /translation="MADSFSYEQLIASGEGRLFGPDSGRLPLPPMLMFDRITRIDTDGG
FT                   AHGLGKIVAELDVKPDLWFFACHFQGDPVMPGCLGLDAMWQLIGFYLTWLRLPGRGRAL
FT                   GAGEVKFTGEVGPDVKLVTYEIDLKRVIKRKLNMAIGDARLLADGKEIYVANDLRVGLF
FT                   LREGDAQGSAA"
FT   gene            548357..549580
FT                   /locus_tag="Ajs_0526"
FT   CDS_pept        548357..549580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0526"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: pen:PSEEN3623
FT                   beta-ketoacyl-ACP synthase I
FT                   (3-oxoacyl-[acyl-carrier-protein] synthase I)"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40776"
FT                   /db_xref="GOA:A1W3F1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3F1"
FT                   /protein_id="ABM40776.1"
FT                   /translation="MTKKRVVITGAGIVSCIGNDLQTVEEALRASRSGIKAVPQFTELG
FT                   LRSQVAGVPEIDVEARIDRKQLRFMGDAAAYAQIALEDAIQQAGLTPEQVSHPRTGLIM
FT                   GSGGGSPANQIEAADTLREKGIRRVGPYQVTRCMSSTVSACLATNFKVKGINYSITSAC
FT                   STSAHCIGAAAQQIAWGLQDVMFAGGGEELSWGMSLLFDGMGAMSSKYNATPEKASRAY
FT                   DANRDGFVIAGGGGAVVLESLEHALARGATILGEVVGFGATSDGEDMVAPSGDGAIACM
FT                   QQAMEGLGAPIDYINTHGTSTPVGDMQEVRAMQAVFGEAVPPFSSTKSLTGHSLGATGV
FT                   QEAIYCLIMLNKGFIAGSANVETPDPLLGSMPLVTQTRDAQLTHVLSNSFGFGGTNASL
FT                   VLRRWQGQ"
FT   gene            549687..550640
FT                   /locus_tag="Ajs_0527"
FT   CDS_pept        549687..550640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0527"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: glycyl-tRNA synthetase, alpha subunit; KEGG:
FT                   dar:Daro_3534 glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40777"
FT                   /db_xref="GOA:A1W3F2"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W3F2"
FT                   /protein_id="ABM40777.1"
FT                   /translation="MLTFQQIILKLQSYWADQGCALLQPYDMEVGAGTSHTATFLRALG
FT                   PEPWKAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPDNILELYLGSLEALGFDL
FT                   KKNDIRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPATGEITYGLE
FT                   RLAMYLQGVDNVYNLTWTEGPNGAKLTYGDVYHQNEVEQSTYNFEHSDAEFLFTAFGAH
FT                   EKQANHLMGEQLALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVAKAY
FT                   LDSRARLGFPMAPKAHADEVLAELAKAAEQQNKKAA"
FT   gene            550671..552833
FT                   /locus_tag="Ajs_0528"
FT   CDS_pept        550671..552833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0528"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: pol:Bpro_4202 glycine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40778"
FT                   /db_xref="GOA:A1W3F3"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W3F3"
FT                   /protein_id="ABM40778.1"
FT                   /translation="MNHQNLLVELFVEELPPKALQKLGDAFAGVLLEQLQAQGLTSAHS
FT                   QLTAFASPRRLAAHITEVLPAAADKAVSQKLMPVAVGLDASGQPTPALLKKLTALGADA
FT                   ASVPQLKRVHDGKAEVLFFESMAKGALLADGLQKALDEAIAKLPIPKVMRYQLQDGWTS
FT                   VHFVRPAHGLVALHGTQVLVGVQALGLTAGNTTHGHRFEASVDPVVIQSADSYAEQLRS
FT                   EGAVIASFAERRAEIARQLQAAADRVGGGVRPIEDAALLDEVTALVERPNVLVCEFEKE
FT                   FLAVPQECLILTMKANQKYFPLLDAEGKLTHQFLVVSNISPQDASAVIQGNERVVRPRL
FT                   ADAKFFFDQDRKKTLVSRVDQLAKVVYHNKLGTQGERVERVRHIAKAIATQLFTALAQG
FT                   NAALDSQEGEIAQDYLLTCVDNAALLAKTDLVTDMVGEFPELQGIMGGYYAVSDGLPDE
FT                   VAHAIEDHYKPRFAGDALPRENVGVVVALADKLETLVGMFGIGNLPTGDRDPFALRRHA
FT                   LGVIRMLVEKELPLDLDALLASAVPAFGDKIEDTSAQLADFIYDRLAGSLREQGYSAQE
FT                   VDAVIALRPQRLALVPRQLEAVRAFTQLEEAPALAAANKRVTNILKKAGEVDPHVNEEL
FT                   LQEPAEKDLYAALQRFVPEANAQFDSGDYTASLQTLAVLRAPVDAFFDDVMVNAEELAL
FT                   RLNRQGLLKKLHMAMNRVADLSRLAV"
FT   gene            552918..553493
FT                   /locus_tag="Ajs_0529"
FT   CDS_pept        552918..553493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0529"
FT                   /product="D-alpha,beta-D-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; KEGG:
FT                   pol:Bpro_4201 histidinol-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40779"
FT                   /db_xref="GOA:A1W3F4"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3F4"
FT                   /protein_id="ABM40779.1"
FT                   /translation="MKLAILDRDGTLNALGDGFIASPDEWVPVPGALEAVARLNHAGWH
FT                   VVVATNQPGLGRGLFDAQTLVAIHAKMHRQLATLGGRIDAVFYCPHTESEQCRCRKPAP
FT                   GLMEQIRDRYGAEGQEILVAGSSAAHLQAASELGAQLHMVCTGRSAHLDPRQSLPPGWP
FT                   AGTRAHASLGALADFIAPQNGASLPVAL"
FT   gene            553571..554320
FT                   /locus_tag="Ajs_0530"
FT   CDS_pept        553571..554320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0530"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   pol:Bpro_4200 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40780"
FT                   /db_xref="GOA:A1W3F5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3F5"
FT                   /protein_id="ABM40780.1"
FT                   /translation="MALIRSILHLLVMVVTVVPYTLGILLVRVLGGSPAARYRVARAWL
FT                   KLCIDSARWLLGIRTQITGMEHLPQGEQQGAVLLVKHQSTYETFLMPAIMPHPLAYVFK
FT                   KELLSVPFFGWSIGSLDMIHIDRGQRARAFAKVLQQGRRLLAKGTWVIMFPEGTRVERG
FT                   AKGEYKSGGTRLAIDAGVPVVPIAVTSATVWPRKAFIKRPGVVHVSVGRPIPTEGRKPD
FT                   ELMREVEAWIEGEMRRLDPDAYPPAAG"
FT   gene            554322..555242
FT                   /locus_tag="Ajs_0531"
FT   CDS_pept        554322..555242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0531"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   pol:Bpro_4199 protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40781"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3F6"
FT                   /protein_id="ABM40781.1"
FT                   /translation="MQRLVQLALDFLGGGSSPDSGVPQPKRAIAPVQQAPEASLLVAPA
FT                   PPLGDLLTPAVFRHPAASREVLLGDAVVAYALQRARRRSIGFTVGPDGLSVRAPSWVTL
FT                   AGVDAALRDKAPWILRKLGEQQARRQQEERARIVWGDGAVLPYLGEPLTVVLDPTHGFA
FT                   ARGGALEEQGGATGRALRIALARSAAPAQVRDAVQAWLMRDARRCFTERLHHFAPLLDV
FT                   RWTRLRLSSANTRWGSARADGSIRLNWRLMHYRPAIIDYVVAHELSHLRVMDHSPRFWD
FT                   TVATVVPDYAALRRSLREQPAPPWD"
FT   gene            555242..555721
FT                   /locus_tag="Ajs_0532"
FT   CDS_pept        555242..555721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0532"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="SMART: Rhodanese domain protein; KEGG: rfr:Rfer_3613
FT                   rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40782"
FT                   /db_xref="GOA:A1W3F7"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3F7"
FT                   /protein_id="ABM40782.1"
FT                   /translation="MGARRPWSARMAAMNTPTPDLHASEQPLPAEGYAGDVSPPLAWQW
FT                   VRAGQAVLVDVRTDAERDWVGFVPGAVAAAWKQWPGMQPNADFDAQLRAAVPPGGTAVL
FT                   LCRSGVRSVAAARRATELGITAYNILEGFEGEPDENGQRNRRSGWRFRGLPWRQG"
FT   gene            complement(555815..556303)
FT                   /locus_tag="Ajs_0533"
FT   CDS_pept        complement(555815..556303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0533"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM;
FT                   transport-associated; KEGG: eba:ebA3069 conserved
FT                   hypothetical protein, probably involved in cell wall
FT                   turnover"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40783"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3F8"
FT                   /protein_id="ABM40783.1"
FT                   /translation="MGLFSFIKEAGEKLFGGKDAQASTAAAPTQAELNDKAGKAIETYI
FT                   ASQNLGVSDVQVQFEGPEGKVTVKGTAPTQAAKEKVTLCCGNVASVTSVDNQMSVTNPE
FT                   PEAQYHDVVRGDTLSAIAKKFYGDANKYPVIFEANKPMLTHPDKIYPGQKLRIPPLAK"
FT   gene            556460..557236
FT                   /locus_tag="Ajs_0534"
FT   CDS_pept        556460..557236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0534"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: putative transcriptional activator, Baf
FT                   family; PFAM: Bordetella pertussis Bvg accessory factor;
FT                   KEGG: pol:Bpro_4044 putative transcriptional acitvator,
FT                   Baf"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40784"
