(data stored in ACNUC7421 zone)

EMBL: CP000542

ID   CP000542; SV 1; circular; genomic DNA; STD; PRO; 5566749 BP.
XX
AC   CP000542; AASQ01000000-AASQ01000056;
XX
PR   Project:PRJNA17187;
XX
DT   10-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Verminephrobacter eiseniae EF01-2, complete genome.
XX
KW   .
XX
OS   Verminephrobacter eiseniae EF01-2
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Verminephrobacter.
XX
RN   [1]
RP   1-5566749
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Chertkov O., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Stahl D., Richardson P.;
RT   "Complete sequence of Chromosome1 of Verminephrobacter eiseniae EF01-2";
RL   Unpublished.
XX
RN   [2]
RP   1-5566749
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Chertkov O., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Stahl D., Richardson P.;
RT   ;
RL   Submitted (21-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 51a5e8c1d2a085e2cb233818142d328d.
DR   BioSample; SAMN02598379.
DR   EnsemblGenomes-Gn; EBG00001160170.
DR   EnsemblGenomes-Gn; EBG00001160171.
DR   EnsemblGenomes-Gn; EBG00001160172.
DR   EnsemblGenomes-Gn; EBG00001160173.
DR   EnsemblGenomes-Gn; EBG00001160174.
DR   EnsemblGenomes-Gn; EBG00001160175.
DR   EnsemblGenomes-Gn; EBG00001160176.
DR   EnsemblGenomes-Gn; EBG00001160177.
DR   EnsemblGenomes-Gn; EBG00001160178.
DR   EnsemblGenomes-Gn; EBG00001160179.
DR   EnsemblGenomes-Gn; EBG00001160180.
DR   EnsemblGenomes-Gn; EBG00001160181.
DR   EnsemblGenomes-Gn; EBG00001160182.
DR   EnsemblGenomes-Gn; EBG00001160183.
DR   EnsemblGenomes-Gn; EBG00001160184.
DR   EnsemblGenomes-Gn; EBG00001160185.
DR   EnsemblGenomes-Gn; EBG00001160186.
DR   EnsemblGenomes-Gn; EBG00001160187.
DR   EnsemblGenomes-Gn; EBG00001160188.
DR   EnsemblGenomes-Gn; EBG00001160189.
DR   EnsemblGenomes-Gn; EBG00001160190.
DR   EnsemblGenomes-Gn; EBG00001160191.
DR   EnsemblGenomes-Gn; EBG00001160192.
DR   EnsemblGenomes-Gn; EBG00001160193.
DR   EnsemblGenomes-Gn; EBG00001160194.
DR   EnsemblGenomes-Gn; EBG00001160195.
DR   EnsemblGenomes-Gn; EBG00001160196.
DR   EnsemblGenomes-Gn; EBG00001160197.
DR   EnsemblGenomes-Gn; EBG00001160198.
DR   EnsemblGenomes-Gn; EBG00001160199.
DR   EnsemblGenomes-Gn; EBG00001160200.
DR   EnsemblGenomes-Gn; EBG00001160201.
DR   EnsemblGenomes-Gn; EBG00001160202.
DR   EnsemblGenomes-Gn; EBG00001160203.
DR   EnsemblGenomes-Gn; EBG00001160204.
DR   EnsemblGenomes-Gn; EBG00001160205.
DR   EnsemblGenomes-Gn; EBG00001160206.
DR   EnsemblGenomes-Gn; EBG00001160207.
DR   EnsemblGenomes-Gn; EBG00001160208.
DR   EnsemblGenomes-Gn; EBG00001160209.
DR   EnsemblGenomes-Gn; EBG00001160210.
DR   EnsemblGenomes-Gn; EBG00001160211.
DR   EnsemblGenomes-Gn; EBG00001160212.
DR   EnsemblGenomes-Gn; EBG00001160213.
DR   EnsemblGenomes-Gn; EBG00001160214.
DR   EnsemblGenomes-Gn; EBG00001160215.
DR   EnsemblGenomes-Gn; EBG00001160216.
DR   EnsemblGenomes-Gn; EBG00001160217.
DR   EnsemblGenomes-Gn; EBG00001160218.
DR   EnsemblGenomes-Gn; EBG00001160219.
DR   EnsemblGenomes-Gn; EBG00001160220.
DR   EnsemblGenomes-Gn; EBG00001160221.
DR   EnsemblGenomes-Gn; EBG00001160222.
DR   EnsemblGenomes-Gn; EBG00001160223.
DR   EnsemblGenomes-Gn; EBG00001160224.
DR   EnsemblGenomes-Gn; EBG00001160225.
DR   EnsemblGenomes-Gn; EBG00001160226.
DR   EnsemblGenomes-Gn; EBG00001160227.
DR   EnsemblGenomes-Gn; EBG00001160228.
DR   EnsemblGenomes-Gn; EBG00001160229.
DR   EnsemblGenomes-Gn; EBG00001160230.
DR   EnsemblGenomes-Gn; EBG00001160231.
DR   EnsemblGenomes-Gn; EBG00001160232.
DR   EnsemblGenomes-Gn; EBG00001160233.
DR   EnsemblGenomes-Gn; EBG00001160234.
DR   EnsemblGenomes-Gn; EBG00001160235.
DR   EnsemblGenomes-Gn; EBG00001160236.
DR   EnsemblGenomes-Gn; EBG00001160237.
DR   EnsemblGenomes-Gn; EBG00001160238.
DR   EnsemblGenomes-Gn; EBG00001160239.
DR   EnsemblGenomes-Gn; EBG00001160240.
DR   EnsemblGenomes-Gn; EBG00001160241.
DR   EnsemblGenomes-Gn; EBG00001160242.
DR   EnsemblGenomes-Gn; EBG00001160243.
DR   EnsemblGenomes-Gn; EBG00001160244.
DR   EnsemblGenomes-Gn; EBG00001160245.
DR   EnsemblGenomes-Gn; EBG00001160246.
DR   EnsemblGenomes-Gn; EBG00001160247.
DR   EnsemblGenomes-Gn; EBG00001160248.
DR   EnsemblGenomes-Gn; EBG00001160249.
DR   EnsemblGenomes-Gn; EBG00001160250.
DR   EnsemblGenomes-Gn; EBG00001160251.
DR   EnsemblGenomes-Gn; EBG00001160252.
DR   EnsemblGenomes-Gn; EBG00001160253.
DR   EnsemblGenomes-Gn; EBG00001160254.
DR   EnsemblGenomes-Gn; EBG00001160255.
DR   EnsemblGenomes-Gn; EBG00001160256.
DR   EnsemblGenomes-Gn; EBG00001160257.
DR   EnsemblGenomes-Gn; EBG00001160258.
DR   EnsemblGenomes-Gn; EBG00001160259.
DR   EnsemblGenomes-Gn; EBG00001160260.
DR   EnsemblGenomes-Gn; EBG00001160261.
DR   EnsemblGenomes-Gn; EBG00001160262.
DR   EnsemblGenomes-Gn; EBG00001160263.
DR   EnsemblGenomes-Gn; EBG00001160264.
DR   EnsemblGenomes-Gn; EBG00001160265.
DR   EnsemblGenomes-Gn; EBG00001160266.
DR   EnsemblGenomes-Gn; EBG00001160267.
DR   EnsemblGenomes-Gn; EBG00001160268.
DR   EnsemblGenomes-Gn; EBG00001160269.
DR   EnsemblGenomes-Gn; EBG00001160270.
DR   EnsemblGenomes-Gn; EBG00001160271.
DR   EnsemblGenomes-Gn; EBG00001160272.
DR   EnsemblGenomes-Gn; EBG00001160273.
DR   EnsemblGenomes-Gn; EBG00001160274.
DR   EnsemblGenomes-Gn; EBG00001160275.
DR   EnsemblGenomes-Gn; EBG00001160276.
DR   EnsemblGenomes-Gn; EBG00001160277.
DR   EnsemblGenomes-Gn; EBG00001160278.
DR   EnsemblGenomes-Gn; EBG00001160279.
DR   EnsemblGenomes-Gn; EBG00001160280.
DR   EnsemblGenomes-Gn; EBG00001160281.
DR   EnsemblGenomes-Gn; EBG00001160282.
DR   EnsemblGenomes-Gn; EBG00001160283.
DR   EnsemblGenomes-Gn; EBG00001160284.
DR   EnsemblGenomes-Gn; EBG00001160285.
DR   EnsemblGenomes-Gn; EBG00001160286.
DR   EnsemblGenomes-Gn; EBG00001160287.
DR   EnsemblGenomes-Gn; EBG00001160288.
DR   EnsemblGenomes-Gn; EBG00001160289.
DR   EnsemblGenomes-Gn; EBG00001160290.
DR   EnsemblGenomes-Gn; EBG00001160291.
DR   EnsemblGenomes-Gn; EBG00001160292.
DR   EnsemblGenomes-Gn; EBG00001160293.
DR   EnsemblGenomes-Gn; EBG00001160294.
DR   EnsemblGenomes-Gn; EBG00001160295.
DR   EnsemblGenomes-Gn; EBG00001160296.
DR   EnsemblGenomes-Gn; EBG00001160297.
DR   EnsemblGenomes-Gn; EBG00001160298.
DR   EnsemblGenomes-Gn; EBG00001160299.
DR   EnsemblGenomes-Gn; EBG00001160300.
DR   EnsemblGenomes-Gn; EBG00001160301.
DR   EnsemblGenomes-Gn; EBG00001160302.
DR   EnsemblGenomes-Gn; EBG00001160303.
DR   EnsemblGenomes-Gn; EBG00001160304.
DR   EnsemblGenomes-Gn; EBG00001160305.
DR   EnsemblGenomes-Gn; EBG00001160306.
DR   EnsemblGenomes-Gn; EBG00001160307.
DR   EnsemblGenomes-Gn; EBG00001160308.
DR   EnsemblGenomes-Gn; EBG00001160309.
DR   EnsemblGenomes-Gn; EBG00001160310.
DR   EnsemblGenomes-Gn; EBG00001160311.
DR   EnsemblGenomes-Gn; EBG00001160312.
DR   EnsemblGenomes-Gn; EBG00001160313.
DR   EnsemblGenomes-Gn; EBG00001160314.
DR   EnsemblGenomes-Gn; EBG00001160315.
DR   EnsemblGenomes-Gn; EBG00001160316.
DR   EnsemblGenomes-Gn; EBG00001160317.
DR   EnsemblGenomes-Gn; EBG00001160318.
DR   EnsemblGenomes-Gn; EBG00001160319.
DR   EnsemblGenomes-Gn; EBG00001160320.
DR   EnsemblGenomes-Gn; EBG00001160321.
DR   EnsemblGenomes-Gn; EBG00001160322.
DR   EnsemblGenomes-Gn; EBG00001160323.
DR   EnsemblGenomes-Gn; EBG00001160324.
DR   EnsemblGenomes-Gn; EBG00001160325.
DR   EnsemblGenomes-Gn; EBG00001160326.
DR   EnsemblGenomes-Gn; EBG00001160327.
DR   EnsemblGenomes-Gn; EBG00001160328.
DR   EnsemblGenomes-Gn; EBG00001160329.
DR   EnsemblGenomes-Gn; EBG00001160330.
DR   EnsemblGenomes-Gn; EBG00001160331.
DR   EnsemblGenomes-Gn; EBG00001160332.
DR   EnsemblGenomes-Gn; EBG00001160333.
DR   EnsemblGenomes-Gn; EBG00001160334.
DR   EnsemblGenomes-Gn; EBG00001160335.
DR   EnsemblGenomes-Gn; EBG00001160336.
DR   EnsemblGenomes-Gn; EBG00001160337.
DR   EnsemblGenomes-Gn; EBG00001160338.