FT                   /db_xref="GOA:A1W3F9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W3F9"
FT                   /protein_id="ABM40784.1"
FT                   /translation="MTFLAIDVGNTRLKWALFDAAQPGAGLLAHGAEFLDHIERLAEGP
FT                   WSHLPAPRHMLGCVVAGDAVKRRVAEQMELWDVPARWVVPSAQEAGVINGYDHPTRLGA
FT                   DRWVAMIGARHRLLAQGPARPLIVVMVGTAVTVEALDAEGRFLGGLILPGHGIMLRALE
FT                   SGTAGLHVPTGEVRLFPSNTSDALTSGGTYAIAGAVERMYQHLRQHCGQEPACMMTGGA
FT                   GWKMAPSMTRPFELVENLIFDGLLEIAARRFAELPA"
FT   gene            complement(557267..557920)
FT                   /locus_tag="Ajs_0535"
FT   CDS_pept        complement(557267..557920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0535"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: rfr:Rfer_3529
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40785"
FT                   /db_xref="GOA:A1W3G0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3G0"
FT                   /protein_id="ABM40785.1"
FT                   /translation="MAKKAPRRTAERILESSLALFNRFGEPNVSTTAIAADLHISAGNL
FT                   YYHYPAKDEIVNALFARYDEALSGLLHAGADVQDVEDAWFFMHTLFELIWQYRFFYRDL
FT                   NNLLSCNRRLEEQFPVLLQAKTAAMHDLLQALRRRGALQMEPADAMQPTATSMVVVLTY
FT                   WLSFEYVRAPRQALEPESAQAALLHGARHVLGLLMPYLEPTQRAHLARLVGAYD"
FT   gene            complement(558013..558486)
FT                   /locus_tag="Ajs_0536"
FT   CDS_pept        complement(558013..558486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0536"
FT                   /product="poly(hydroxyalkanoate) granule-associated
FT                   protein"
FT                   /note="TIGRFAM: poly(hydroxyalkanoate) granule-associated
FT                   protein; PFAM: poly granule associated family protein;
FT                   KEGG: pol:Bpro_4024 poly granule associated"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40786"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3G1"
FT                   /protein_id="ABM40786.1"
FT                   /translation="MPHVPPDDDTDPAREFPRMARESAQQIWLAGLGAFAKAQAEGGKV
FT                   FEALVREGMALQRKTHDTAQEHWGEAAQRMGQMASGLGERAAGQWDRLEGIFEERVSKA
FT                   LQRLGVPTAQEVQALHERIDALTQELQALQERQADRDGVTTAPPPSRPPTREG"
FT   gene            558675..559736
FT                   /locus_tag="Ajs_0537"
FT   CDS_pept        558675..559736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0537"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility C-terminal domain; KEGG: pol:Bpro_4022
FT                   dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40787"
FT                   /db_xref="GOA:A1W3G2"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3G2"
FT                   /protein_id="ABM40787.1"
FT                   /translation="MILVTGGAGFIGANFVLDWLAVGDEPVVNLDKLTYAGNLHNLDSL
FT                   QGDARHVFVQGDIGDRTLLDRLLAEHQPRAVINFAAESHVDRSIHGPEDFIQTNVVGTF
FT                   RLLEAARHYWQALPATQKEAFRFLHVSTDEVYGTLAPDAPAFTEEHNYEPNSPYSASKA
FT                   ASDHLVRAWHHTYGLPVLTTNCSNNYGPLHFPEKLIPLMIVNALAGKSLPVYGDGMQIR
FT                   DWLYVKDHCSAIRRVLQAGRLGETYNVGGWNEKPNIDIVNTVCALLDELRPRSDGQSYT
FT                   TQITYVTDRPGHDRRYAIDARKLERELGWKPAETFETGIRKTVQWYLDNPQWVQQVQSG
FT                   AYRDWVAKQYEAA"
FT   gene            559733..560611
FT                   /locus_tag="Ajs_0538"
FT   CDS_pept        559733..560611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0538"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: pol:Bpro_4021 dTDP-4-dehydrorhamnose
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40788"
FT                   /db_xref="GOA:A1W3G3"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3G3"
FT                   /protein_id="ABM40788.1"
FT                   /translation="MNILLLGKNGQVGWELQRSLSVLGPVTALGHDEADFTQPQAVAQA
FT                   VRALRPQVIVNAAAHTAVDKAESEPERARLLNAATPGVLAQEAERLGALLVHYSTDYVF
FT                   DGSGDTPWVETDAPAPLSVYGATKLEGERLIQQSGCRHLILRTSWVYAARGGNFAKTML
FT                   RLAQERERLTVIDDQWGAPTGADLLADVTAHAIRQLQRRPEDGGLYHCVAAGETTWHAY
FT                   AKYVLEHAAQVQAAIEIKAKEIAPVPTSAFPTPAARPHNSRLDTARLRDTFGLTLPSWQ
FT                   QGVARMLTEIL"
FT   gene            560620..561504
FT                   /locus_tag="Ajs_0539"
FT   CDS_pept        560620..561504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0539"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: pol:Bpro_4018
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40789"
FT                   /db_xref="GOA:A1W3G4"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3G4"
FT                   /protein_id="ABM40789.1"
FT                   /translation="MTTRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLM
FT                   LAGIRDILIISTPQDTPRFEQLLGDGSQWGLNLQYAVQPSPDGLAQAFLIGERFLNGAP
FT                   SALVLGDNIFYGHDFHELLANANARTEGASVFAYHVHDPERYGVAEFDAQGRVLSLEEK
FT                   PQAPKSNYAVTGLYFYDAQVVELAKGLQPSPRGELEITDLNRLYLEQGLLQVEIMGRGY
FT                   AWLDTGTHESLLEAGQFIATLENRQGLKIACPEEIAWRHRWVDAAQLERLAQPLTKNGY
FT                   GKYLMRILNEKIY"
FT   gene            561512..562060
FT                   /locus_tag="Ajs_0540"
FT   CDS_pept        561512..562060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0540"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: rme:Rmet_2732 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; TIGRFAM: dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 3,5-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40790"
FT                   /db_xref="GOA:A1W3G5"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3G5"
FT                   /protein_id="ABM40790.1"
FT                   /translation="MQATRLAIPDVVLIEPKVFGDARGFFFESFNQRAFNEVTGTNHHF
FT                   VQDNHSRSTKGVLRGLHYQIQQPQGKLVRVVQGAVFDVAVDIRKSSATFGQWVGVELSA
FT                   ENHRQLWVPPGFAHGFVVLSDTADFLYKTTDYYAPQYERCIAWNDPTLAIAWPDLGMRP
FT                   TLSAKDGAGKLLQQAELPA"
FT   gene            562152..563054
FT                   /locus_tag="Ajs_0541"
FT   CDS_pept        562152..563054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0541"
FT                   /product="rhamnosyltransferase"
FT                   /note="TIGRFAM: rhamnosyltransferase; PFAM: glycosyl
FT                   transferase, family 2; KEGG: noc:Noc_2177
FT                   rhamnosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40791"
FT                   /db_xref="GOA:A1W3G6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR006446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3G6"
FT                   /protein_id="ABM40791.1"
FT                   /translation="MACMSKIIAVVVAYRPNLEKLHEQFAALLPQVHSIVVVDNSPGAE
FT                   VLDWAGKWPACQVHCIALGQNMGIAHAQNRGIEWARSMGGSHVLLMDHDSIPAQNMVAQ
FT                   LLRALEAWPHAGAVGPHYTDARRGKNKSPFVRTVGLRRIWLNCFDGGEAVEVDHLIASG
FT                   CLIPMGVLDHVGAMREDFFIDFVDVEWCLRARHAGYRMYGVCAAHLEHQLGDKPVRFLG
FT                   REYLSHSPLRHYFHARNAMLLYREPWVPLNWKLVSAWRLLLKMGFHVLVTAPRLRHLEK
FT                   ITRGLLHGLMGRAGGIAER"
FT   gene            563100..566051
FT                   /locus_tag="Ajs_0542"
FT   CDS_pept        563100..566051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0542"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   xac:XAC3598 truncated O-antigen biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40792"
FT                   /db_xref="GOA:A1W3G7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3G7"
FT                   /protein_id="ABM40792.1"
FT                   /translation="MTAISPEDADSVALVTVILPAYNHAKYVVEAMDSVRAQTFTRWEL
FT                   IVIDDGSTDDTWAVLQAYAAQHGDPRIRLLTQANAGSHATLNRGLAMARTPYLAILNSD
FT                   DRYAPERLQRLVDTAQAAADEVFIVTGLRLIDGDGNFFPESYWWNAMYGDILQRWRAAQ
FT                   SSGVNPALQTLLWGNFTVSTSNFFMSRTLWQRLGPFKRLRYVPDWDYALRVAMEQPRAF
FT                   QFLHDQALLEYRLHGRNTILGGALRNHAEAYHVLRTYQKKWAAAGQALPEHALDRLHYL
FT                   ARFIRHEHARQQLERQKLGWLEQVIRHEHARQQLERQKLGWLEQVIRHEHARQQLERQK
FT                   LGWLEQVDALRLELDSARTAAAQWQATAQGMQASRSWRLTVPLRKLAQVLRACRTGPRA
FT                   VVRKLAARWRRAQSGGVKTAYGQWLKAEASQLQGLHARAGMLINELPRRPLISIVMPVH
FT                   DTPPHFLQAAVDSVQGQWYGHWELCICDDASSRADTRQRLQTLQDQSDKIKVTRRETAG
FT                   HIVHATNDALALAQGEFVVFLDHDDVLAPQALLRLAQAINAPSAPDFIYSDEDKLDEQG
FT                   RRCLPLFKPQWSPTLQWAQNYVGHIMCVRRAWLERLGGLLEGSQGSQDHDLVLRLAAQG
FT                   AKIEHIPEVLYHWRIHAASTSASPQSKPYAHLAGRQAVARHLASRYGEQFDRVDDGDHA
FT                   FVYQPRFRVPAGTVASIIIPTRDKADLLDACIQSIHRHTTGIAYEILVLDNGSTEPETQ
FT                   ACFQRLTQDARVRVIAADIPFNWSRLNNIGRSHARGQVLVFLNNDTEIITPDWLVRLVE
FT                   YALLPDVATVGALLLYPDRTIQHAGVVVGMGGWADHVFKGEPVQHYPTPFVSSVVPRNV
FT                   LANTGACVAVATARFDALGGFDEAFEICGSDVELGIRAHKQGLLNVYLPAARLLHLESK
FT                   TRSPHVPEVDFQQSALKYAPYRLEGDPFYNPNLDLSASTPRPRVPGGHVPGAQ"
FT   gene            566136..567431
FT                   /locus_tag="Ajs_0543"
FT   CDS_pept        566136..567431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nar:Saro_3231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40793"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3G8"
FT                   /protein_id="ABM40793.1"
FT                   /translation="MRSGLQKLAVAYRQQQAMSTASPNHDIAEVLPIDPRPAVAQGGTR
FT                   LNLMVPAVSQRHVFGGIETALQVFDALRPYFDQARIIVTDEATPEPRSDAYYGAWPIVP
FT                   MASESPPCDHIVAAGSRWGQTLAVHAQDHFMATAWWTAHNAFALLNWQRAQVPEASARR
FT                   LLYLIQDYEPGFYPWSSRYLLAQATYEQPGRTIALMNSHWLADYLAAQGYAFPVKEVLQ
FT                   PRLHPALAAARARCETFAKERILLVYGRPGTERNAFSLIVASLRLWARHYPQARQWRIL
FT                   SAGEAFAPIDLGSGCTLHSVGKLSIEAYADLLCRTAVGFSLMVSPHPSYPPLEMAAFGA
FT                   RVVVNRFANKDLSGVSPLLVSASPPNPEGFSAALRTLTQAFDHGETSCMPANASEMVWQ
FT                   GGFLDSCGPGFAWAADVAAKLLGDAPAIPATV"
FT   gene            567445..568287
FT                   /locus_tag="Ajs_0544"
FT   CDS_pept        567445..568287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0544"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG:
FT                   bur:Bcep18194_A3980 ABC polysaccharide/polyol phosphate
FT                   export pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40794"
FT                   /db_xref="GOA:A1W3G9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3G9"
FT                   /protein_id="ABM40794.1"
FT                   /translation="MNTHSSSIGLRPSSSPLQLLRSLWHHRFLLRQLVRRDVASRYRGS
FT                   LMGLLWSLLLPCVMLAVYVFVFGYVFTPVRKVGDGALSPAFALSLFAGMLLHGMLGECL
FT                   SRAPAAVLAQPSYVKKVVFPMELLPLAVVGTAVVQFLIGSAVLLLALVLTQGLPATAWL
FT                   WPLAWLPLVALVAGIALMLAALTVYLRDLAQLTGFVATLLLFLSPVFYPLESLPPNWQH
FT                   WLLLNPLTVPIEATRSLLVHGQGLNWAHWSAHAAGCLATLWAGWWIFQRARKGFADVI"
FT   gene            568277..570727
FT                   /locus_tag="Ajs_0545"
FT   CDS_pept        568277..570727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0545"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mes:Meso_3694 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40795"
FT                   /db_xref="GOA:A1W3H0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3H0"
FT                   /protein_id="ABM40795.1"
FT                   /translation="MSSEIPSGGWAIRAQGLGKTYRLYDKPHHRLLQSLWRGRKNYFRE
FT                   FAALSDVSFELARGQTLGIIGRNGAGKSTLLQIICGTLTPSAGQVQVNGRIAALLELGT
FT                   GFNPEFTGRENIVINAAILGLSQREIAERLDDIIAFADIGPFIDQPVKTYSSGMYVRLA
FT                   FAVVVHVNPDILIVDEALAVGDALFQAKCMTRMRRMLDDGLTLLFISHDIAAVKALCQR
FT                   ALWLDHGRVRALGATPEVTRDYDHDWIRQANAAHDLPTDAPAAAAASDAEALLPSGVGT
FT                   GAVALLAVGWGVAGMFGTEARAQHGDTLHLRLRLQLRQPCRHLVVSYHIKNRQNQHILG
FT                   GHSSDRPEVHGRAWQSGEVLELAFDIPVHLHQGDYALTVLAASMADVAHYTDAVFHLWA
FT                   DDVATLHVMPRAHFPLSDLIEPPQDLSVIPHAPWLVLDDFFPNLLTGFRVAEYNAHLAA
FT                   FPQLSVLSSLGDFASQHARYAEHYPALAHRVRPFAPAWLAGAGLAFLNFLNNAHQFLPA
FT                   LQQYRVPFVLTLYPGGGFGLDEPESDAKLAAVLACPLLQALIVTQGVTQDYVQRFAAGR
FT                   GLALPPLHRIDGVVVNPLYLEVEAPARDAMADKAVLDICFVAERYMPQGANKGYPAFIA
FT                   AALALADCARLRWHIVGGGFTPEEIDVSALGDRIQFHGRLTTQDLRQFYARMDLIVSPN
FT                   QPYLLHPGNFDGFPTGCCVEAALCGVAVMATDALQQNPGYVDGESMLMLDAASEVSLAQ
FT                   QIEIRIRQILADPAVLTRIGQAGQVFTRELYAPERQIGERQRILRSVAQRLGLPVPMEE
FT                   NPLP"
FT   gene            570724..571374
FT                   /locus_tag="Ajs_0546"
FT   CDS_pept        570724..571374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0546"
FT                   /product="conserved hypothetical protein; putative
FT                   acetyltransferases (isoleucine patch superfamily)"
FT                   /note="KEGG: fal:FRAAL5663 hypothetical protein; putative
FT                   acetyltransferases (isoleucine patch superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40796"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3H1"
FT                   /protein_id="ABM40796.1"
FT                   /translation="MTPLILFGAGGHAREVAQLVRDINQAQPGSWQLLGFMADPGAAPG
FT                   NPMPLPAPWLGDSQQALAAHPGAHCIVAVGDSRARRRIAAQLRQQHPGLRFATLVHPRA
FT                   WLAEGVHLGPGSVVFAGACINVDVTIGRHASINLACTISHDCVLGEYVSLGPGVHLPGG
FT                   VTLGEAVDVGTGACFRPRVSVGANAVIGAGAAVVHDLPGNCVAVGAPARPTRP"
FT   gene            571414..572862
FT                   /locus_tag="Ajs_0547"
FT   CDS_pept        571414..572862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0547"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: nfa:nfa2110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40797"
FT                   /db_xref="GOA:A1W3H2"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3H2"
FT                   /protein_id="ABM40797.1"
FT                   /translation="MAFHANGSVHPEPGQPFANGGHAFRYSRRLLGAMAVLAVCVGMAM
FT                   CFLSPALNAPDEVYHWQRAVQVSHGQFLADRREEQDYGGEIDVAALEFARWANSHFERS
FT                   SAFSLSQARQVSAALADNEGMARASFPSSASFSPLAYLPQASGIAVARHLGGGVFEQMI
FT                   AGRMANLLAYVALMAAAAWVAPCGRRLVVMLALTAPALYLAASVSADPLNFALPALLFA
FT                   WCLRLRFDDSARLSRRGRLGLGLMLVSLSLLKPIYLLLAGMALLVPARHFGGRRGRGFF
FT                   LLAAIGAGLVLTLAWNAVYPFMPGRYWGTDAAPKAVLLSIVHAPLAGLEYFVHSLLHQL
FT                   PVMWLDGWGRMGGYPPPFMTNAPRALSWAGLATMLAIAASDGHQPRDLRASAFMVALAA
FT                   LFTGVIFLAFWLSFSPSNAAVIQGVQGRYFQLVFLLIGWALVCAAPFGKVFQRWRAPLL
FT                   ILGLVLQTVSLLQGMGEFRFYWAS"
FT   gene            572939..574018
FT                   /locus_tag="Ajs_0548"
FT   CDS_pept        572939..574018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0548"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bxe:Bxe_A3516 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40798"
FT                   /db_xref="GOA:A1W222"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A1W222"
FT                   /protein_id="ABM40798.1"
FT                   /translation="MAHPGRPATKLQITDAERAELHARLRVRKAPEDEKLRMRIVLGCA
FT                   DGESGTMIAQRLGTTVQTVSKWRRRYRAYRLAGLTDAPRAGRPRSVGDEQVQLIVDKVR
FT                   QSKPDNATHWSVRQMSRHAGVSPATVQRIWHAFGLKPHLQETFKLSTDPHFVDKVRDVV
FT                   GLYMAPPDRALVLCVDEKSQIQALDRTQPGLPLTFGKPSTRTHDYKRHGTTSLFAALDV
FT                   ATGKVIGQLKRRHRSVEFLQFLKAIDAAVPGEQDIHLIMDNYGTHKTQAVRAWLAAHPR
FT                   YHVHFTPTSASWLNLVERFFSQISEQWIKRSAHTSVAQLEQSIREYIDRHNEDPKPFVW
FT                   HKSADTILASVARAASTII"
FT   gene            574053..575018
FT                   /locus_tag="Ajs_0549"
FT   CDS_pept        574053..575018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0549"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   zmo:ZMO0947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40799"
FT                   /db_xref="GOA:A1W3H4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3H4"
FT                   /protein_id="ABM40799.1"
FT                   /translation="MNNKLRLAVLIPCFNEEVAIGTVVRDFQRVLPQATIYVFDNNSRD
FT                   NTVAIARSLGAVVRHVPLQGKGNVMRRMFADVEADIYVLVDGDATYHAESSPQMIDLLL
FT                   AEGLDMVVGRRESIEEYSYRLGHRLGNRMLTGFVARLFGRRFTDMLSGYRVFSRRYVKS
FT                   FPALARGFETETELTVHALELRMPVAEVDTPYKARPEGSFSKLNTIRDGLRILNTIVRL
FT                   FRLERPLLFFSLISALLALLAVALAVPLAVTYVETGLVPRLPTAVLASGLGLLSSLSLT
FT                   CGLILENVTHTRQEARRLIYLGIPCSGLPGTVGASVGSQD"
FT   gene            575015..575398
FT                   /locus_tag="Ajs_0550"
FT   CDS_pept        575015..575398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0550"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: ret:RHE_CH00273
FT                   hypothetical conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40800"
FT                   /db_xref="GOA:A1W3H5"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3H5"
FT                   /protein_id="ABM40800.1"
FT                   /translation="MTGRLLRFGLVGTAGFVVDAGLLQTMVQWGGVNPFLARLGSFMAA
FT                   ATATWWLNRCFTFRVGSQASAGEWMRYVTTMVLGGLVNYGAYAALLLWLPLAMRQPWLG