DR   EnsemblGenomes-Gn; EBG00001160339.
DR   EnsemblGenomes-Gn; EBG00001160340.
DR   EnsemblGenomes-Gn; EBG00001160341.
DR   EnsemblGenomes-Gn; EBG00001160342.
DR   EnsemblGenomes-Gn; EBG00001160343.
DR   EnsemblGenomes-Gn; EBG00001160344.
DR   EnsemblGenomes-Gn; EBG00001160345.
DR   EnsemblGenomes-Gn; EBG00001160346.
DR   EnsemblGenomes-Gn; EBG00001160347.
DR   EnsemblGenomes-Gn; EBG00001160348.
DR   EnsemblGenomes-Gn; EBG00001160349.
DR   EnsemblGenomes-Gn; EBG00001160350.
DR   EnsemblGenomes-Gn; EBG00001160351.
DR   EnsemblGenomes-Gn; EBG00001160352.
DR   EnsemblGenomes-Gn; EBG00001160353.
DR   EnsemblGenomes-Gn; EBG00001160354.
DR   EnsemblGenomes-Gn; EBG00001160355.
DR   EnsemblGenomes-Gn; EBG00001160356.
DR   EnsemblGenomes-Gn; EBG00001160357.
DR   EnsemblGenomes-Gn; EBG00001160358.
DR   EnsemblGenomes-Gn; EBG00001160359.
DR   EnsemblGenomes-Gn; EBG00001160360.
DR   EnsemblGenomes-Gn; EBG00001160361.
DR   EnsemblGenomes-Gn; EBG00001160362.
DR   EnsemblGenomes-Gn; EBG00001160363.
DR   EnsemblGenomes-Gn; EBG00001160364.
DR   EnsemblGenomes-Gn; EBG00001160365.
DR   EnsemblGenomes-Gn; EBG00001160366.
DR   EnsemblGenomes-Gn; EBG00001160367.
DR   EnsemblGenomes-Gn; EBG00001160368.
DR   EnsemblGenomes-Gn; EBG00001160369.
DR   EnsemblGenomes-Gn; EBG00001160370.
DR   EnsemblGenomes-Gn; EBG00001160371.
DR   EnsemblGenomes-Gn; EBG00001160372.
DR   EnsemblGenomes-Gn; EBG00001160373.
DR   EnsemblGenomes-Gn; EBG00001160374.
DR   EnsemblGenomes-Gn; EBG00001160375.
DR   EnsemblGenomes-Gn; EBG00001160376.
DR   EnsemblGenomes-Gn; EBG00001160377.
DR   EnsemblGenomes-Gn; EBG00001160378.
DR   EnsemblGenomes-Gn; EBG00001160379.
DR   EnsemblGenomes-Gn; EBG00001160380.
DR   EnsemblGenomes-Gn; EBG00001160381.
DR   EnsemblGenomes-Gn; EBG00001160382.
DR   EnsemblGenomes-Gn; EBG00001160383.
DR   EnsemblGenomes-Gn; EBG00001160384.
DR   EnsemblGenomes-Gn; EBG00001160385.
DR   EnsemblGenomes-Gn; EBG00001160386.
DR   EnsemblGenomes-Gn; EBG00001160387.
DR   EnsemblGenomes-Gn; EBG00001160388.
DR   EnsemblGenomes-Gn; EBG00001160389.
DR   EnsemblGenomes-Gn; EBG00001160390.
DR   EnsemblGenomes-Gn; EBG00001160391.
DR   EnsemblGenomes-Gn; EBG00001160392.
DR   EnsemblGenomes-Gn; EBG00001160393.
DR   EnsemblGenomes-Gn; EBG00001160394.
DR   EnsemblGenomes-Gn; EBG00001160395.
DR   EnsemblGenomes-Gn; EBG00001160396.
DR   EnsemblGenomes-Gn; EBG00001160397.
DR   EnsemblGenomes-Gn; EBG00001160398.
DR   EnsemblGenomes-Gn; EBG00001160399.
DR   EnsemblGenomes-Gn; EBG00001160400.
DR   EnsemblGenomes-Gn; EBG00001160401.
DR   EnsemblGenomes-Gn; EBG00001160402.
DR   EnsemblGenomes-Gn; EBG00001160403.
DR   EnsemblGenomes-Gn; EBG00001160404.
DR   EnsemblGenomes-Gn; EBG00001160405.
DR   EnsemblGenomes-Gn; EBG00001160406.
DR   EnsemblGenomes-Gn; EBG00001160407.
DR   EnsemblGenomes-Gn; EBG00001160408.
DR   EnsemblGenomes-Gn; EBG00001160409.
DR   EnsemblGenomes-Gn; EBG00001160410.
DR   EnsemblGenomes-Gn; EBG00001160411.
DR   EnsemblGenomes-Gn; EBG00001160412.
DR   EnsemblGenomes-Gn; EBG00001160413.
DR   EnsemblGenomes-Gn; EBG00001160414.
DR   EnsemblGenomes-Gn; EBG00001160415.
DR   EnsemblGenomes-Gn; EBG00001160416.
DR   EnsemblGenomes-Gn; EBG00001160417.
DR   EnsemblGenomes-Gn; EBG00001160418.
DR   EnsemblGenomes-Gn; EBG00001160419.
DR   EnsemblGenomes-Gn; EBG00001160420.
DR   EnsemblGenomes-Gn; EBG00001160421.
DR   EnsemblGenomes-Gn; EBG00001160422.
DR   EnsemblGenomes-Gn; EBG00001160424.
DR   EnsemblGenomes-Gn; EBG00001160425.
DR   EnsemblGenomes-Gn; EBG00001160426.
DR   EnsemblGenomes-Gn; EBG00001160427.
DR   EnsemblGenomes-Gn; EBG00001160428.
DR   EnsemblGenomes-Gn; EBG00001160429.
DR   EnsemblGenomes-Gn; EBG00001160430.
DR   EnsemblGenomes-Gn; EBG00001160431.
DR   EnsemblGenomes-Gn; EBG00001160432.
DR   EnsemblGenomes-Gn; EBG00001160433.
DR   EnsemblGenomes-Gn; EBG00001160434.
DR   EnsemblGenomes-Gn; EBG00001160435.
DR   EnsemblGenomes-Gn; EBG00001160436.
DR   EnsemblGenomes-Gn; EBG00001160437.
DR   EnsemblGenomes-Gn; EBG00001160438.
DR   EnsemblGenomes-Gn; EBG00001160439.
DR   EnsemblGenomes-Gn; EBG00001160440.
DR   EnsemblGenomes-Gn; EBG00001160441.
DR   EnsemblGenomes-Gn; EBG00001160442.
DR   EnsemblGenomes-Gn; EBG00001160443.
DR   EnsemblGenomes-Gn; EBG00001160444.
DR   EnsemblGenomes-Gn; EBG00001160445.
DR   EnsemblGenomes-Gn; EBG00001160446.
DR   EnsemblGenomes-Gn; EBG00001160447.
DR   EnsemblGenomes-Gn; EBG00001160448.
DR   EnsemblGenomes-Gn; EBG00001160449.
DR   EnsemblGenomes-Gn; EBG00001160450.
DR   EnsemblGenomes-Gn; EBG00001160451.
DR   EnsemblGenomes-Gn; EBG00001160452.
DR   EnsemblGenomes-Gn; EBG00001160453.
DR   EnsemblGenomes-Gn; EBG00001160454.
DR   EnsemblGenomes-Gn; EBG00001160455.
DR   EnsemblGenomes-Gn; EBG00001160456.
DR   EnsemblGenomes-Gn; EBG00001160457.
DR   EnsemblGenomes-Gn; EBG00001160458.
DR   EnsemblGenomes-Gn; EBG00001160459.
DR   EnsemblGenomes-Gn; EBG00001160460.
DR   EnsemblGenomes-Gn; EBG00001160461.
DR   EnsemblGenomes-Gn; EBG00001160462.
DR   EnsemblGenomes-Gn; EBG00001160463.
DR   EnsemblGenomes-Gn; EBG00001160464.
DR   EnsemblGenomes-Gn; EBG00001160465.
DR   EnsemblGenomes-Gn; EBG00001160466.
DR   EnsemblGenomes-Gn; EBG00001160467.
DR   EnsemblGenomes-Gn; EBG00001160468.
DR   EnsemblGenomes-Gn; EBG00001160469.
DR   EnsemblGenomes-Gn; EBG00001160470.
DR   EnsemblGenomes-Gn; EBG00001160471.
DR   EnsemblGenomes-Gn; EBG00001160472.
DR   EnsemblGenomes-Gn; EBG00001160473.
DR   EnsemblGenomes-Gn; EBG00001160474.
DR   EnsemblGenomes-Gn; EBG00001160475.
DR   EnsemblGenomes-Gn; EBG00001160476.
DR   EnsemblGenomes-Gn; EBG00001160477.
DR   EnsemblGenomes-Gn; EBG00001160478.
DR   EnsemblGenomes-Gn; EBG00001160479.
DR   EnsemblGenomes-Gn; EBG00001160480.
DR   EnsemblGenomes-Gn; EBG00001160481.
DR   EnsemblGenomes-Gn; EBG00001160482.
DR   EnsemblGenomes-Gn; EBG00001160483.
DR   EnsemblGenomes-Gn; EBG00001160484.
DR   EnsemblGenomes-Gn; EBG00001160485.
DR   EnsemblGenomes-Gn; EBG00001160486.
DR   EnsemblGenomes-Gn; EBG00001160487.
DR   EnsemblGenomes-Gn; EBG00001160488.
DR   EnsemblGenomes-Gn; EBG00001160489.
DR   EnsemblGenomes-Gn; EBG00001160490.
DR   EnsemblGenomes-Gn; EBG00001160491.
DR   EnsemblGenomes-Gn; EBG00001160492.
DR   EnsemblGenomes-Gn; EBG00001160493.
DR   EnsemblGenomes-Gn; EBG00001160494.
DR   EnsemblGenomes-Gn; EBG00001160495.
DR   EnsemblGenomes-Gn; EBG00001160496.
DR   EnsemblGenomes-Gn; EBG00001160497.
DR   EnsemblGenomes-Gn; EBG00001160498.
DR   EnsemblGenomes-Gn; EBG00001160499.
DR   EnsemblGenomes-Gn; EBG00001160500.
DR   EnsemblGenomes-Gn; EBG00001160501.
DR   EnsemblGenomes-Gn; EBG00001160502.
DR   EnsemblGenomes-Gn; EBG00001160503.
DR   EnsemblGenomes-Gn; EBG00001160504.
DR   EnsemblGenomes-Gn; EBG00001160505.
DR   EnsemblGenomes-Gn; EBG00001160506.
DR   EnsemblGenomes-Gn; EBG00001160507.
DR   EnsemblGenomes-Gn; EBG00001160508.
DR   EnsemblGenomes-Gn; EBG00001160509.
DR   EnsemblGenomes-Gn; EBG00001160510.
DR   EnsemblGenomes-Gn; EBG00001160511.
DR   EnsemblGenomes-Gn; EBG00001160512.
DR   EnsemblGenomes-Gn; EBG00001160513.
DR   EnsemblGenomes-Gn; EBG00001160514.
DR   EnsemblGenomes-Gn; EBG00001160515.
DR   EnsemblGenomes-Gn; EBG00001160516.
DR   EnsemblGenomes-Gn; EBG00001160517.
DR   EnsemblGenomes-Gn; EBG00001160518.
DR   EnsemblGenomes-Gn; EBG00001160519.
DR   EnsemblGenomes-Gn; EBG00001160520.
DR   EnsemblGenomes-Gn; EBG00001160521.
DR   EnsemblGenomes-Gn; EBG00001160522.
DR   EnsemblGenomes-Gn; EBG00001160523.
DR   EnsemblGenomes-Gn; EBG00001160524.
DR   EnsemblGenomes-Gn; EBG00001160525.
DR   EnsemblGenomes-Gn; EBG00001160526.
DR   EnsemblGenomes-Gn; EBG00001160527.
DR   EnsemblGenomes-Gn; EBG00001160528.
DR   EnsemblGenomes-Gn; EBG00001160529.
DR   EnsemblGenomes-Gn; EBG00001160530.
DR   EnsemblGenomes-Gn; Veis_R0001.
DR   EnsemblGenomes-Gn; Veis_R0003.
DR   EnsemblGenomes-Gn; Veis_R0004.
DR   EnsemblGenomes-Gn; Veis_R0005.
DR   EnsemblGenomes-Gn; Veis_R0006.
DR   EnsemblGenomes-Gn; Veis_R0007.
DR   EnsemblGenomes-Gn; Veis_R0008.
DR   EnsemblGenomes-Gn; Veis_R0009.
DR   EnsemblGenomes-Gn; Veis_R0010.
DR   EnsemblGenomes-Gn; Veis_R0011.
DR   EnsemblGenomes-Gn; Veis_R0012.
DR   EnsemblGenomes-Gn; Veis_R0013.
DR   EnsemblGenomes-Gn; Veis_R0014.
DR   EnsemblGenomes-Gn; Veis_R0015.
DR   EnsemblGenomes-Gn; Veis_R0016.
DR   EnsemblGenomes-Gn; Veis_R0017.
DR   EnsemblGenomes-Gn; Veis_R0018.
DR   EnsemblGenomes-Gn; Veis_R0019.
DR   EnsemblGenomes-Gn; Veis_R0020.
DR   EnsemblGenomes-Gn; Veis_R0021.
DR   EnsemblGenomes-Gn; Veis_R0022.
DR   EnsemblGenomes-Gn; Veis_R0024.
DR   EnsemblGenomes-Gn; Veis_R0025.
DR   EnsemblGenomes-Gn; Veis_R0026.
DR   EnsemblGenomes-Gn; Veis_R0027.
DR   EnsemblGenomes-Gn; Veis_R0028.
DR   EnsemblGenomes-Gn; Veis_R0029.
DR   EnsemblGenomes-Gn; Veis_R0030.
DR   EnsemblGenomes-Gn; Veis_R0031.
DR   EnsemblGenomes-Gn; Veis_R0032.
DR   EnsemblGenomes-Gn; Veis_R0033.
DR   EnsemblGenomes-Gn; Veis_R0034.
DR   EnsemblGenomes-Gn; Veis_R0035.
DR   EnsemblGenomes-Gn; Veis_R0036.
DR   EnsemblGenomes-Gn; Veis_R0037.
DR   EnsemblGenomes-Gn; Veis_R0038.
DR   EnsemblGenomes-Gn; Veis_R0039.
DR   EnsemblGenomes-Gn; Veis_R0040.
DR   EnsemblGenomes-Gn; Veis_R0041.
DR   EnsemblGenomes-Gn; Veis_R0042.
DR   EnsemblGenomes-Gn; Veis_R0043.
DR   EnsemblGenomes-Gn; Veis_R0044.
DR   EnsemblGenomes-Gn; Veis_R0045.
DR   EnsemblGenomes-Gn; Veis_R0046.
DR   EnsemblGenomes-Gn; Veis_R0047.
DR   EnsemblGenomes-Gn; Veis_R0048.
DR   EnsemblGenomes-Gn; Veis_R0049.
DR   EnsemblGenomes-Gn; Veis_R0050.
DR   EnsemblGenomes-Gn; Veis_R0052.
DR   EnsemblGenomes-Gn; Veis_R0053.
DR   EnsemblGenomes-Gn; Veis_R0054.
DR   EnsemblGenomes-Gn; Veis_R0055.
DR   EnsemblGenomes-Gn; Veis_R0056.
DR   EnsemblGenomes-Gn; Veis_R0057.
DR   EnsemblGenomes-Gn; Veis_R0058.
DR   EnsemblGenomes-Gn; Veis_R0059.
DR   EnsemblGenomes-Gn; Veis_R0060.
DR   EnsemblGenomes-Tr; EBT00001748706.
DR   EnsemblGenomes-Tr; EBT00001748707.
DR   EnsemblGenomes-Tr; EBT00001748708.
DR   EnsemblGenomes-Tr; EBT00001748709.
DR   EnsemblGenomes-Tr; EBT00001748710.
DR   EnsemblGenomes-Tr; EBT00001748711.
DR   EnsemblGenomes-Tr; EBT00001748712.
DR   EnsemblGenomes-Tr; EBT00001748713.
DR   EnsemblGenomes-Tr; EBT00001748714.
DR   EnsemblGenomes-Tr; EBT00001748715.
DR   EnsemblGenomes-Tr; EBT00001748716.
DR   EnsemblGenomes-Tr; EBT00001748717.
DR   EnsemblGenomes-Tr; EBT00001748718.
DR   EnsemblGenomes-Tr; EBT00001748719.
DR   EnsemblGenomes-Tr; EBT00001748720.
DR   EnsemblGenomes-Tr; EBT00001748721.
DR   EnsemblGenomes-Tr; EBT00001748722.
DR   EnsemblGenomes-Tr; EBT00001748723.
DR   EnsemblGenomes-Tr; EBT00001748724.
DR   EnsemblGenomes-Tr; EBT00001748726.
DR   EnsemblGenomes-Tr; EBT00001748727.
DR   EnsemblGenomes-Tr; EBT00001748728.
DR   EnsemblGenomes-Tr; EBT00001748730.
DR   EnsemblGenomes-Tr; EBT00001748731.
DR   EnsemblGenomes-Tr; EBT00001748732.
DR   EnsemblGenomes-Tr; EBT00001748733.
DR   EnsemblGenomes-Tr; EBT00001748734.
DR   EnsemblGenomes-Tr; EBT00001748735.
DR   EnsemblGenomes-Tr; EBT00001748736.
DR   EnsemblGenomes-Tr; EBT00001748737.
DR   EnsemblGenomes-Tr; EBT00001748738.
DR   EnsemblGenomes-Tr; EBT00001748739.
DR   EnsemblGenomes-Tr; EBT00001748740.
DR   EnsemblGenomes-Tr; EBT00001748741.
DR   EnsemblGenomes-Tr; EBT00001748742.
DR   EnsemblGenomes-Tr; EBT00001748743.
DR   EnsemblGenomes-Tr; EBT00001748744.
DR   EnsemblGenomes-Tr; EBT00001748745.
DR   EnsemblGenomes-Tr; EBT00001748746.
DR   EnsemblGenomes-Tr; EBT00001748747.
DR   EnsemblGenomes-Tr; EBT00001748748.
DR   EnsemblGenomes-Tr; EBT00001748749.
DR   EnsemblGenomes-Tr; EBT00001748750.
DR   EnsemblGenomes-Tr; EBT00001748751.
DR   EnsemblGenomes-Tr; EBT00001748752.
DR   EnsemblGenomes-Tr; EBT00001748753.
DR   EnsemblGenomes-Tr; EBT00001748754.
DR   EnsemblGenomes-Tr; EBT00001748756.
DR   EnsemblGenomes-Tr; EBT00001748757.
DR   EnsemblGenomes-Tr; EBT00001748758.
DR   EnsemblGenomes-Tr; EBT00001748759.
DR   EnsemblGenomes-Tr; EBT00001748760.
DR   EnsemblGenomes-Tr; EBT00001748761.
DR   EnsemblGenomes-Tr; EBT00001748762.
DR   EnsemblGenomes-Tr; EBT00001748763.
DR   EnsemblGenomes-Tr; EBT00001748764.
DR   EnsemblGenomes-Tr; EBT00001748765.
DR   EnsemblGenomes-Tr; EBT00001748766.
DR   EnsemblGenomes-Tr; EBT00001748767.
DR   EnsemblGenomes-Tr; EBT00001748768.
DR   EnsemblGenomes-Tr; EBT00001748769.
DR   EnsemblGenomes-Tr; EBT00001748770.
DR   EnsemblGenomes-Tr; EBT00001748771.
DR   EnsemblGenomes-Tr; EBT00001748772.
DR   EnsemblGenomes-Tr; EBT00001748773.
DR   EnsemblGenomes-Tr; EBT00001748774.
DR   EnsemblGenomes-Tr; EBT00001748775.
DR   EnsemblGenomes-Tr; EBT00001748776.
DR   EnsemblGenomes-Tr; EBT00001748777.
DR   EnsemblGenomes-Tr; EBT00001748778.
DR   EnsemblGenomes-Tr; EBT00001748779.
DR   EnsemblGenomes-Tr; EBT00001748780.
DR   EnsemblGenomes-Tr; EBT00001748781.
DR   EnsemblGenomes-Tr; EBT00001748782.
DR   EnsemblGenomes-Tr; EBT00001748783.
DR   EnsemblGenomes-Tr; EBT00001748784.
DR   EnsemblGenomes-Tr; EBT00001748785.
DR   EnsemblGenomes-Tr; EBT00001748786.
DR   EnsemblGenomes-Tr; EBT00001748787.
DR   EnsemblGenomes-Tr; EBT00001748788.
DR   EnsemblGenomes-Tr; EBT00001748789.
DR   EnsemblGenomes-Tr; EBT00001748790.
DR   EnsemblGenomes-Tr; EBT00001748791.
DR   EnsemblGenomes-Tr; EBT00001748792.
DR   EnsemblGenomes-Tr; EBT00001748793.
DR   EnsemblGenomes-Tr; EBT00001748794.
DR   EnsemblGenomes-Tr; EBT00001748795.
DR   EnsemblGenomes-Tr; EBT00001748796.
DR   EnsemblGenomes-Tr; EBT00001748797.
DR   EnsemblGenomes-Tr; EBT00001748798.
DR   EnsemblGenomes-Tr; EBT00001748799.
DR   EnsemblGenomes-Tr; EBT00001748800.
DR   EnsemblGenomes-Tr; EBT00001748801.
DR   EnsemblGenomes-Tr; EBT00001748802.
DR   EnsemblGenomes-Tr; EBT00001748803.
DR   EnsemblGenomes-Tr; EBT00001748804.
DR   EnsemblGenomes-Tr; EBT00001748805.
DR   EnsemblGenomes-Tr; EBT00001748806.
DR   EnsemblGenomes-Tr; EBT00001748807.
DR   EnsemblGenomes-Tr; EBT00001748808.
DR   EnsemblGenomes-Tr; EBT00001748809.
DR   EnsemblGenomes-Tr; EBT00001748810.
DR   EnsemblGenomes-Tr; EBT00001748811.
DR   EnsemblGenomes-Tr; EBT00001748812.
DR   EnsemblGenomes-Tr; EBT00001748813.
DR   EnsemblGenomes-Tr; EBT00001748814.
DR   EnsemblGenomes-Tr; EBT00001748815.
DR   EnsemblGenomes-Tr; EBT00001748816.
DR   EnsemblGenomes-Tr; EBT00001748817.
DR   EnsemblGenomes-Tr; EBT00001748818.
DR   EnsemblGenomes-Tr; EBT00001748819.
DR   EnsemblGenomes-Tr; EBT00001748820.
DR   EnsemblGenomes-Tr; EBT00001748821.
DR   EnsemblGenomes-Tr; EBT00001748822.
DR   EnsemblGenomes-Tr; EBT00001748823.
DR   EnsemblGenomes-Tr; EBT00001748824.
DR   EnsemblGenomes-Tr; EBT00001748825.
DR   EnsemblGenomes-Tr; EBT00001748826.