FT                   VAFGSLAGMAVNYYTSSRFVFAR"
FT   gene            575681..576832
FT                   /locus_tag="Ajs_0551"
FT   CDS_pept        575681..576832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0551"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   bth:BT3376 nucleotide sugar transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40801"
FT                   /db_xref="GOA:A1W3H6"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3H6"
FT                   /protein_id="ABM40801.1"
FT                   /translation="MLTPHASTPVPFAQPIYVTRPMLPPLSEYTALLQEVWDSGWLANG
FT                   GEQHRALEAELVQWLRVPHLSLFNNGTIALVVACQALRLAGEVITTPFTFPATPHVLRW
FT                   NNITPVFADIDPETLCIDPAGVESRVTPSTTGILGVHVYGVPCDVHALDGIARSHGLRV
FT                   VYDGAHAFGTQIDGQTIASFGDATMLSFHATKLFHTAEGGALAVNDPELKQRIDLLKNF
FT                   GIKNEEEVVMPGINGKMSELQAALGRVVLRHVGQERQRRAAVRQLYEQRLAGIEGLRLH
FT                   AMPAGVTNSLQYLVLRVNAEQAGCSRDTLHERLKRYNIITRKYFHPLCSEYSCYRQLPS
FT                   ASPQQLPNAYRVASEVLALPLYGALSGDDVHRICDTIVHSLRA"
FT   gene            577232..579193
FT                   /locus_tag="Ajs_0552"
FT   CDS_pept        577232..579193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0552"
FT                   /product="TonB-dependent receptor, plug"
FT                   /note="PFAM: TonB-dependent receptor, plug; KEGG:
FT                   rfr:Rfer_2036 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40802"
FT                   /db_xref="GOA:A1W3H7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3H7"
FT                   /protein_id="ABM40802.1"
FT                   /translation="MSRRSLPAGCACIVLSTGVTLAAQADELGYELSERDYLSEIPHIY
FT                   SASRLPQQLEDAAGALTVLDREFIRLTGARELTEVFRWVPGFQVATSAGGRPVVAYHGL
FT                   SGQISQRMQVYVDGRSVYAPYLFGGVDWSALSVPLDEIERIEIQRGSNSVTYGANAFLG
FT                   VIHIVTRAAAQSVGVRAEVVQGSAGVADRHIRWGHAQPAAQWRIAAGQRSDDGLAGRPD
FT                   GYRTNYLDLRAEFQPSSTQEWSITSGITRSHLGSGFEKRVGDPPRTEIAESASLQARYR
FT                   QTVDPGQEWSVTMSSTQDSGDDSFDIPLLDKGSLHIDGRRRANRYALDYQHFKDLSPQW
FT                   RASWGLGYRQDSVTAFQLFNSGAPQTNASWLGFLNAEWRPSTHWTLNFGSLVERDRLAP
FT                   TQWAPRLAINWKPLAAHTFKLGYSSAFRTPSIFEQRADWRIQNEGNTLDIRYLSSGGLL
FT                   PERVNAWDLVYLGQWREQGLTLDARLFQEKLSRIVTGRLTLLPMGATFAPNAAAYDLRN
FT                   NASAINRGVEYQLSWRPAGGTIVSWNQYFARPQASPAVIAQTIARRSTGLLVSHAWPRG
FT                   WTTGLGYTSMSSMRWLGEPTQVGAQRFASLRVARSLRVNGSHVHVAVRWFQPLGQSDEF
FT                   RELQRERRKLWLAVSLEY"
FT   sig_peptide     577232..577309
FT                   /locus_tag="Ajs_0552"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.780 at
FT                   residue 26"
FT   gene            579205..580149
FT                   /locus_tag="Ajs_0553"
FT   CDS_pept        579205..580149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40803"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3H8"
FT                   /protein_id="ABM40803.1"
FT                   /translation="MARAIVRALLRHILGAAGLLLCLGVQANTLGIVTSGQGAAYDEFV
FT                   EAVRQELKSVPGLKIQLVGLDAEASALPLPGDTFMVLAVGLQATRRTVALAPADARWPL
FT                   LSVMVPRASFEALNPPPRNARRLSAIYIDQPPQRQVELIRALLPGARNVGLVVGPTHQR
FT                   DLDAIRALATAKGLALVTEKAARDTELYPALQSVLRSSDVLLALPDPYVINVSTAQNLL
FT                   LTAFRFRVPVIGYSAAYVRAGALAAAYSTPRQIGQEAAQVARQLWRGGALPTPRYPRNF
FT                   SIAINRPLAESLGLNLPDEAAVQQRLQALESSE"
FT   sig_peptide     579205..579288
FT                   /locus_tag="Ajs_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.992 at
FT                   residue 28"
FT   gene            580146..582173
FT                   /locus_tag="Ajs_0554"
FT   CDS_pept        580146..582173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0554"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase, HAMP region domain protein; histidine kinase A
FT                   domain protein domain protein; KEGG: rfr:Rfer_2038
FT                   periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40804"
FT                   /db_xref="GOA:A1W3H9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR019247"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3H9"
FT                   /protein_id="ABM40804.1"
FT                   /translation="MTPGRIAARLLHPLAWHRMDLRGRLMWLAMLPVLVFAVVWGSYVI
FT                   RQRDADLAAQLQQRAQLLARQLAVAADYGIFSFNQAALDNIALGVLRESSVISATIIAA
FT                   DGRVLATRHAPAQGQAIPPGQLQAMLEASRRGGGGGVSEHNAHWVAHLEPVRTPLLDVD
FT                   DLPEAAHPQRHAPPQGHVIVQVSTRSIRTELFDFGLRVMVLLAGVLLSGWVMARRISTS
FT                   LDQRIQAVVQAAQKIGAGHIGIRLPASAIPSFARLSQDINGMAEQLEQSRQRLEQRVLE
FT                   ATQALREQRDAAEQANRDKTRFLAAASHDLRQPMHALNLLLEALKQESRSDERARLLER
FT                   IEASSQAMSALLDALLDISRLDAGTVRLQRAPLQLQPLLLRLRDTYERQAERKGIALVI
FT                   HGSQACVRSDPLLLERILGNFLSNALRYTPPGGCVLLAVRLRGAHCVIQVRDNGPGIAP
FT                   DEQAAVFQEFVQLHNPQRDRSQGLGLGLAIVQRLARLLDHPVGVRSCLGHGATFHIQLP
FT                   RCEVAPPAAPGVPPPHGASTPASPGLEGCRILLVEDDALVRDGYARLLQLWGGEARVHA
FT                   NADAVLAALGQDGWRPHLIVTDHRLGGALNGRQLIDALRRHWAAELPAVILTGDTEDAA
FT                   LGQSGTERLRVLYKPVKPAELRQVLVQLWRAGGAATPPRD"
FT   gene            582184..582882
FT                   /locus_tag="Ajs_0555"
FT   CDS_pept        582184..582882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0555"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: mes:Meso_0341 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40805"
FT                   /db_xref="GOA:A1W3I0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3I0"
FT                   /protein_id="ABM40805.1"
FT                   /translation="MPVISRLVKILIVDDHGLVREGLQAILSRSELLAECVQAWDAASL
FT                   WQQLEQHADIDLVLMDIQLPDVSGLSLLEELTQRLPQLPVIMLSADHDAGIVLHSLEQG
FT                   ARGFLPKSSLNQVLVSAIRLVAAGGVYVPPEALQKPAARPAAAGPQAPVSIASLGFTAR
FT                   QTDVFRLLLQGLSNKQICRELDLAEPTVKIHVRGILRTLGVSSRAEVIAKYGMLSPSPS
FT                   TPRQAAAADH"
FT   gene            582919..583968
FT                   /locus_tag="Ajs_0556"
FT   CDS_pept        582919..583968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0556"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   pfo:Pfl_4042 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40806"
FT                   /db_xref="GOA:A1W3I1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3I1"
FT                   /protein_id="ABM40806.1"
FT                   /translation="MSLFAQLLRRRARAPLVSVVVASYNHAPFVQDCLRSALSQGIDDL
FT                   EILVTDDGSTDATAQHVAALGDPRIHLHAFAQNRGACLAMNDALRRSRGRYIAVLNSDD
FT                   LFLPGKLRRQIDFLEHNPQVGAVFGWPSFIDEQGQPFHDPAHKDHAVFHQPNRGRHQWL
FT                   RHFFDQGNALCHPTALLRREVYQNVGLYDPRLAQVPDLDQWIRVCMRYDIHVLPEPLTA
FT                   FRIRSGQQNASGARPEVVRRDAWERADVLRHYLRLPPAQLLQVFPEFAGQGAGQGASLV
FT                   EQLACHALALGTPFHQRFALQAWFDALPAGGLLDAPGPAAAPPAGGDPTAWRRYIAATA
FT                   AANPHRIGG"
FT   gene            583986..585107
FT                   /locus_tag="Ajs_0557"
FT   CDS_pept        583986..585107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0557"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: rru:Rru_A2715
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40807"
FT                   /db_xref="GOA:A1W3I2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3I2"
FT                   /protein_id="ABM40807.1"
FT                   /translation="MQTTQHAYLSRLDHLRFFAAALVVLFHYFHTQVGDLRSGNPLVSL
FT                   VDEGHTGIALFMVISGFIFTVIAGERHIHYGGFIKNRVLRIYPLFVFAVFLQLFISTYN
FT                   DQRNYGFLQLLGWLMPFRSETVPLSPYFVQLWTIWVEFQFYLIFPFLLAFSRRHGSRYL
FT                   WAWLGLLVLVRALVYAASGSVRFIAYETLFGRLDQFIIGMLLARFWQVRQALQARAARA
FT                   GGAVAPHLSPLWLALAGLALLLGLHAFSRKVGFSELASPVWIIWPGLEAALWAVFVGVY
FT                   LCTRWPGPQALRQRIDRALAALGAVSFSTYVLHNLVIAAYNARLPPLATGAGPVADALA
FT                   TGALLLPAVLALSAITYHLIERPFLALRGGYLS"
FT   gene            585393..591035
FT                   /locus_tag="Ajs_0558"
FT   CDS_pept        585393..591035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_4160 VCBS"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40808"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3I3"
FT                   /protein_id="ABM40808.1"
FT                   /translation="MTYFTTGAQLQAALNALPNTKTGNFVAFDSFFYGQQYMADYQGTL
FT                   SPIEHFVQIGAARGYKPNATFDPTYYKNAFADLKNTDFNAADLLYHFMQYGLDEGRTPN
FT                   AALATFDGTAYLAANPDVAAYVNANLAQFGGSATNGALAHYVKFGAAEGRTAPGTSVSN
FT                   GQTFTLTASAPDVNEGSSVVFNLATTGVAAGTVLTYTLSGVSAQDVIGGSLTGQVTVDA
FT                   FGNAAVSVGLVGDNKTEGAETLTMSLAGQTANVTVNDTSLTPALVLTTGTDILDGDAAD
FT                   NVFAASGLTLQTADWLDGKGGNDTLVVSVSNDTVAGGDNVDAAPHLAGIETIRVNAPNV
FT                   VNPEISIDLSNASGVTTLESFQVSDYNNEDGFVEFLDIQSVNDTAIKIVDTNIDYEFTY
FT                   DKVNAYDPVSNAVDLAIQEVDGSTITFSNDRPYEYAESNVDRINLTSLSRTQVSTTDEN
FT                   TLAALQVGSDFQTLMIEGDADLTIVDRLDLNLNLVDAGDLEADLTLDLHAQGVVLKSDL
FT                   TVNAAATTFLNVIGAQGDDSIGIGGERSAGITVVDLGTGDDSLVLGDNGALLGHATIVA
FT                   GEGEDTIVVNQTGLLNVDLGLDDDSLVINGDVEDLTTTARDGVSVVVAGVGDDTVLIEG
FT                   DGAYDINLGAGDDNLTKHGNGNNTIVAGAGNDTVTIVGTGNTSNNNVKLDAGNDSLTIV
FT                   DNGNNSVEGGTGDDSVTIVGNGNQTVNGGDDSDSIVIVGDGNDSIIAGTGNDDVTIAGT
FT                   GKQYVDLGEGNDSLLINGSASGNLDYASASLVSTIVGGEGNDTVAVTADHILNANLGTG
FT                   NDELTLRAQDLTTDDTVAGGSGSDTLVLTNETPRDAWEIGRSETSRTTAFETYDLRDSN
FT                   LTLDVTNQMVATAENNSITVSTQQSEGIELPSLTLTEEAVEAEVMPVPLEQGMTVGEWN
FT                   ALVLQWRNGQLEEAYGYLSEGDVDNYYDTLPYGGSDPTPTIPEVEAWILEQAENDLQSY
FT                   LDTKGVEQVFADTDADGDGNDDLTDEVFFILNDSSLTQTVDLTGLDTNLPDAFTLLGGS
FT                   LTDIVIANDELINGRMTLNFDSTAGRALSTEDTLRVVDGATITAADLRNVTGLERLDLV
FT                   ATSNSAQTWTVELTDHVVNQTTANADFLITVASEVPAGSKLYIKLDPESLEGATSNVFV
FT                   VRNSNVTVYLDRGEGAGYEVVSEPSYGPDDAVQDFNADTGLFVVTDQHFTTNADNLFGN
FT                   FFVADSVDQLQAADRAEGLGEDDTVQLNFAVNNEDSTLEEIFNGADLIDIEHMVFATEN
FT                   NVVFDGIGAGYASGLESLSTGSGDDQLTAMRTGLVYELNQGDDEITLQSNIGVDSATVD
FT                   GGEGEDSVYGGGYSDNVVVRDVEYINLYGNVSVAGDSVVLATTNEDLVTIENAETVTGS
FT                   GGADDLLISNSGLSVSVLGNGGDDTIVVGGGTANATVYGGYGNDSIRVTVSNYAAVYGY
FT                   DGLDFGEADDQDTIDVIVTAGSAYVAGNDVSDRITVSVQNDATIYGESGDDFIQVSTRV
FT                   VGATTVAADDVTVDGGSGDDTIVVAALTADVVGGTGLDSITVTVVNGATVAGGADDDVI
FT                   TVSAGDNVSVNGDGDDDSITVTTLDSATVNGGTGDDAIVVTYGNDTAGTDNASVSGGDG
FT                   DDSITIHEGSGADGATVDSGLGQDVIGLNVSATGAADTIMFGTVAYTVLQDVDTVSTTQ
FT                   NYDFNAILGQTAHVGFNDGGDTINGFNMELGGAGVEDVLDFSAFLTTTKAGTDYNGVFH
FT                   GRGTSDAIEYGDWTSGLTSVDMDNFGADADFAIISADNGFVLNASHITNVDGADGIEVD
FT                   NAGKAIVFIAMDTDGDSNYDRADIYFVQDVDQDAGTAWAVDLVGTVNLATEIGATTSIN
FT                   LANLAW"
FT   gene            591448..592710
FT                   /locus_tag="Ajs_0559"
FT   CDS_pept        591448..592710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0559"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   syf:Synpcc7942_1625 probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40809"
FT                   /db_xref="GOA:A1W3I4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022623"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3I4"
FT                   /protein_id="ABM40809.1"
FT                   /translation="MNILLVHQNFPGQFKHIAPVLGASGQHRVVAFTMVKNPPPIVGVQ
FT                   MVSYQPGRGTHAHTHPWVQDFEAKVIRGNVALKAARKMRDEYGFTPDLIFAHHGWGESL
FT                   FLKDVWPRARMLLYSEWYYPLIGADMGFDPEIQKRGEEQTARLRIKNAHNLLSMEMADA
FT                   GLSPTHWQRDTHPAWFRDRIQVIHDGIDTAAVKPDANVPPLTLNIPADPDCGIAATQVT
FT                   LAKGDEIITFINRNLEPYRGYHIFMRALPELLRRRPKARVVIVGGNEVSYGAKPEQGTW
FT                   KQKFLAEVRDGIDLGRVHFVGKIPYNAFLALMQMTTVHAYLTYPFVLSWSLLEAMSCAA
FT                   AIVASDTAPVREAITDGETGRLVDFFSPAALTDTLCELLDDPAQRARLGRRARDTVVAH
FT                   YDLNTRCLPRQLQLLNEVARG"
FT   gene            592732..592977
FT                   /locus_tag="Ajs_0560"
FT   CDS_pept        592732..592977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40810"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3I5"
FT                   /protein_id="ABM40810.1"
FT                   /translation="MNDNDILSFINGLTEPAGNPALPDIADDIAAIAAESLGWIPLDSG
FT                   AYLHLGATAAGDAPLVIDVVGSISADMAGSNVLLLT"
FT   gene            593025..593528
FT                   /locus_tag="Ajs_0561"
FT   CDS_pept        593025..593528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0561"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccr:CC3052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40811"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3I6"
FT                   /protein_id="ABM40811.1"
FT                   /translation="MQIATITTRYDAIEDRILLAVADADDIQARLWLTRRMTQRLVAAL
FT                   VDGVQRQIAEPPAARAEVKVAALAAANVYAQLQARISKKPAPPVEPPSAAPQHLIQEIG
FT                   VRNGRNGARILEFRCRDRGPATLMLSLTEQRQWLESLKSACGAAHWALDVWPGWMAPGA
FT                   QDGE"
FT   gene            593581..594693
FT                   /locus_tag="Ajs_0562"
FT   CDS_pept        593581..594693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0562"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   eba:ebA1554 hypothetical transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40812"
FT                   /db_xref="GOA:A1W3I7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3I7"
FT                   /protein_id="ABM40812.1"
FT                   /translation="MTRPRCALVSLADTPWYHVVNRCVRRAFLCGHDAHSGQDFEHRRG
FT                   WVETRIRELASVFAIDVAAYAVMSNHYHVVLRVDAARARGWSDEEVLRRWTQLFTGPLL
FT                   VQQFLQPPQRALMGQAQLEQVQALADTYRARLFELSWFMRVLNESIARQANAEDGVKGR
FT                   FWEGRFKSQALLDEQALLSAMTYVDLNPVRAGMAESLEDSAHTAIAARLAELRGQPFVP
FT                   VQAPQAPLQAAQHSSAPGAAAPLPHLLPEQALACLPEAPLMPFDPTGRFAQAVPFGLQE
FT                   YLDLVDTVGRVVHPTKRGTIAHHVPPLLQRLGMDTEAFIACADTFFRSFANAVGTPASL
FT                   AQLAARRQARALRGMATARQMLSPRPERVA"
FT   gene            594690..595211
FT                   /locus_tag="Ajs_0563"
FT   CDS_pept        594690..595211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40813"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3I8"
FT                   /protein_id="ABM40813.1"
FT                   /translation="MKPNRPPALMQQALAAIKIILPRGSQKAPSPSLPQQKAAPVSMQG
FT                   CEGCLGGFVEHLKQCLGCTRTHLPATHTPIDRHIRAFAPGGRVRVAQTRSVLCLEWGRS
FT                   RHCSLQRPVTAAPAQLRACGYRSLIPIGDGIVRLSSLEVSMQRGWQPPRTVQWQVLSPL
FT                   VLAAHEVCAV"
FT   gene            complement(595154..595924)
FT                   /locus_tag="Ajs_0564"
FT   CDS_pept        complement(595154..595924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_2656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40814"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3I9"
FT                   /protein_id="ABM40814.1"
FT                   /translation="MSHTPGHDPLVHTHLSSYLQRICDHVRLGYRHWCSGTIRVDKAAA
FT                   LVRKFDRLYAVGRSRHQRAWARHKGEAAAVLLLYAPTVPGTADTAEADDDALLWTLLLT
FT                   PGQSLAQQLEVLHDAGTATGRVQVRDFELVQLPRAGQAHSAWTWRLSEGAYQGWRAHLI
FT                   DTARRSPWLLPGQVQRLARTPGFAGCRVQVKKLQQLARAEHQRRMPGQAVLALPRVLYV
FT                   QRLASGQLRLSQLRRRYTAQTSCAANTRGDRTCH"
FT   gene            complement(596144..596392)
FT                   /locus_tag="Ajs_0565"
FT   CDS_pept        complement(596144..596392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40815"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3J0"
FT                   /protein_id="ABM40815.1"
FT                   /translation="MSSVLVVSTFFLEQPLETIAVQRDPGQQAGKHGHRCRGLQQLRRP
FT                   ELQGHLPAAARQWAVAVHQSGGVFVNTHVMSFLSKMA"
FT   gene            596602..597951
FT                   /locus_tag="Ajs_0566"
FT   CDS_pept        596602..597951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0566"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="KEGG: tdn:Tmden_1855 DNA
FT                   (cytosine-5-)-methyltransferase; TIGRFAM: DNA-cytosine
FT                   methyltransferase; PFAM: C-5 cytosine-specific DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40816"
FT                   /db_xref="GOA:A1W3J1"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3J1"
FT                   /protein_id="ABM40816.1"
FT                   /translation="MLGIKNQGTGTLRVMELFAGVGGFRQGLEQVRTPAQQAAFKVVWA
FT                   NQYEPASKKQWAAEVYRARWGVQDLVNEDIFEVLQEPALMASLDALCPDVLVGGFPCQD
FT                   YSVAKPLSHSQGLQGDKGVMWWAVSRMLQARRAAGAPLKYLVLENVDRLLSSPATCPGQ
FT                   DFARILVSLQQEGYAVEWRVVNAADYGFAQKRRRLFMVAAHESTPLYTRMAACAGEAQQ
FT                   GSLPWLLSAGVLSKALPASVKDGGKLQVFSLPVGDFAAMSYVPLKRGSGFASGGVCAAG
FT                   WVCTAPLVAQKLTDFTEFTGLAQALTLGDVVRETGEAVAPACFLADAALPKWQRLKAAK
FT                   SIARVSAHGHAYHFSEGAMAFPDRLDAPARTVITSEGGAGASRTTHVVRHADGRLRRLV