DR   EnsemblGenomes-Tr; EBT00001748827.
DR   EnsemblGenomes-Tr; EBT00001748828.
DR   EnsemblGenomes-Tr; EBT00001748829.
DR   EnsemblGenomes-Tr; EBT00001748830.
DR   EnsemblGenomes-Tr; EBT00001748831.
DR   EnsemblGenomes-Tr; EBT00001748832.
DR   EnsemblGenomes-Tr; EBT00001748833.
DR   EnsemblGenomes-Tr; EBT00001748834.
DR   EnsemblGenomes-Tr; EBT00001748835.
DR   EnsemblGenomes-Tr; EBT00001748836.
DR   EnsemblGenomes-Tr; EBT00001748837.
DR   EnsemblGenomes-Tr; EBT00001748838.
DR   EnsemblGenomes-Tr; EBT00001748839.
DR   EnsemblGenomes-Tr; EBT00001748840.
DR   EnsemblGenomes-Tr; EBT00001748841.
DR   EnsemblGenomes-Tr; EBT00001748842.
DR   EnsemblGenomes-Tr; EBT00001748843.
DR   EnsemblGenomes-Tr; EBT00001748844.
DR   EnsemblGenomes-Tr; EBT00001748845.
DR   EnsemblGenomes-Tr; EBT00001748846.
DR   EnsemblGenomes-Tr; EBT00001748847.
DR   EnsemblGenomes-Tr; EBT00001748848.
DR   EnsemblGenomes-Tr; EBT00001748849.
DR   EnsemblGenomes-Tr; EBT00001748850.
DR   EnsemblGenomes-Tr; EBT00001748851.
DR   EnsemblGenomes-Tr; EBT00001748852.
DR   EnsemblGenomes-Tr; EBT00001748853.
DR   EnsemblGenomes-Tr; EBT00001748854.
DR   EnsemblGenomes-Tr; EBT00001748855.
DR   EnsemblGenomes-Tr; EBT00001748856.
DR   EnsemblGenomes-Tr; EBT00001748857.
DR   EnsemblGenomes-Tr; EBT00001748858.
DR   EnsemblGenomes-Tr; EBT00001748859.
DR   EnsemblGenomes-Tr; EBT00001748860.
DR   EnsemblGenomes-Tr; EBT00001748861.
DR   EnsemblGenomes-Tr; EBT00001748862.
DR   EnsemblGenomes-Tr; EBT00001748863.
DR   EnsemblGenomes-Tr; EBT00001748864.
DR   EnsemblGenomes-Tr; EBT00001748865.
DR   EnsemblGenomes-Tr; EBT00001748866.
DR   EnsemblGenomes-Tr; EBT00001748867.
DR   EnsemblGenomes-Tr; EBT00001748868.
DR   EnsemblGenomes-Tr; EBT00001748869.
DR   EnsemblGenomes-Tr; EBT00001748870.
DR   EnsemblGenomes-Tr; EBT00001748871.
DR   EnsemblGenomes-Tr; EBT00001748872.
DR   EnsemblGenomes-Tr; EBT00001748873.
DR   EnsemblGenomes-Tr; EBT00001748874.
DR   EnsemblGenomes-Tr; EBT00001748875.
DR   EnsemblGenomes-Tr; EBT00001748876.
DR   EnsemblGenomes-Tr; EBT00001748877.
DR   EnsemblGenomes-Tr; EBT00001748878.
DR   EnsemblGenomes-Tr; EBT00001748879.
DR   EnsemblGenomes-Tr; EBT00001748880.
DR   EnsemblGenomes-Tr; EBT00001748882.
DR   EnsemblGenomes-Tr; EBT00001748883.
DR   EnsemblGenomes-Tr; EBT00001748884.
DR   EnsemblGenomes-Tr; EBT00001748885.
DR   EnsemblGenomes-Tr; EBT00001748886.
DR   EnsemblGenomes-Tr; EBT00001748887.
DR   EnsemblGenomes-Tr; EBT00001748888.
DR   EnsemblGenomes-Tr; EBT00001748889.
DR   EnsemblGenomes-Tr; EBT00001748890.
DR   EnsemblGenomes-Tr; EBT00001748891.
DR   EnsemblGenomes-Tr; EBT00001748892.
DR   EnsemblGenomes-Tr; EBT00001748893.
DR   EnsemblGenomes-Tr; EBT00001748894.
DR   EnsemblGenomes-Tr; EBT00001748895.
DR   EnsemblGenomes-Tr; EBT00001748896.
DR   EnsemblGenomes-Tr; EBT00001748897.
DR   EnsemblGenomes-Tr; EBT00001748898.
DR   EnsemblGenomes-Tr; EBT00001748899.
DR   EnsemblGenomes-Tr; EBT00001748900.
DR   EnsemblGenomes-Tr; EBT00001748901.
DR   EnsemblGenomes-Tr; EBT00001748902.
DR   EnsemblGenomes-Tr; EBT00001748903.
DR   EnsemblGenomes-Tr; EBT00001748904.
DR   EnsemblGenomes-Tr; EBT00001748905.
DR   EnsemblGenomes-Tr; EBT00001748906.
DR   EnsemblGenomes-Tr; EBT00001748907.
DR   EnsemblGenomes-Tr; EBT00001748908.
DR   EnsemblGenomes-Tr; EBT00001748909.
DR   EnsemblGenomes-Tr; EBT00001748910.
DR   EnsemblGenomes-Tr; EBT00001748911.
DR   EnsemblGenomes-Tr; EBT00001748912.
DR   EnsemblGenomes-Tr; EBT00001748913.
DR   EnsemblGenomes-Tr; EBT00001748914.
DR   EnsemblGenomes-Tr; EBT00001748915.
DR   EnsemblGenomes-Tr; EBT00001748916.
DR   EnsemblGenomes-Tr; EBT00001748917.
DR   EnsemblGenomes-Tr; EBT00001748918.
DR   EnsemblGenomes-Tr; EBT00001748919.
DR   EnsemblGenomes-Tr; EBT00001748920.
DR   EnsemblGenomes-Tr; EBT00001748921.
DR   EnsemblGenomes-Tr; EBT00001748922.
DR   EnsemblGenomes-Tr; EBT00001748923.
DR   EnsemblGenomes-Tr; EBT00001748924.
DR   EnsemblGenomes-Tr; EBT00001748925.
DR   EnsemblGenomes-Tr; EBT00001748926.
DR   EnsemblGenomes-Tr; EBT00001748927.
DR   EnsemblGenomes-Tr; EBT00001748928.
DR   EnsemblGenomes-Tr; EBT00001748929.
DR   EnsemblGenomes-Tr; EBT00001748930.
DR   EnsemblGenomes-Tr; EBT00001748931.
DR   EnsemblGenomes-Tr; EBT00001748932.
DR   EnsemblGenomes-Tr; EBT00001748933.
DR   EnsemblGenomes-Tr; EBT00001748934.
DR   EnsemblGenomes-Tr; EBT00001748935.
DR   EnsemblGenomes-Tr; EBT00001748936.
DR   EnsemblGenomes-Tr; EBT00001748937.
DR   EnsemblGenomes-Tr; EBT00001748938.
DR   EnsemblGenomes-Tr; EBT00001748939.
DR   EnsemblGenomes-Tr; EBT00001748940.
DR   EnsemblGenomes-Tr; EBT00001748941.
DR   EnsemblGenomes-Tr; EBT00001748942.
DR   EnsemblGenomes-Tr; EBT00001748943.
DR   EnsemblGenomes-Tr; EBT00001748944.
DR   EnsemblGenomes-Tr; EBT00001748945.
DR   EnsemblGenomes-Tr; EBT00001748946.
DR   EnsemblGenomes-Tr; EBT00001748947.
DR   EnsemblGenomes-Tr; EBT00001748948.
DR   EnsemblGenomes-Tr; EBT00001748949.
DR   EnsemblGenomes-Tr; EBT00001748950.
DR   EnsemblGenomes-Tr; EBT00001748951.
DR   EnsemblGenomes-Tr; EBT00001748952.
DR   EnsemblGenomes-Tr; EBT00001748953.
DR   EnsemblGenomes-Tr; EBT00001748954.
DR   EnsemblGenomes-Tr; EBT00001748955.
DR   EnsemblGenomes-Tr; EBT00001748956.
DR   EnsemblGenomes-Tr; EBT00001748957.
DR   EnsemblGenomes-Tr; EBT00001748958.
DR   EnsemblGenomes-Tr; EBT00001748959.
DR   EnsemblGenomes-Tr; EBT00001748960.
DR   EnsemblGenomes-Tr; EBT00001748961.
DR   EnsemblGenomes-Tr; EBT00001748962.
DR   EnsemblGenomes-Tr; EBT00001748963.
DR   EnsemblGenomes-Tr; EBT00001748964.
DR   EnsemblGenomes-Tr; EBT00001748965.
DR   EnsemblGenomes-Tr; EBT00001748966.
DR   EnsemblGenomes-Tr; EBT00001748967.
DR   EnsemblGenomes-Tr; EBT00001748968.
DR   EnsemblGenomes-Tr; EBT00001748969.
DR   EnsemblGenomes-Tr; EBT00001748970.
DR   EnsemblGenomes-Tr; EBT00001748971.
DR   EnsemblGenomes-Tr; EBT00001748972.
DR   EnsemblGenomes-Tr; EBT00001748973.
DR   EnsemblGenomes-Tr; EBT00001748974.
DR   EnsemblGenomes-Tr; EBT00001748975.
DR   EnsemblGenomes-Tr; EBT00001748976.
DR   EnsemblGenomes-Tr; EBT00001748977.
DR   EnsemblGenomes-Tr; EBT00001748978.
DR   EnsemblGenomes-Tr; EBT00001748979.
DR   EnsemblGenomes-Tr; EBT00001748980.
DR   EnsemblGenomes-Tr; EBT00001748981.
DR   EnsemblGenomes-Tr; EBT00001748982.
DR   EnsemblGenomes-Tr; EBT00001748983.
DR   EnsemblGenomes-Tr; EBT00001748984.
DR   EnsemblGenomes-Tr; EBT00001748985.
DR   EnsemblGenomes-Tr; EBT00001748986.
DR   EnsemblGenomes-Tr; EBT00001748987.
DR   EnsemblGenomes-Tr; EBT00001748988.
DR   EnsemblGenomes-Tr; EBT00001748989.
DR   EnsemblGenomes-Tr; EBT00001748990.
DR   EnsemblGenomes-Tr; EBT00001748991.
DR   EnsemblGenomes-Tr; EBT00001748992.
DR   EnsemblGenomes-Tr; EBT00001748993.
DR   EnsemblGenomes-Tr; EBT00001748994.
DR   EnsemblGenomes-Tr; EBT00001748995.
DR   EnsemblGenomes-Tr; EBT00001748996.
DR   EnsemblGenomes-Tr; EBT00001748997.
DR   EnsemblGenomes-Tr; EBT00001748998.
DR   EnsemblGenomes-Tr; EBT00001748999.
DR   EnsemblGenomes-Tr; EBT00001749000.
DR   EnsemblGenomes-Tr; EBT00001749001.
DR   EnsemblGenomes-Tr; EBT00001749002.
DR   EnsemblGenomes-Tr; EBT00001749003.
DR   EnsemblGenomes-Tr; EBT00001749004.
DR   EnsemblGenomes-Tr; EBT00001749005.
DR   EnsemblGenomes-Tr; EBT00001749006.
DR   EnsemblGenomes-Tr; EBT00001749007.
DR   EnsemblGenomes-Tr; EBT00001749008.
DR   EnsemblGenomes-Tr; EBT00001749009.
DR   EnsemblGenomes-Tr; EBT00001749010.
DR   EnsemblGenomes-Tr; EBT00001749011.
DR   EnsemblGenomes-Tr; EBT00001749012.
DR   EnsemblGenomes-Tr; EBT00001749013.
DR   EnsemblGenomes-Tr; EBT00001749014.
DR   EnsemblGenomes-Tr; EBT00001749015.
DR   EnsemblGenomes-Tr; EBT00001749016.
DR   EnsemblGenomes-Tr; EBT00001749017.
DR   EnsemblGenomes-Tr; EBT00001749018.
DR   EnsemblGenomes-Tr; EBT00001749019.
DR   EnsemblGenomes-Tr; EBT00001749020.
DR   EnsemblGenomes-Tr; EBT00001749021.
DR   EnsemblGenomes-Tr; EBT00001749023.
DR   EnsemblGenomes-Tr; EBT00001749024.
DR   EnsemblGenomes-Tr; EBT00001749025.
DR   EnsemblGenomes-Tr; EBT00001749026.
DR   EnsemblGenomes-Tr; EBT00001749027.
DR   EnsemblGenomes-Tr; EBT00001749028.
DR   EnsemblGenomes-Tr; EBT00001749029.
DR   EnsemblGenomes-Tr; EBT00001749030.
DR   EnsemblGenomes-Tr; EBT00001749031.
DR   EnsemblGenomes-Tr; EBT00001749032.
DR   EnsemblGenomes-Tr; EBT00001749033.
DR   EnsemblGenomes-Tr; EBT00001749034.
DR   EnsemblGenomes-Tr; EBT00001749035.
DR   EnsemblGenomes-Tr; EBT00001749036.
DR   EnsemblGenomes-Tr; EBT00001749037.
DR   EnsemblGenomes-Tr; EBT00001749038.
DR   EnsemblGenomes-Tr; EBT00001749039.
DR   EnsemblGenomes-Tr; EBT00001749040.
DR   EnsemblGenomes-Tr; EBT00001749041.
DR   EnsemblGenomes-Tr; EBT00001749042.
DR   EnsemblGenomes-Tr; EBT00001749043.
DR   EnsemblGenomes-Tr; EBT00001749044.
DR   EnsemblGenomes-Tr; EBT00001749045.
DR   EnsemblGenomes-Tr; EBT00001749046.
DR   EnsemblGenomes-Tr; EBT00001749047.
DR   EnsemblGenomes-Tr; EBT00001749048.
DR   EnsemblGenomes-Tr; EBT00001749049.
DR   EnsemblGenomes-Tr; EBT00001749050.
DR   EnsemblGenomes-Tr; EBT00001749051.
DR   EnsemblGenomes-Tr; EBT00001749052.
DR   EnsemblGenomes-Tr; EBT00001749053.
DR   EnsemblGenomes-Tr; EBT00001749054.
DR   EnsemblGenomes-Tr; EBT00001749055.
DR   EnsemblGenomes-Tr; EBT00001749056.
DR   EnsemblGenomes-Tr; EBT00001749058.
DR   EnsemblGenomes-Tr; EBT00001749059.
DR   EnsemblGenomes-Tr; EBT00001749060.
DR   EnsemblGenomes-Tr; EBT00001749061.
DR   EnsemblGenomes-Tr; EBT00001749062.
DR   EnsemblGenomes-Tr; EBT00001749063.
DR   EnsemblGenomes-Tr; EBT00001749064.
DR   EnsemblGenomes-Tr; EBT00001749065.
DR   EnsemblGenomes-Tr; EBT00001749066.
DR   EnsemblGenomes-Tr; EBT00001749067.
DR   EnsemblGenomes-Tr; EBT00001749068.
DR   EnsemblGenomes-Tr; EBT00001749069.
DR   EnsemblGenomes-Tr; EBT00001749070.
DR   EnsemblGenomes-Tr; EBT00001749071.
DR   EnsemblGenomes-Tr; Veis_R0001-1.
DR   EnsemblGenomes-Tr; Veis_R0003-1.
DR   EnsemblGenomes-Tr; Veis_R0004-1.
DR   EnsemblGenomes-Tr; Veis_R0005-1.
DR   EnsemblGenomes-Tr; Veis_R0006-1.
DR   EnsemblGenomes-Tr; Veis_R0007-1.
DR   EnsemblGenomes-Tr; Veis_R0008-1.
DR   EnsemblGenomes-Tr; Veis_R0009-1.
DR   EnsemblGenomes-Tr; Veis_R0010-1.
DR   EnsemblGenomes-Tr; Veis_R0011-1.
DR   EnsemblGenomes-Tr; Veis_R0012-1.
DR   EnsemblGenomes-Tr; Veis_R0013-1.
DR   EnsemblGenomes-Tr; Veis_R0014-1.
DR   EnsemblGenomes-Tr; Veis_R0015-1.
DR   EnsemblGenomes-Tr; Veis_R0016-1.
DR   EnsemblGenomes-Tr; Veis_R0017-1.
DR   EnsemblGenomes-Tr; Veis_R0018-1.
DR   EnsemblGenomes-Tr; Veis_R0019-1.
DR   EnsemblGenomes-Tr; Veis_R0020-1.
DR   EnsemblGenomes-Tr; Veis_R0021-1.
DR   EnsemblGenomes-Tr; Veis_R0022-1.
DR   EnsemblGenomes-Tr; Veis_R0024-1.
DR   EnsemblGenomes-Tr; Veis_R0025-1.
DR   EnsemblGenomes-Tr; Veis_R0026-1.
DR   EnsemblGenomes-Tr; Veis_R0027-1.
DR   EnsemblGenomes-Tr; Veis_R0028-1.
DR   EnsemblGenomes-Tr; Veis_R0029-1.
DR   EnsemblGenomes-Tr; Veis_R0030-1.
DR   EnsemblGenomes-Tr; Veis_R0031-1.
DR   EnsemblGenomes-Tr; Veis_R0032-1.
DR   EnsemblGenomes-Tr; Veis_R0033-1.
DR   EnsemblGenomes-Tr; Veis_R0034-1.
DR   EnsemblGenomes-Tr; Veis_R0035-1.
DR   EnsemblGenomes-Tr; Veis_R0036-1.
DR   EnsemblGenomes-Tr; Veis_R0037-1.
DR   EnsemblGenomes-Tr; Veis_R0038-1.
DR   EnsemblGenomes-Tr; Veis_R0039-1.
DR   EnsemblGenomes-Tr; Veis_R0040-1.
DR   EnsemblGenomes-Tr; Veis_R0041-1.
DR   EnsemblGenomes-Tr; Veis_R0042-1.
DR   EnsemblGenomes-Tr; Veis_R0043-1.
DR   EnsemblGenomes-Tr; Veis_R0044-1.
DR   EnsemblGenomes-Tr; Veis_R0045-1.
DR   EnsemblGenomes-Tr; Veis_R0046-1.
DR   EnsemblGenomes-Tr; Veis_R0047-1.
DR   EnsemblGenomes-Tr; Veis_R0048-1.
DR   EnsemblGenomes-Tr; Veis_R0049-1.
DR   EnsemblGenomes-Tr; Veis_R0050-1.
DR   EnsemblGenomes-Tr; Veis_R0052-1.
DR   EnsemblGenomes-Tr; Veis_R0053-1.
DR   EnsemblGenomes-Tr; Veis_R0054-1.
DR   EnsemblGenomes-Tr; Veis_R0055-1.
DR   EnsemblGenomes-Tr; Veis_R0056-1.
DR   EnsemblGenomes-Tr; Veis_R0057-1.
DR   EnsemblGenomes-Tr; Veis_R0058-1.
DR   EnsemblGenomes-Tr; Veis_R0059-1.
DR   EnsemblGenomes-Tr; Veis_R0060-1.
DR   EuropePMC; PMC2443923; 18458128.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01811; PtaRNA1.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000542.
DR   SILVA-SSU; CP000542.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001428
CC   Source DNA and bacteria available from David Stahl
CC   (dastahl@u.washington.edu)
CC   Contacts: David Stahl (dastahl@u.washington.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5566749
FT                   /organism="Verminephrobacter eiseniae EF01-2"
FT                   /strain="EF01-2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:391735"
FT   gene            493..1944
FT                   /locus_tag="Veis_0001"
FT   CDS_pept        493..1944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: rfr:Rfer_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55794"
FT                   /db_xref="GOA:A1WDT7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDT7"
FT                   /protein_id="ABM55794.1"
FT                   /translation="MTEEFTHSPPPPLHWPGANAADERSAGQGLWQACAEQLARDLPEA
FT                   QFNTWIKPLVAQVAQDFSKITLLVGNRFKLDWIRAQYASQITALLGDLYGQPMALELAL
FT                   VPRESVARTAHTPRPSASGPPGAPGAESASAGRDEAPQALRHRLNAALTFETLVEGSAN
FT                   RMARSAGMHVAGMPGHLYNPLFVYGGVGLGKTHLVHAVGNRLLASRPQAKVLYVHAEQF
FT                   VSDVVRSYQRRTFDEFKERYHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLTKKSHLV
FT                   MTSDTYPKGLSNIHERLVSRFDSGLTVAIEPPELEMRVAILINKAQAESTEMPEEVAFF
FT                   VAKNVRSNVRELEGALRKILAYSRFNQKEISIQLAREALRDLLSIQNRQISVENIQKTV
FT                   ADYYKIKVADMYSKKRPASIARPRQIAMYLTKELTQKSLPEIGESFGGRDHTTVLHAVR
FT                   KIAAERQQLTELNQQLHVLEQTLKG"
FT   gene            2040..3158
FT                   /locus_tag="Veis_0002"
FT   CDS_pept        2040..3158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rfr:Rfer_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55795"
FT                   /db_xref="GOA:A1WDT8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDT8"
FT                   /protein_id="ABM55795.1"
FT                   /translation="MIVLKATQDKVLAALQSVAGIVERRHTLPILANVLIRKTGNALQL
FT                   TTSDLEIQIRTTAELGGDTGECMTTMSVRKLIDILRTMPGEQTVSLESDQSRLILKAGK
FT                   SRFTLHSLPGQDFPLVQESAAFGPVFSVPQKTLKSLLGQVSFTMAVQDIRYYLNGILFV
FT                   AEGQTLSLIATDGHRLAFACATLDVQVPKQEVILPRKTVLELQRLLSDADGDNRPHIEM
FT                   QFASNQAKFTFGGMEFVTKLVEGKFPDYNRVIPKNHHNCVTLGRAALLTSLQRTAIMTS
FT                   DKFKGVRLNLEPGALRVASSNAEQEEAVDELDVDYAGDNIEIGFNVTYLIDALANMEQD
FT                   MVQLAFADGNSSALLTIPANDNFKYVVMPMRI"
FT   gene            3321..5927
FT                   /locus_tag="Veis_0003"
FT   CDS_pept        3321..5927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: pol:Bpro_0003 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55796"
FT                   /db_xref="GOA:A1WDT9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDT9"
FT                   /protein_id="ABM55796.1"
FT                   /translation="MTADNPLPEPAPGGTGGPALPKIDTRQAGASESYDAGAITILEGL
FT                   EAVRKRPGMYIGDTSDGTGLHHLVFEVVDNSIDEALAGHCDDIVVTIHTDNSISVTDNG
FT                   RGIPTGVKFDDKHEPRRSAAEIALTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSKWL
FT                   RLTVRREGRVHQLEFARGFVQDRLLDTVDGVAVSPMKLAGATEKRGTEVHFLPDAEIFK
FT                   ENRDFHYEILAKRLRELSFLNNGVRIRLKDERSGKEDDFSGAGGVRGFVEFINKGKTAL
FT                   HPNSFYATGERPAETYGGIPGTHIGVEVAMQWNSAYAEQVLCFTNNIPQRDGGTHLTGL
FT                   RAAMTRVINKYIEETEMAKKAKVEVTGDDMREGLCCVLSVKLPEPKFSSQTKDKLVSSE
FT                   VRAPVEDIVGKLLADYLQEKPADAKIICSKIVDAARAREAARKAREMTRRKGALDGLGL
FT                   PGKLADCQEKDPALCEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARYEKLL
FT                   TSDAILTLITALGTGIGKAGGSAGGDDFDAAKLRYHRIIIMTDADVDGAHIRTLLLTFF
FT                   YRQMPELVERGHIYIAQPPLYKVKAGKEELYLKDDPALDNFLLRIALNQASVLTGNADQ
FT                   AVLSGATLTELARKHQSAESVIARLSHFMDAEALRAMADGVRLRLGSLADAQASAVALQ
FT                   AKLRELHTTGAPAEVTGEFDARTDKPLLRISRRHHGNIKSSAITQDFVHGADYAALAEA
FT                   AETFRGLLGANAKAMRGEAEKQKEEKISDFRQAMKWLISEAERTTTRQRYKGLGEMNPE
FT                   QLWETTMDPSVRRLLRVQIDDAIEADRVFTMLMGDEVEPRRDFIEMNALRAGNIDV"
FT   gene            complement(7315..7905)
FT                   /locus_tag="Veis_0004"
FT   CDS_pept        complement(7315..7905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0004"
FT                   /product="mobile mystery protein B"
FT                   /note="TIGRFAM: mobile mystery protein B; PFAM:
FT                   filamentation induced by cAMP protein Fic; KEGG:
FT                   gsu:GSU1391 Fic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55797"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR013436"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDU0"
FT                   /protein_id="ABM55797.1"
FT                   /translation="MAIDLDEQDGQTPLDPDEKAGLIPEHLVTKGDLNDWEQENILRAV
FT                   RWLKRARAPDVLSEGFCRELHKQMFGKTWSWAGTFRKSDKNIGCDWTQVAVRLKNLFDN
FT                   TRWWAENATFPPDEIGARFHRDLVWIHPFPNGNGRHARMMADALVRSLGEPAFSWGSGG
FT                   NLVAANEARARYLAALRAADQGDYQLLLAFVRS"
FT   gene            complement(7896..8411)
FT                   /locus_tag="Veis_0005"
FT   CDS_pept        complement(7896..8411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0005"
FT                   /product="mobile mystery protein A"
FT                   /note="TIGRFAM: mobile mystery protein A; SMART:
FT                   helix-turn-helix domain protein; KEGG: gsu:GSU1390
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55798"
FT                   /db_xref="GOA:A1WDU1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013435"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDU1"
FT                   /protein_id="ABM55798.1"
FT                   /translation="MIHYRLSCCLKKSAYRLAMSPELNQLRLEQLQATLSSYADLVKRQ
FT                   TPPRGWLKLIREALGRTERQQAQRLGISGPTLHKSEQSEADDRITLGQLRKLADGLDCE
FT                   LVYALVPRRPLTEVVQERARTIAVEEVGSVAHTMGLEDQRPGADRLRKQVERRTEELLR
FT                   GRWSDLWR"
FT   gene            8724..11030
FT                   /locus_tag="Veis_0006"
FT   CDS_pept        8724..11030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0006"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="PFAM: type III restriction enzyme, res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases-like; KEGG: dde:Dde_2493 DEAD/DEAH box
FT                   helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55799"
FT                   /db_xref="GOA:A1WDU2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDU2"
FT                   /protein_id="ABM55799.1"
FT                   /translation="MCQYLEANGVKWRTPQPPVDRAPPPPFAKLSTDEKVRLFRGLFRG
FT                   RTDVYPVRWESKTTGKSGYAPACLNEWAAGICHKPRIKCADCEHRSLASITDPVIYDHL
FT                   AGEHTVGIYPLLHDNTCHFLAVDFDEQEWREDALAFVESCRTLGVPAALEISRSGDGAH
FT                   VWLFFSQKVDARDARRLGTALISHVCARTRQLKLSSYDRLLPNQDTMPKGGFGNLIALP
FT                   LQKKPRDAGRSVFVDDEFLPYPDQWGFLASVRRMPVEDIEPTILQATGGSHPLDVTFIE
FT                   DEDHQTPWLTPLRTSKKISGPLPESLHLTLANLVYFPKEGLPQALANRLIRLAAFQNPE
FT                   FYKAQAMRFAVWDKPRVIGCAENYPNHIALPRGCLDDAVSLLAANGIRAVVQDERFQGA
FT                   QIDVRFAGTLRDDQEVAVGATLQHDTGVLCAPTAFGKTVTAAAVIARRGVNTLVLVHRT
FT                   ELLTQWQERLQSFLAADKNVIGRIGGGKSKPTGKIDIAVMQSLARNEELSALLDNYGQV
FT                   IVDECHHIGAVSFDLLLRRAKAKYVLGLTATPVRRDGQHPIIFMQCGPIRHTAQRPDSA
FT                   PQRMEFHPIRVAGSLEVPGDAGIQDIFTSLVNDVRRTREIVDAVLECYGQGRKILVLTE
FT                   RTDHIATLADAFRKIAPRIFILHGRMSRKERMATTAELDQLPPTAARILLASGKLVGEG
FT                   FDHPALDTLALAMPVSWRGTLQQYAGRLHREHSAKTDVRILDFVDTGHPALHRMWEKRL
FT                   RGYSAMGYSIAPRLV"
FT   gene            11421..12317
FT                   /locus_tag="Veis_0007"
FT   CDS_pept        11421..12317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0007"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rsp:RSP_3400 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55800"
FT                   /db_xref="GOA:A1WDU3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDU3"
FT                   /protein_id="ABM55800.1"
FT                   /translation="MNLRFVETFVWVARLGSFRAAAERLNATQAAVSNRIASLEAEMGC
FT                   ELFERMPGGVRLSTVGQRALQPAEELLRTATSFKVAISSPLQLRATISIGTIDSIVHAW
FT                   LPQFIEQVKARFPALGLDLNVDTSLGIARDICERRLDLALLMGPVLRTGLKNIDLCSME
FT                   CLWVAAPSFGLGGQPLRLQELRAHPVLSFSRNSVQHVWLLRQFEELGVPPPVISNSNSL
FT                   SAVSRLACDGVGVALLPLPVAAAAIATGALERLSITPQFPALKLHAVYADDPENLIPSM
FT                   LAVIAREVSLSAAKGAP"
FT   gene            12341..13222
FT                   /locus_tag="Veis_0008"
FT   CDS_pept        12341..13222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_3182 peptidase C14, caspase catalytic
FT                   subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55801"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDU4"
FT                   /protein_id="ABM55801.1"
FT                   /translation="MAHKVCSNCAATATAMTSGCLPAMPGMPMGQVTCANSCGLKPRPR
FT                   RRLENAAHLGWLPISPMKRKSCCAHWRRRQAATSSRSSAWQKLMISTREPAASAGTAPC
FT                   TGSECSQTAPGGGSGAKMPSRLSIQVSANGKGASTRASACPTCPAPNSATGCKRGARRR
FT                   ASPGASTALRRSKPRCTTPPQHCPKDGPSAQRIGPASAPCARRRRASVIACHSRCPPPM
FT                   LPTSRSANTAIQAPGSRGAEPRVEATVTRQAGPAAKPSSSTRKFPSAIFAIPSPSFAVP
FT                   SPSPGPPATGPW"
FT   sig_peptide     12341..12433
FT                   /locus_tag="Veis_0008"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.704) with cleavage site probability 0.526 at
FT                   residue 31"
FT   gene            13414..14997
FT                   /locus_tag="Veis_0009"
FT   CDS_pept        13414..14997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0009"
FT                   /product="protein of unknown function DUF894, DitE"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   major facilitator superfamily MFS_1; KEGG: pol:Bpro_4167
FT                   protein of unknown function DUF894, DitE"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55802"
FT                   /db_xref="GOA:A1WDU5"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDU5"
FT                   /protein_id="ABM55802.1"
FT                   /translation="MSTPSTSLWSPLRQPVFRGLWIGGGVFFIGSGMQAMAAAWLVVEL
FT                   TGSALLAALVQTAVFMPMFLLALPAGVLADTTDRKRLISGALLAQTGACALLALLTLAG
FT                   WIGPASVLLLVFVCGCCTAVLTPAWNSSVIDPVPRDEWPQAITAVSIAYNVARAVGPTL
FT                   AGLVFAQLGAGWVFAVTVGTTLVMWDSIRRWPPRAHAPSKLPAERLWGGTLSGLRFAWH
FT                   SRIILAQLVRVMAFSAAGSALWALLPVIAQRQLGAGAQGFGLLMGCLGIGAVAVGLMLG
FT                   RLRARFGLEWIVGSAGGVFAAAMLVTALTQRAWLVYLWMLLAGAAWMSAMSTFNTATQA
FT                   SAPQWVRSRAVAMHMVAALGAFALGSAFWGASSELMGPTPTLCLAAACMLAGLPLAGPM
FT                   PLRMGALHEVTQATPWDELFIEAEPLPEAGPVAVEIGYRIVPGSDAAFLDAISQMKAPR
FT                   RRDGATFWRVYKDLGEPSRYVERFIVESWADYLHQRARATMADQVLETGVRAFLAPGQS
FT                   ARMSHYIAER"
FT   sig_peptide     13414..13527
FT                   /locus_tag="Veis_0009"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.938 at
FT                   residue 38"
FT   gene            15099..16211
FT                   /locus_tag="Veis_0010"
FT   CDS_pept        15099..16211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0010"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: pol:Bpro_4264 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55803"
FT                   /db_xref="GOA:A1WDU6"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WDU6"
FT                   /protein_id="ABM55803.1"
FT                   /translation="MPFAPLANDSFLRACRRQATDYTPLWLMRQAGRYLPEYQASRARA
FT                   GSFMGLATSVDYATEVTLQPLERFPLDAAILFSDILTVPDAMGLGLSFAEGEGPRLAKV
FT                   VRDEATVAALAVPDMARLRYVFDAVASIRRALNGRVPLIGFSGSPWTLACYMVEGRGSD
FT                   DYRLVKGLMYSRPDLMHRILAINADTVAAYLNAQIDAGAQAVMVFDSWGGVLADGAFQA
FT                   FSLAYTARVLAQLQRTGVDGSDVPRIVFTKGGAPWLQDMQSLDCQVLGLDWTANLASAR
FT                   ALVGGAVGGPGKALQGNIDPHVLLAPPARIVQQVQQVLDSFGPPHTDRSTTGPTHIFNL
FT                   GHGISQFTPPAHVAALVEAVHSYSRAQRQG"
FT   gene            16497..18635
FT                   /locus_tag="Veis_0011"
FT   CDS_pept        16497..18635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0011"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: rfr:Rfer_0822 primosomal protein N'; TIGRFAM:
FT                   primosomal protein N'; PFAM: helicase domain protein; type
FT                   III restriction enzyme, res subunit; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55804"
FT                   /db_xref="GOA:A1WDU7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDU7"
FT                   /protein_id="ABM55804.1"
FT                   /translation="MALHTPLHTPLHSDAGGLLSYACERPLPAGTLVRVPLGRREVLGV
FT                   VWDAPEGIDAPPGQRHALPEGMTLRPIAGVLEGLAPLDAPWRRLVAFAARYYQRALGEV
FT                   ALAALPPQLRTLSPEQLARRLRRPAQAPGATDEAMPATETLTVSAEQESAIARIAAEPG
FT                   PFLLFGSTGSGKTEVYLRCVQEALQANAAAQALVLVPEINLTAQLEERLTRRFAPLFGA
FT                   AAVVSLHSGMTGPQRLASWLAAHSGRARIVLGTRMAVFASLPGLAFIVVDEEHDPSYKQ
FT                   QEGARYSARDLAIWRGREQNAKVLLGSATPSLESWHASRPPSPENPAGGRYLRLHMPSR
FT                   IGAGALPRVRRVDMGQQPRRALFSAPLLAAITERVARGEQSMILLNRRGYAPVLHCVDC
FT                   GWKSDCPHCSAHQVFHKADRSLRCHHCGSTLRVPRHCPGCGSPDILPLGRGTEQLEEQL
FT                   GALLSDVLRPDRTPARIARIDADTTRAKGALASQLAQVHSGQVDVLVGTQMIAKGHDFR
FT                   RITLVAAVQPDGALFSSDFRAPERLFALLMQAAGRAGRDAAYMARQGTPCEMWVQSFHP
FT                   RHAVFEALRRHDYPAFAEQQLQERAAAAMPPFAYQALVRADARTQQLAQGFLTAATAAA
FT                   QAAGLPGREQVTLYPPVPLAIQRVANVERAQMLLESPARAALQRFLSAWQPVLQATRSQ