FT                   PEELEVLNGFARGFTDIAGITPAKRGFLMGNALVTGLVTAIGRALWQAQT"
FT   gene            complement(598013..598489)
FT                   /locus_tag="Ajs_0567"
FT   CDS_pept        complement(598013..598489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A0918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40817"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3J2"
FT                   /protein_id="ABM40817.1"
FT                   /translation="MRTVWRITTARFAQTAFSGEGARLYGGRWNPKGWEVVYTAESQSL
FT                   GLLELMVQDDPLRAHYVLIPAQLPDDLPETRINIEQLPDDWRTIGARDVLQSMGQAWLQ
FT                   GAQTALLSVPSAVVPAERNILINPRHPDFARIVLGAPQSLHTDTRLLRNLGKPI"
FT   gene            complement(598489..598941)
FT                   /locus_tag="Ajs_0568"
FT   CDS_pept        complement(598489..598941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A0917 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40818"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3J3"
FT                   /protein_id="ABM40818.1"
FT                   /translation="MTTASVHSSVASALNLLGGEAVLHARPRVVMDWIPLVRRGLPSAS
FT                   VDALVRLTRITQTELAHALAIPERTLARRKREGALSAEESAKFVRFARVVERAETVFED
FT                   TDSALSWLQSPNASLGGVTPLSLLDTDIGADSVLDTLGRIEHGVFA"
FT   gene            598999..599304
FT                   /locus_tag="Ajs_0569"
FT   CDS_pept        598999..599304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0569"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wol:WD0572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40819"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3J4"
FT                   /protein_id="ABM40819.1"
FT                   /translation="MSRAPVPLVFITHAFKGITVNTTEHITLTFPIEHDGLPIKEIALR
FT                   RPTVGDHLTAQKAAGTDAERKIRLIANLAELPPAVIHRLDMKDYAQLQKVLGGFLQ"
FT   gene            599542..599994
FT                   /locus_tag="Ajs_0570"
FT   CDS_pept        599542..599994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0570"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   pst:PSPTO_5581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40820"
FT                   /db_xref="GOA:A1W3J5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3J5"
FT                   /protein_id="ABM40820.1"
FT                   /translation="MRSGHRAHDWRIVETMEQVSSEGRPRRREYSKAFKAQLVAACAQP
FT                   GASVGGVALSHGLHANMVHRWIREAGPVRAQPGVCSDAEPGFISLPLTAMADSTHEEQA
FT                   LAALPPSAPLPLPSAPVHVRLQRGELVVSLQCPLGQCGALLREVLR"
FT   gene            600015..600326
FT                   /locus_tag="Ajs_0571"
FT   CDS_pept        600015..600326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0571"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: psb:Psyr_0746
FT                   IS66 Orf2 like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40821"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3J6"
FT                   /protein_id="ABM40821.1"
FT                   /translation="MSTQPLDMRAGPETALARVVQVFGAARPHHAYLFANARANRLKVL
FT                   VHDGFGVWLAARRLNQGKFAWGDERLGPRLTLSVEQLQALVTGLPWQRLGEDAVITVL"
FT   gene            600407..601921
FT                   /locus_tag="Ajs_0572"
FT   CDS_pept        600407..601921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0572"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: rfr:Rfer_3059
FT                   transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40822"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3J7"
FT                   /protein_id="ABM40822.1"
FT                   /translation="MNEPVDLQSMDEAQMRQMLQHLMSELKHKQTLLDKLSYEMAILKR
FT                   LKFAAKTEALNADQRSLLEDALEEDLQAVDEEIEQLRSAEERSPRQQPKRLPLPAQLLR
FT                   QEFTHEPEVTECCGQAMRRMGEDVAEKLDYTPGVFMVHRHVRGKWVCACCQTLKQQPVE
FT                   AHIIDKGLATTGLLAQVLVAKYADHLPLYRQESIYARAGVPLARSTLAQWVGSCGVQLQ
FT                   PLVDALRQEVLAHSIVHADETPVQMLKRGSERDGKTHRAYLWAYTPGRHEDLKAVVYDF
FT                   CESRAGKHAGEFLNGWRGTLLVDDFAGYKQLMGEHITEAACWAHARRKFFELHAANKSQ
FT                   IAEQALVQIGQLYEVERQASNVDGTERLRMRQQHSRPIVDKLHAWLSEHRSKVPEGSAT
FT                   ARAIDYSLRRWQPLTRLLDNGQLPIDNNWIENQMRPVALGRKNWLFAGSLRAGQRAAAV
FT                   MSLIQSAKLNGHDPHAYLKDVMTRLPTHKDSRIGELLPHRWQSATI"
FT   gene            complement(602087..602782)
FT                   /pseudo
FT                   /locus_tag="Ajs_0573"
FT   gene            602919..604310
FT                   /locus_tag="Ajs_0574"
FT   CDS_pept        602919..604310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0574"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   pol:Bpro_2203 ISRSO17-transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40823"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3J8"
FT                   /protein_id="ABM40823.1"
FT                   /translation="MSASERFDQYMAHLSRALGHADRYAGLKGYCTGLMLPLSRKSVEP
FT                   MAARVDPLHASARHQALHHFVAKAQWSDVEVLRRVCQWVVPHMDFSRGGWWIIDDTGFP
FT                   KKGVHSVGVARQYCGMPGKQDNCQVAVSVSLACDQGSIPVAWQLYLPQDWAQDAERRKR
FT                   TGVPESVRFATKTQIALHQLRTLLSEGAPRHCVLADAGYGVDTAFRQALSDMGLHYAVG
FT                   VTSAVVVWPPGVEPLPPETYSGKGRPPVTPRRTAQLQPMSVKALALSLPAQAFQTISWR
FT                   EGTNAPLTGRFAAVRVRHAGGNAGKASLRAQEWLLIEWPVEQAEPVKYILSTLPESTAL
FT                   NDLVSCAYQRWRIERDYQDLKQDFGLGHYEGRGWRGFHHHASLSIAAYAFLMSERLIAD
FT                   KPAGGKKNFIERQVPAVPQDYIPRGRPARTAARGQLDHKLASSAELRTHRPSGTVPLLR
FT                   PHQHE"
FT   gene            complement(604477..605463)
FT                   /pseudo
FT                   /locus_tag="Ajs_0575"
FT   gene            605614..606702
FT                   /locus_tag="Ajs_0576"
FT   CDS_pept        605614..606702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0576"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   mca:MCA2964 ISMca1, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40824"
FT                   /db_xref="GOA:A1W269"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A1W269"
FT                   /protein_id="ABM40824.1"
FT                   /translation="MRGSQDFQGAMFSYISLEERVPQAHPLRKLRAVVDALLATMNREF
FT                   EAVYARRGRPSVPPEMLLKALLLQILFSIRSERQLVEAINYNLLYRWFVGLNIEDKVWD
FT                   HSTFSANRERLFNEDLARAFFERVKLSAQWGKLASDEHFSVDGTLIDAWASHKSFKRKD
FT                   DDSGTPPGRNPEVDFKGQERCNDTHESTTDADARLFKKSQGDKSRLCHMGHILMENRNG
FT                   LIVDVEITHASGTAEREAALAMLERRGNRNKRATVGADKGYDSKAFIKGCRKLKVTPHV
FT                   AAKDKHSAVDARVTRHEGYKTSLKVRKRIEEAFGWIKTVGGLAKTKLIGQAKLTGQALL
FT                   CFATYNLVRMGSIGGWWDAHHA"
FT   gene            606894..607190
FT                   /pseudo
FT                   /locus_tag="Ajs_0577"
FT   gene            607304..608860
FT                   /locus_tag="Ajs_0578"
FT   CDS_pept        607304..608860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0578"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   cch:Cag_0447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40825"
FT                   /db_xref="GOA:A1W3K0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022623"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3K0"
FT                   /protein_id="ABM40825.1"
FT                   /translation="MRILFVHPGFPAQFRHVAQALVQQGHAVRALCQKPPEGAAPEFDV
FT                   PGVQVHAYGLPRGGTPGAQGWVAELELRAIRGEAALQAALALRDEQGFAPHVMLAHAGL
FT                   GDSLFLKAVWPGARLGLWGAHYHDAASARHADHDPGLSPLQALDAAARARAEALVQAQL
FT                   RMRNAQLDLHLREADGLLVPTDWQAARFPAPWRERLWVAHDGIDTEALAPNAQVRATLP
FT                   GDVALAPGDEVVSFVARSLEPRRGLQVVMRALPRLLAQRPAARVLIVGAEGPGQGPLPA
FT                   DGRSWKQHLIDEVLPQMPEADWQRVHFLGPLPHAHVVAVLQLAAVHVHWAYPLALSRSL
FT                   LEAMSTGCAVVAGDTAPVREVLADGETGRLLEFFDAEALADEVARLLQAPAERQRLGAQ
FT                   ARQCVQARYDLHGVCLPRQLQWLQALADGAAAPAPAPTPDAAQALRAELARAEQARDQA
FT                   QQAAALAQAQLEQAGRARDSAEAGRQAADALLQEAVQALAGVRQLLEAEAEAMEAAPPL
FT                   V"
FT   gene            complement(608924..609481)
FT                   /locus_tag="Ajs_0579"
FT   CDS_pept        complement(608924..609481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccr:CC3052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40826"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3K1"
FT                   /protein_id="ABM40826.1"
FT                   /translation="MPEAVPPAPVLQRITTAYDPAQDRMRLAGERADGSTLTLWLTQRL
FT                   LKRLLPALWQWLERHDAPAGAAHSARLPGYHSDAVHGFAQQAARAQLPPQPPVTPHERS
FT                   PQWLVHSIQLSAGASGVELRFSGEPGTDAPVGLTLAAQPLRQWLSILQQQYHEAEWPTQ