FT                   PQHKGLLRWLVDVDPLVI"
FT   gene            complement(18688..20538)
FT                   /locus_tag="Veis_0012"
FT   CDS_pept        complement(18688..20538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0012"
FT                   /product="putative inner membrane transmembrane protein"
FT                   /note="KEGG: rfr:Rfer_2901 putative inner membrane
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55805"
FT                   /db_xref="GOA:A1WDU8"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDU8"
FT                   /protein_id="ABM55805.1"
FT                   /translation="MRIARSFRPLVFAPSSRRPRHGAHRPVTPPTPAIVTQQAVSPLPR
FT                   WALLLLCSAYVVPGFVGREPWKSADITAFGYMLALARGQTPWFGPLLGGMPPESESLLP
FT                   YWLGAWALQLAPPWLSAELAARIPFAALLLVTLLATWYGTYYLARSPGAQPVAFAFGGE
FT                   ANPPDYARAMADGALLALIACLGLAQLSHEMSSHLAQLGCVALLFFALAAMPHRRWASA
FT                   LALVLGMFGLTLSGAPALAALLGVGSMVLVLHAPGDQSGRRLRWVLALAAVTLAAALLA
FT                   WGLHCWRWRIVSADAVGKEWQSLARLLLWFGWPAWPLALWTVWRWRRQILSRQGHRHLL
FT                   LPLWFCALSLAAAITTRPADRALLPGLPALAALAAFALPTLRRSVGALIDWFTLLFFSA
FT                   SALAIWVIWIAMQTGFPAKPAANVAKLAPDFVPQFSALALAPALAATALWCLLVWWRAA
FT                   RDRAPIWKSLVLPASGATLGWLLLMTLWLPLLDHARSYGPQVRSVVAALGPAPGCIETL
FT                   GLHRGQVAALQYHGRLALQPAGGADACQWLLADGAAWPVSGRMVDAGLWEFEAILPRPT
FT                   DNNDHLLLFHRLAAARGTDGPRGSEGADEPDGPDGPPRGR"
FT   gene            20727..21254
FT                   /locus_tag="Veis_0013"
FT   CDS_pept        20727..21254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0013"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: pol:Bpro_0786
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55806"
FT                   /db_xref="GOA:A1WDU9"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDU9"
FT                   /protein_id="ABM55806.1"
FT                   /translation="MQIRCALVGMPGAGKSTVGQRLADRVGVPFIDLDQWLEQAIGSSI
FT                   RSYFEAQGEERFRDLESQGLAEVARQPGGLVLATGGGAVLRAPNRAVLRQFGHVLYLWA
FT                   MPEDLYQRVKHDQTRPLLQTDDPLRRLRQLYAERDPLYRATARCVIQTGQAAVGTLVDC
FT                   IMRQLELAPPPP"
FT   gene            21430..24165
FT                   /locus_tag="Veis_0014"
FT   CDS_pept        21430..24165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0014"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /note="KEGG: rfr:Rfer_0466
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase;
FT                   TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase, DHPS; Methionine synthase, B12-binding module,
FT                   cap domain protein; Vitamin B12 dependent methionine
FT                   synthase, activation region; cobalamin B12-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55807"
FT                   /db_xref="GOA:A1WDV0"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDV0"
FT                   /protein_id="ABM55807.1"
FT                   /translation="MSAISLPPMKLSGLEPVSIGPDSLFVNIGERTNVTGSKAFARMIL
FT                   NGQYEQALAVARQQVDNGAQIIDINMDEAMLDSKAAMVRFLQLIASEPDIARVPIMIDS
FT                   SKWEVIEAGLRCIQGKGIVNSISMKEGLAQFKRQAGLVRRYGAAAVVMAFDEQGQADTC
FT                   GRKIAICERAYRILVDEIDFPPEDIIFDPNIFAVATGIEEHDNYAVDFIEATRWIKQNL
FT                   PGAKVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIAAGMDMGIVNAGMVGVYDDLEPAL
FT                   RERVEDVILNRRADAGERLVEIAESARSSARDDSRKLEWRGTPEAPKTVGERLGHALVH
FT                   GITDFITRDTEEAYQQILARGGRPLHVIEGPLMDGMNIVGDLFGAGKMFLPQVVKSARV
FT                   MKLAVAHLIPYIEEEKRQDELAGRDVRSKGKIVIATVKGDVHDIGKNIVTVVLQCNNFD
FT                   VVNMGVMVPCHEILARAKAEGADIVGLSGLITPSLEEMQYVAGQMQKDEHFRLRKIPLL
FT                   IGGATTSRVHTAVKIAPHYEGPVVYVPDASRSVGVAQNLLGQALGSYLQELNADYDKVR
FT                   RLHASKKPLPLWPLAKARANKTPIDWSACQPAAPRAMGRRVFKNFDLAGLEKYIDWGPF
FT                   FQTWDLAGPYPAILTDAVVGAAASRVFADGQAMLKKIIAGRWLTASGVVALLPANSVGE
FT                   DIEFYTDDTRTRCAMTWYGLRQQTQKHVIDGVMRPSRCLSDFVAPKDSGIADYAGLFAV
FT                   TAGLGIEKKEQDFIAALDDYSAILFKSLADRLAEAFAECLHQRVRTDLWGYAPDERLSP
FT                   AELIAEKYRGIRPAPGYPACPDHSAKAAMFRVLQCADIGMGLTGSLAMTPAASVSGFYL
FT                   AHPDSRYFSVGTIGQDQLQAMAERRGMEQPALARLLASNL"
FT   gene            complement(24349..24993)
FT                   /locus_tag="Veis_0015"
FT   CDS_pept        complement(24349..24993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0015"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: rde:RD1_0515
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55808"
FT                   /db_xref="GOA:A1WDV1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDV1"
FT                   /protein_id="ABM55808.1"
FT                   /translation="MGEKFPFRARNPDNTRQLILDAARIEFAKAGLSGARVDKIAETSG
FT                   VNKRMIYHYFGGKELLFAAVVEAAYMDIRSQEQALGLDGLAPSEAMRLLLDFTWKYHLQ
FT                   NPAFITLVNSENLHQARHIEGNRQLRKLQKAYVGMVEGILQRGVASGEFRQGIDAVQLC
FT                   ISIAAVSFYYLNNRYTGRVLFGFDFMNKNALLARRQFNTQTIMRMVAARPD"
FT   gene            complement(25187..26308)
FT                   /locus_tag="Veis_0016"
FT   CDS_pept        complement(25187..26308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0016"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: pol:Bpro_0787
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55809"
FT                   /db_xref="GOA:A1WDV2"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDV2"
FT                   /protein_id="ABM55809.1"
FT                   /translation="MARPPDLSFPMHSVDIDLGDRSYSILIGSGFLPDGIARLADIRAT
FT                   SAVVVTNATLARLYLKGWSGFLATVYPRVHVVELPDGEEYKNWDSLNRIFSALLEWGCD
FT                   RKTVLFALGGGVIGDLTGFAAASYMRGIAFVQIPTTLLAQVDSSVGGKTGINHPLGKNM
FT                   IGAFHQPRLVICDLDTLDTLPKRELSAGLAEVIKYGPIADMALLDWLEGSLDAVLAKDR
FT                   RALAHVVQRSCQIKAAVVGCDEKETGLRAVLNFGHTFGHAIEAGMGYGVWLHGEAVAAG
FT                   MVMAAELSHRLGMVDARFVQRLTSIIGRAGLPTRGPIVDAADNAGRYLALMHVDKKAQA
FT                   GEIHFVLIDGPGRAVSRPAPDALVRQVIDACCG"
FT   gene            complement(26392..27594)
FT                   /locus_tag="Veis_0017"
FT   CDS_pept        complement(26392..27594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mtp:Mthe_1690 conserved repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55810"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDV3"
FT                   /protein_id="ABM55810.1"
FT                   /translation="MKNIFKTSVAISAVSLAALLLMSCGGANNGDPVGPIAKLRLKAPI
FT                   GSLIAYAGGGWSDLTEVRGGTMPYGVFNNVQGLETYVDDDGVLMFRARGAGGDGEITVY
FT                   DSSLPVQQVVIKGATKVIPMTCSSGVTISLVPNESRKFTIMGGIAPYTINNANAGAVTA
FT                   SISGSTATVTAKDLTATATSIVTVLDATGASCPAITVTVTASVQTSPPLTVDPTEITSS
FT                   LRTTSRTMIVSGGTPPYTVVSTNQDVATASIAGSTITVNLHAIGSANIIVTDSKGQTIK
FT                   SAPKVTVNTDVIDVEPDSYEINEDSTSSIKYLITGGKPNYTAMISLDDQEYIEVHTTNA
FT                   APYTLTVTKRRCVPENRTIPIDIYDVNLLKQTVRLTIKNTIRPGQPTNDADDTGKNCRT
FT                   P"
FT   sig_peptide     complement(27505..27594)
FT                   /locus_tag="Veis_0017"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.741 at
FT                   residue 30"
FT   gene            complement(27620..29758)
FT                   /locus_tag="Veis_0018"
FT   CDS_pept        complement(27620..29758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0018"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB, short N-terminal domain; KEGG: rfr:Rfer_2923
FT                   type II and III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55811"
FT                   /db_xref="GOA:A1WDV4"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDV4"
FT                   /protein_id="ABM55811.1"
FT                   /translation="MKHISSLSMNFCRPAAIGITLAFLSLTAVAQGAISAIAGSVQGGV
FT                   EILKIDFTDALTAPPTGFTIQSPARIALDFPGVTNASGKSAHTVNLGNLKSINIVQASE
FT                   RSRVVLNLKSPTSYHVDVQGKTLILSLAPVAGAAPVAAAPVVPFAENQNSDILPLKDID
FT                   FRRGTDGSGRVIVTLANSQAGVDLQQQAKGIAVEFMRTSLPEGLRRRLDVTDFGTPVQT
FT                   VTTTQTGERVRMLIESSGDWEHSAYQSDNQFVVEIRQKKIDQSKLTQGPGYSGEKLSLN
FT                   FQNIEVRSLLQVIADFTNFNIVTSDTVTGSLTLRLKDVPWDQALQIILDARGLGMRKAG
FT                   SVLWVAPKDEIDARTRKDFEVAQAIQRLEPLRTQAYQLNYAKASDILTQLNASGGAGGS
FT                   STRFLSERGSAIAEPRTNQLFVTDTASKQEEVRQLLARLDVAVRQVMIEARIVEARDSF
FT                   GRSLGVRLGSTDLSASRKGTGGYGIGGNKRVAYGTSYSDAVKASGANGSTAPDTGGNFV
FT                   NLPASLSSVNTVGSFALSIFNAATNKFLTLELSAMEADGKGRIVSSPRIITADQTKALI
FT                   EQGTEYPYAVTAPNGATTLAFKKAVLKLEVSPQITPEGNIILDLDVSKDSRGETTSQGV
FT                   AIDTKHIKTQILIENGGTVVIGGIFEMEETSQENKIPFLGDVPVVGNLFKSKTKETTKR
FT                   EMLIFITPKVIADSGPKR"
FT   sig_peptide     complement(29666..29758)
FT                   /locus_tag="Veis_0018"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.853 at
FT                   residue 31"
FT   gene            complement(29755..30297)
FT                   /locus_tag="Veis_0019"
FT   CDS_pept        complement(29755..30297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0019"