FT                   DWPAWLAAAAGPAAPAGRAMLH"
FT   gene            complement(609487..610338)
FT                   /locus_tag="Ajs_0580"
FT   CDS_pept        complement(609487..610338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0580"
FT                   /product="SapC family protein"
FT                   /note="PFAM: SapC family protein; KEGG: eba:ebA1573 SapC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40827"
FT                   /db_xref="InterPro:IPR010836"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3K2"
FT                   /protein_id="ABM40827.1"
FT                   /translation="MLRRTFPHPPNMTDTPSNPTANPLTPLSRQQHGQLRWRGPADYGF
FT                   ARHDQLCPLVLQELPKAALALPIGFVAQQEQFLPVAIQGLQAGRNLYVAPDGRWLAGYI
FT                   PAPYRSYPFRLARTEDGQQVLCIHADSGLVGPGDGQPFFDEQGQLSPATAQVLQFFQQL
FT                   EANRQHTTAACALLQQHGLIQPWPLRLQTDAGTQELGGLLRIDEAALNRLSGPALEALQ
FT                   RGGALQLAYCQLLSMQHLASLGRLATLHAQARQAPPPAPAPARDLDLEFLNQGGTLRLG
FT                   AL"
FT   gene            610763..611377
FT                   /locus_tag="Ajs_0581"
FT   CDS_pept        610763..611377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0581"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_2211 transposase, IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40828"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3K3"
FT                   /protein_id="ABM40828.1"
FT                   /translation="MDAILRIPLNTSPEQAQRLQALQQGFAQLCNALAPLVQSTRVWNR
FT                   VALHHLAYRQLREQFPDMGSQMVCNAIYSVSRTCRMVFQHPDSPLHLDKLGERPLPLLR
FT                   FADSCPVYFDRHTLSLKAGQLSMFTLDGRMRFQLSLDAEVEARFHAQKLREIVLSRRAD
FT                   GIYELSFLLVDQAQPAAAAEGALAPPEPGEIPEYVMVDEAV"
FT   gene            611374..613119
FT                   /locus_tag="Ajs_0582"
FT   CDS_pept        611374..613119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0582"
FT                   /product="type I secretion system ATPase"
FT                   /note="KEGG: cch:Cag_0740 type I secretion system ATPase,
FT                   PrtD; TIGRFAM: type I secretion system ATPase; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40829"
FT                   /db_xref="GOA:A1W3K4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3K4"
FT                   /protein_id="ABM40829.1"
FT                   /translation="MNPTQAPSELRQAVVALRPYYVRAAWFSLFASLLVLAPSGYMLEV
FT                   YERVVNSRNHLTLWWLTVAVLGAFVLMEVLEWARGEVMRAAGEALDRKLRVRVFDAIFE
FT                   ANVRRVPGGTVQPMQDFRKICEFLHSPALLAIMEAPIALVMMVLLFLISPVLGWSAVVF
FT                   GVLQVGVTWLNERRTKPPLMEANRTAIAAQQYADGTLRNAEVIEAMGMLRNTHRRWITK
FT                   QREFLQLQAQASESAGGFQALSKLLQNILSSMLLGLACWLLLHGELHGGGGMMIVSSIL
FT                   GGRMLAPLVQVVTQWQTVVNARDAWNRLDALLAAVPARAPAMPLPAPRGSVQVEQLVAG
FT                   APGSNATILRGIAFALQPGDVLAVVGPSASGKTTLARLLVGLWPAAMGKVRLDGVDVQT
FT                   WNKAELGPHVGYLPQGVELFEGTLAENIARFGEVDRPKVEAAARAVGLQGLIASLPEGY
FT                   ETRVGPGGARLSGGQRQRVALARALYGDPVYVVLDEPNSSLDEEGDAALAAAITQASAR
FT                   GATVVVITHRTSVLAVANKMLVLRDGQQQAFGPRDEVLAALNQAARQAAAAAAPTALAP
FT                   GQAVA"
FT   gene            613154..614878
FT                   /locus_tag="Ajs_0583"
FT   CDS_pept        613154..614878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0583"
FT                   /product="type I secretion system ATPase"
FT                   /note="KEGG: ppu:PP_2560 transport protein HasD, putative;
FT                   TIGRFAM: type I secretion system ATPase; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40830"
FT                   /db_xref="GOA:A1W3K5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3K5"
FT                   /protein_id="ABM40830.1"
FT                   /translation="MMTTPGFFERSELTRALWAFRREFLVVGVFSMVANVLLLAPTLYM
FT                   LQVFDRVMLSQSELTLLMLSLITLFLFLVGAFSEWMRSRVLVRAGMRLDGMLSTRVFNA
FT                   SFETNLKQLGGSTAKAFGDLVQVRQFLTGNGIFALFDAPWAPVYLAVLFFLHPLLGYLA
FT                   IFFALVQVALVWFSHRQTVTPSEQAQAAASEETLYLQSKLRNVEVLEPMGIVHNLRARW
FT                   LAKHGQAQRLQGQAQAVTHRITAWSKFIRYSQQSLALGAGALLVIDGQLSPGAMIAANV
FT                   LMTRALAPIDLLVSTWRGFMVARSAFERLEALLEGNPERDPALTRVPPTGALLLRDVVA
FT                   VAPGRSEPILKGVSLQAQPGTATVVLGPSGSGKSTLARCMIGIWPHMEGEVLLDERPIA
FT                   GWNRDELGPYLGYLPQDIELFEGSIAENIARFGEVDAEKVIAAARNAGLHDMILRFPKG
FT                   YDTPIGEAGGLLSGGQRQRIGLARAIYGDPALVVLDEPNANLDDVGEAALVRAVQTLKA
FT                   RGSTVVLVTHRPGILAVADRLVILKNGSVQADGPRDAVLAALRNAQSPAAQASLAVA"
FT   gene            614930..616297
FT                   /locus_tag="Ajs_0584"
FT   CDS_pept        614930..616297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0584"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: mfa:Mfla_1346 type I secretion membrane fusion
FT                   protein, HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40831"
FT                   /db_xref="GOA:A1W3K6"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3K6"
FT                   /protein_id="ABM40831.1"
FT                   /translation="MAESLHFSDKKSQLTPDAQALDAADTVAKHDLGRAGRWGLWALGL
FT                   GFGGFLLWAALAPLDEGVPGPGVVALDTKRKAVQHLSGGIVQQVLVREGDEVKEGQLLI
FT                   KLDAAVARANYESVRQSYLGLLAMQARLQAEQLGKPGIAWPADLKEAASDPLIQQQILN
FT                   QEQLFHTRRSLLRSDLQSIEENIQGQEGLLQSYAGMLGNRKNQLALLHEELGHLRDLVK
FT                   EGYAPRNRQLELERSVADVNTSIADLQGNTLRARSAISDLRQRAISRQQEYRKEVETQL
FT                   ADVSRQVLVDGEKFRAVRNDLERTEIRSPADGQVVGLAVQTVGGVVQPGQKLMDIVPKG
FT                   APLLLEARVAPHMIDRVKAGMPVDVRFSSFANSPQLVVQGAVESVSGDLLTEPQSNVSY
FT                   YLARVQVTGEGAKALGQRQLHPGMPVEVIFKGGERSMLTYLLHPLTKRLAASMTEE"
FT   gene            616302..617672
FT                   /locus_tag="Ajs_0585"
FT   CDS_pept        616302..617672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0585"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   dar:Daro_3926 type I secretion outer membrane protein,
FT                   TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40832"
FT                   /db_xref="GOA:A1W3K7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3K7"
FT                   /protein_id="ABM40832.1"
FT                   /translation="MARSSTLLGMPRLNRLARACAALAGVALAWPAWSLDLRQAYEAAL
FT                   QNDASIRASRAAADASRERLPQAQAQRLPSVSLSATRNYNDLTARTRNFLGQPVTQQNH
FT                   YYSGNQSLTVRQPIYRPYNNALVDQARAQVEDADALLERDEYSLVVRVGEAYFDVLLAR
FT                   DQLDLVAAQKASYTVQLDAARKGLAAGSGTRTDVDEAQARLDMTGAQELEALQNLEFTQ
FT                   RRLQTLTGQPLAQLAGLDVQRFRPEPPMPARLEDWVALAEEASPELRSLRAQVEAARLE
FT                   IDKAQAGHKPTLDAVAQWARSSSDSVTSVNSRYDQGVVGLQLTIPLYSGGYVSSTVRQA
FT                   LAAQERAREALEATRLDLGVRVHKEFRGMTEGALRIAALEQAVRSAEQAVISSRKSQQA
FT                   GSRTTVDVLNAEQQKTMALRDLAQARYLYLLSRMRLQSLAGQDRQASIEQANASLAP"
FT   sig_peptide     616302..616406
FT                   /locus_tag="Ajs_0585"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.550 at
FT                   residue 35"
FT   gene            617710..618792
FT                   /locus_tag="Ajs_0586"
FT   CDS_pept        617710..618792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0586"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   sfr:Sfri_2826 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40833"
FT                   /db_xref="GOA:A1W3K8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR015393"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3K8"
FT                   /protein_id="ABM40833.1"
FT                   /translation="MTRKVAIVGCAGVPAAYGGFETLAENLALYRERHGLDVDLTIFCS
FT                   GPMPAEEARRFHGARLHHLPISANGVSSIAYDLWSLALAWRQRVDTVLLLGVSGAIALP
FT                   LLRCFGRTKVVTNIDGVEWRRAKWGRAARAFLRLSEWLAVRCSHVVVADNEGVAEHVAR
FT                   SYARSCTVIAYGGEHAVQCTRRPWHTALPPRYALALCRIEPENNVEMILDAFARQPVLP
FT                   LVFVGNWEASAFGRAMRARYGGCDHITLADPKYDPGALRTLRERASLYVHGHSAGGTNP
FT                   SLVEAMHFGLPVAAYDCSFNRYTTHGQARYFADAQALTALLSDLEGARAEAVGNCMQAL
FT                   GRLHYTWDRIGAEYFEALGA"
FT   sig_peptide     617710..617766
FT                   /locus_tag="Ajs_0586"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.779) with cleavage site probability 0.333 at
FT                   residue 19"
FT   gene            618857..619957
FT                   /locus_tag="Ajs_0587"
FT   CDS_pept        618857..619957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0587"
FT                   /product="glycosyl transferase, family 4"
FT                   /note="PFAM: glycosyl transferase, family 4; KEGG:
FT                   pol:Bpro_3998 glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40834"
FT                   /db_xref="GOA:A1W3K9"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3K9"
FT                   /protein_id="ABM40834.1"
FT                   /translation="MIWLSLVSLIVTTVVAAAIIRWSGGRAVAYGDAMPQRFHVGEVPR
FT                   LGGLALLAGLVVSWLLGMWQTRLGDPGSLRLGPWVLLWIAVLLPAVLGGIAEDMTQRLS
FT                   VRYRLLLTLISGGLAVWLLDMNVPRLGLPWLDMLLRQAPWLGMGVVLLAMAGLPHAFNI
FT                   IDGYNGLAGMVALIVCLALAHVCLQVGDRALASLLVCLAAATGGFLVWNYPRGMLFAGD
FT                   GGAYIWGGVIALASLSLVQRNAEVSPWFPLLLLIYPVGETLFSIYRKLARGVSPGMADA
FT                   LHFHQLIYRRIVRSVFHEDEARRMLKRNNRTSPYLWAFTMLTVVPAVLFWNNTPVLMTF
FT                   CGLFGATYVTAYIGIVRFKVPGWMRF"
FT   sig_peptide     618857..618910
FT                   /locus_tag="Ajs_0587"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.311 at
FT                   residue 18"
FT   gene            620027..620917
FT                   /locus_tag="Ajs_0588"
FT   CDS_pept        620027..620917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0588"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: pol:Bpro_3982 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40835"
FT                   /db_xref="GOA:A1W3L0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1W3L0"
FT                   /protein_id="ABM40835.1"
FT                   /translation="MTDLLSIAPRDKAEILAQALPYIRKFHGKTMVIKYGGNAMTDPAL
FT                   QADFAEDVVLLKLVGMNPVVVHGGGPQIEQALNRLGKKGEFIQGMRVTDAETMEVVEWV
FT                   LAGEVQQDIVGLIHQAGGKAVGLTGRDGGMIRAKKLKMVDNKDPSVEHDVGQVGDIVAI
FT                   DPSVVKALQDDAFIPVISPIGFGEENESYNINADVVASKLATVLQAEKLVLLTNTPGVL
FT                   DKEGKLLTDLTAREIDALFADGTISGGMLPKISGALDAAKAGVNAVHIIDGRVPHSMLL
FT                   EILTDQAYGTMIRSH"
FT   gene            621110..621754
FT                   /locus_tag="Ajs_0589"
FT   CDS_pept        621110..621754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0589"
FT                   /product="cell division inhibitor SlmA"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: pol:Bpro_3979
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40836"
FT                   /db_xref="GOA:A1W3L1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3L1"
FT                   /protein_id="ABM40836.1"
FT                   /translation="MTEFTPATDAPASTDDAPTARRRPRPGERREQILQTLAAMLEQPG
FT                   AERITTAALAARLQVSEAALYRHFASKAQMFEGLIDFIEQSVFTLVHQIMERGGESEGA
FT                   QRAARITAMVLQFGERNPGMVRVMVGDALVFENERLQQRMNLFFDKVEATLRQCLRPVA
FT                   DADGSATPTVQTQVRAAALSDLIRGRLQRYARTGFRRMPTEHLDATLALWL"
FT   gene            complement(622021..623001)
FT                   /locus_tag="Ajs_0590"
FT   CDS_pept        complement(622021..623001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0590"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   rso:RSc1704 ISRSO18-transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40837"
FT                   /db_xref="GOA:A1W3L2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3L2"
FT                   /protein_id="ABM40837.1"
FT                   /translation="MASSPPMKQSSLDLKLSTKKTRKQELLIQMDLVVPWAALVELIAP
FT                   YYPEGKNGRPPFALETMLRIHCMQQWFTLSDLAMEEAFFDTPIYREFASLDAHGRVPDE
FT                   STILRFRHRLEKHKLAEQILATVNELLAAQGLLLKAGTAVDATLIAAPSSTKNKDRKRD
FT                   PEMHSSQKGNEWHFGMKAHIGVDADSGLVHTVIGTSGNVADVVEGNSLLHGQETDGFGD
FT                   AGYQGIDKRPDAKEAVRWHIAMRPGKRRALDKENNPVDALIDQVEKIKASIRAKVEHPF
FT                   RVIKRQFGYTKVRYRGLKKNTLQLKTLFALSNLWMVRHQLLEAQG"
FT   gene            623150..623815
FT                   /locus_tag="Ajs_0591"
FT   CDS_pept        623150..623815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0591"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: pol:Bpro_3958
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40838"
FT                   /db_xref="GOA:A1W3L3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3L3"
FT                   /protein_id="ABM40838.1"
FT                   /translation="MSLSPSPTKTVRAPRREGRALHKGQHTKAVIIDAALGLATHIGLE
FT                   GLSIGALAEVTGMSKSGVFAHFGSREELQISVIREYHTRFEQEVFYPAMQAPRGVSRLR
FT                   ALFANWMKRTSIEIDSGCIYISGAVEFDDRTGPVRDALANSVMTWQAAMKRAIQQCKEC
FT                   GEIRDDVSEDQMLFEIHGLILALHYEARFLHTPGSIDRANTGFDNILARYSALPGHRG"
FT   gene            623880..625676
FT                   /locus_tag="Ajs_0592"
FT   CDS_pept        623880..625676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0592"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   pol:Bpro_3957 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40839"
FT                   /db_xref="GOA:A1W3L4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3L4"
FT                   /protein_id="ABM40839.1"
FT                   /translation="MPTYTPPLRDMQFVLHEVFKVTDEFKAMPAHAEVDADTINAVLEE
FT                   AGKFAAGVAFPLNISGDTEGCKLDPQTHEVTPPKGFKEAYRQYVEGGWPALSCDPEYGG
FT                   QGLPHTVNQCLYEMLNSANQAWTMYPGLSHGAYEALLAHGTDEQKKTYLPKLVSGEWTG
FT                   TMCLTEPHCGTDLGLLRTKAEPVGDGTYKITGNKIFISAGEHNFTSNIVHLVLARLPDA
FT                   PKGSKGISLFVVPKFKVNADGSLGERNPIYCTGLEHKMGIHGNATAQIAIDGAIGTLVG
FT                   EPHKGLAAMFVMMNAARLGVGNQSLGLTEVAFQNALAYAKDRIQMRSLSGKKAPDKEAD
FT                   PIIVHPDVRKMLLTAKAYAEGARALQVFCTLLLDKAHSHPDEKVRKDSDELVALLTPIV
FT                   KAFVTDNGHIATNACMQVFGGHGFIKEWGMEQFVRDNRINMIYEGTNTVQSLDLLGRKV
FT                   LGNNGATLKKFGKLVGQLVAEEGVNEKMAEFINPIAYLGDQMTKFTTEIGFRGFQNPDE
FT                   VGAAAVDYLRVAGHLVFGYMFARMAQVALREIAAGNTDPFYQAKLQTARFYFAKLFPEV
FT                   HTLMRTARAGSKVLMDTDAALA"
FT   gene            625729..626163
FT                   /locus_tag="Ajs_0593"
FT   CDS_pept        625729..626163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40840"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3L5"
FT                   /protein_id="ABM40840.1"
FT                   /translation="MRQALAAIIFAAIAAPAWAQMSPVGLWRSVDDKTGEAKAEIRIAE
FT                   TSGVLNGRIEKSLKKDADPAATCTECKDDRKGKAIAGLEIIRGVKKADDREVWEGGKIL
FT                   DPENGKEYRASLTPIEGGKRLEVRGFLGPFWRTQTWQRVQ"
FT   sig_peptide     625729..625788
FT                   /locus_tag="Ajs_0593"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            626264..628666
FT                   /locus_tag="Ajs_0594"
FT   CDS_pept        626264..628666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0594"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding; KEGG:
FT                   rfr:Rfer_3517 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ajs_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABM40841"
FT                   /db_xref="GOA:A1W3L6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1W3L6"
FT                   /protein_id="ABM40841.1"
FT                   /translation="MSRFQVKKVAVLGAGVMGAQIAAHLVNVKVPVVLFDLPAKEGPKN
FT                   GIVTRAVENLKKLKPSPLGVADDAALIQQANYEENMALLGECDLVIEAIAERMDWKLDL
FT                   YKKIAPHVAPHAIVASNTSGLSITQLSEALPDAIKPRFCGIHFFNPPRYMVLVELINTP
FT                   TTRPEVLDQLEAFVTSGLGKGVVRAHDTPNFIANRVGIAGMLSTMKEVENFGLTFDVVD
FT                   DLTGKKLGRASSGTFRTADVVGLDTMAHVIKTLQDNLNEQTDPFYGSFGTPAVLQKLIE
FT                   LGHLGQKAKAGFYKKVGRDILRFELESEEYVPAGAKADEVYGRMLKKPAAERLKLLRNS
FT                   QGAQGRFLWAILRNSFHYAAVHLATIADTARDVDQAMRWGFGMSQGPFELWQEAGWLEV
FT                   ARMVQEDIDAGKALSKAPLPEWVFKGPVADAGGVHTAQGSWSARQGKFVPRRQLPVYER
FT                   QYFPEKLLGEDNLPDWRKAGTTISETDALRTWTLDGKVLIASIQSKMHAISPDVMEGLM
FT                   EAVDLAEREYDGMVIWSGDAPFSVGADLQATMPAYVVAGIAAIEGVEHELQNLMLRLRY
FT                   AQVPVVSAIHGMALGGGCELAVHSARRVAHMESYIGLVEVGVGLVPGAGGLTYIARRAA
FT                   ENAAASTGKDLLPFLTEGFTAAAMAKVGTSALESKKLGYLLDSDLIVPHKDEVLFVAIN
FT                   EAKAMAASGWRAPMKRLFPVAGRSGIATIRGSLVNMRDGGFISEHDQHIATLIAEVVCG
FT                   GDVDAGTLVSEEYLMALERKAFCALIEHPKTQERILGMLNTGKPVRN"
FT   sig_peptide     626264..626335
FT                   /locus_tag="Ajs_0594"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.574 at
FT                   residue 24"
FT   gene            628688..629884
FT                   /locus_tag="Ajs_0595"
FT   CDS_pept        628688..629884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ajs_0595"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: pol:Bpro_3953 acetyl