FT                   /product="Pilus assembly protein, PilQ"
FT                   /note="PFAM: Pilus assembly protein, PilQ; KEGG:
FT                   rfr:Rfer_2922 pilus assembly protein, PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55812"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDV5"
FT                   /protein_id="ABM55812.1"
FT                   /translation="MKDFRIPLLLTLPVVLTACSPGGEDELRQWIIEQRANTRAGVTPL
FT                   SEPKKFIPELYTQDGVMDPFDPLKLTRGSDGDTTHAAENAALLAPELARRKEPLEAFPL
FT                   DTMAMVGSLNKTGTPTALLRVENLIYQVHVGNYLGQNYGKVVQITENSIQLREIAQDAA
FT                   GDWVERMASLDLQEGKK"
FT   sig_peptide     complement(30226..30297)
FT                   /locus_tag="Veis_0019"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.340 at
FT                   residue 24"
FT   gene            complement(30297..30968)
FT                   /locus_tag="Veis_0020"
FT   CDS_pept        complement(30297..30968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0020"
FT                   /product="Pilus assembly protein, PilO"
FT                   /note="PFAM: Pilus assembly protein, PilO; KEGG:
FT                   pol:Bpro_0783 pilus assembly protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55813"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDV6"
FT                   /protein_id="ABM55813.1"
FT                   /translation="MASKKQNSIDLAERMAVILGQFKNLDNKDPSLWPTVPKIFLYLAV
FT                   MAAVAVASWFIFLKDYETELEEARSKETALRDGYRQKLVKAVNLDVLKKQREQIQQYVI
FT                   QLEKQLPSKAEMAALLSDINQAGLGRSLQFELFKPGQVVAKNYYAELPIAIRVSGKYHD
FT                   IGAFAADIAHLSRIVTLNNIAIAPTGARGANMLTLDATARTFRYLDPEEVQAQKKAGGA
FT                   K"
FT   gene            complement(30970..31593)
FT                   /locus_tag="Veis_0021"
FT   CDS_pept        complement(30970..31593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0021"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   rfr:Rfer_2920 fimbrial assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55814"
FT                   /db_xref="GOA:A1WDV7"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDV7"
FT                   /protein_id="ABM55814.1"
FT                   /translation="MILINLLPHREEARKRRKEAFQAATLASALLGLAIAGAIYWGFQM
FT                   LITDQLDRNAFLQKETQVLEGQIKEIASIEDEISALRARQKAVEDLQSDRNLPVHLLAE
FT                   LVKQLPDGMFITGIRQAEQTITMQGVTYSNEQVSELLRNLADNTPWLTKPELAEIVAGS
FT                   NFAAVQNQRNPRPASSFNLRFQLVRASDAEKTIAAANAAAPGGK"
FT   gene            complement(31590..32669)
FT                   /locus_tag="Veis_0022"
FT   CDS_pept        complement(31590..32669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0022"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   pol:Bpro_0781 type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55815"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDV8"
FT                   /protein_id="ABM55815.1"
FT                   /translation="MISMGSLFGRQSAPLLGIDISSSSVKLVELGRDKAGSLVLERCAI
FT                   ELLERGWITDGNVEKFDEVADALRRLIKKSGAKTKNVALALPPSAVITKRITLPGGMTE
FT                   QELEIQVESEANQYIPFSLDEVSLDFCVVGPSKTAADDVEVLIAASRREKVQDRQGLAE
FT                   AAGLKAVVIDIESHAARMAAGRLIQALPNQGVDAVVALFEIGALTTSMQVLSNDEALYD
FT                   RDQAFGGAQLTQLIMRQYGFSMEEAESKKRSGELPEDYQSAVLHLFVDSMAQEIGRALQ
FT                   FFFTSTPHNRVDHILLAGGSAPLPGLTEAVTQHTGFVCNTVNPFDGMEIGNAVRMQKMA
FT                   REAPTYLTSCGLAMRRFLQ"
FT   gene            33001..35400
FT                   /locus_tag="Veis_0023"
FT   CDS_pept        33001..35400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0023"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: rfr:Rfer_2918 penicillin-binding protein 1A;
FT                   TIGRFAM: penicillin-binding protein, 1A family; PFAM:
FT                   glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55816"
FT                   /db_xref="GOA:A1WDV9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDV9"
FT                   /protein_id="ABM55816.1"
FT                   /translation="MPQPPPAKSSAKSDTPPVRARPTWSRQVLRISGWLLGLTAAAVAG
FT                   LALTIAVALSAAYPNLPDISELADYRPKLPLRVYSAEGALLGEFGEERRNLTPIAEIPK
FT                   VMKDAVLAVEDARFFQHGGIDYKGVLRAGLANVGRLGSQGASTITMQVARNVYLSSEKT
FT                   FTRKIYEVLLTLKLENLLTKDQILEIYMNQIYLGNRAYGFAAASEAYFGTPLKSLSIAQ
FT                   AAMLAGLPKAPSAYNPISNPKRARVRQQYIIERMRENGFITPQQATEAKQEDLKIRTGP
FT                   DNTRIHAEYVAEMVRQLIFIQYGNEAYTRGLNVYTSLNAVQQETAYNALRRGIMDYERR
FT                   QQYRGPERFVALPAAQQEMEDAIDDALANHPDNGDLLAAVVLAAAPNKIVAARATGDQI
FT                   EITGDGLKPAQSGLSDKAPPNIRIRPGAVIRVLKTPKNTWEITQLPEVEGALVALDPRN
FT                   GSIRALVGGFDFNKNKFNHATQAWRQPGSSFKPFIYSAALEKGFTPATVINDAPLFFGA
FT                   GVTGGQPWEPKNYDGKYDGPMSMRTGLAKSKNMVSIRILQAIGPKTAQDWVGRFGFDVE
FT                   KHPAYLPMALGTGSVTPLQLASAYCVFANGGYRVNPWLITKVTDHKGRVISEPPPPVSG
FT                   EQSRAIAARNAFVMDSLLQEVTRSGTAAKAQATLKRPDIYGKTGTTNDSVDAWFAGFQP
FT                   TIAAVTWIGYDTPRNLGSRETGGGLSLPIWISFMERALRGVPVQEPDVPAGVVNVGGEW
FT                   FYEEYAHNAGVASVGLEAGGVAAPAAVPQAPPPSEERNRILDLFRH"
FT   sig_peptide     33001..33168
FT                   /locus_tag="Veis_0023"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.852) with cleavage site probability 0.403 at
FT                   residue 56"
FT   gene            complement(35409..35738)
FT                   /locus_tag="Veis_0024"
FT   CDS_pept        complement(35409..35738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0024"
FT                   /product="Frataxin family protein"
FT                   /note="PFAM: Frataxin family protein; KEGG: rfr:Rfer_2917
FT                   frataxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55817"
FT                   /db_xref="GOA:A1WDW0"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WDW0"
FT                   /protein_id="ABM55817.1"
FT                   /translation="MTDLEFMDHAEKLLLAVERSCDRINETTDADLDSQRSGGMLTLVF
FT                   PNRSQIVINLQKPLHEVWMAARSGGYHYRFDGHAWQDSKGAGEFFACLGRDATVQSGRP
FT                   LQFAA"
FT   gene            35913..37325
FT                   /locus_tag="Veis_0025"
FT   CDS_pept        35913..37325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0025"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   pol:Bpro_0111 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55818"
FT                   /db_xref="GOA:A1WDW1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDW1"
FT                   /protein_id="ABM55818.1"
FT                   /translation="MNAAHLLPEIHLRVVPPALIAALQTRFGAQCTVAQAVREQHGRDE
FT                   SSFRAPPPSAVVFADSTQDVADAVQLASQYAVPVIAYGAGSSLEGQLLAVQGGISIDLS
FT                   RMNQVLSIDAEDLTVTVQPGITRKQLNEAIKDTGLFFPIDPGADASIGGMSATRASGTN
FT                   AVRYGTMRENVLALEVVTASGQVIRTGTRAKKSSAGYDLTRLMVGSEGTLGIMTEITVR
FT                   LYPLPEAVSAAVCSFPSIEAAVRTTIQTIQLGVPIARIELIDRHAVRMVNAHSKLQLRE
FT                   EPMLLMEFHGTPSGVKEQTETVQEIAGEFGGQAFEWASTPEERSRLWAARHNAYFAAVQ
FT                   SRPGCRAISTDTCVPISRLADCLLESVAEAEASGIPYSLVGHVGDGNFHFGYLLDPDNP
FT                   EERITAETLNHNLVARALSLDGTCSGEHGVGLHKMGFLLDETGAGAVDMMRAIKRALDP
FT                   KNILNPGKIFAF"
FT   gene            complement(37456..38568)
FT                   /locus_tag="Veis_0026"
FT   CDS_pept        complement(37456..38568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0026"
FT                   /product="quinolinate synthetase A"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: rfr:Rfer_1319
FT                   quinolinate synthetase complex, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55819"
FT                   /db_xref="GOA:A1WDW2"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDW2"
FT                   /protein_id="ABM55819.1"
FT                   /translation="MPGRIAVEYEQPLAAGGACSTRQAWAHVPPEPAPAERAALRQQIR
FT                   RLLRQNDAVMVAHYYVHPDLQDLAEETGGLVGDSLEMARFGRDHAARTLVVSGVRFMGE
FT                   TAKILSPGKTILMPDLDAHCSLDLGCPPAAFSAFCDAHPERTVVVYANTSAAVKARADW
FT                   LVTSSCALEIVAALAAAGQKILWAPDRHLGAYIQRETGADMLLWNGACIVHDEFKAFEL
FT                   QALKQQHPQAKVLVHPESPADVQALADAIGSTSAILKAARQMAAKEFIVATDSGMLHQL
FT                   RAQNPGKIFHEAPTAGDSATCKSCAHCPWMAMNGLADLARVLATGANAISVDPALLPRA
FT                   RQPIDRMLAFTAALRNGQAAAGLVPHLGAA"
FT   gene            38614..39504
FT                   /locus_tag="Veis_0027"
FT   CDS_pept        38614..39504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lma:LmjF35.0520 proteophosphoglycan ppg4"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55820"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDW3"
FT                   /protein_id="ABM55820.1"
FT                   /translation="MACTSLVSVPMEMRSTPVSASSRRPARVTPPEISRIARPALRRTA
FT                   SRSMGSGMLSSSTILAPASRAWPNCSSVSTSICMNRACAARSSWPTARSTAVTPPAAAM
FT                   WFSLISTASYRPMRWLLPPPTRTAYFCARRRPGKVLRVSTIRAPVPATASTWMRVRVAT
FT                   ALSSCKKFSTVRSALSSARAWPSSVSTTCPGAQRWPSATCQSSSTPGSSARNVASAQGA
FT                   PQITAASRARMRARARRAGSIRPAVRSPVPRSSASARAASARAMSATLRSWESGVEAGV
FT                   EVMAASIAASRAGLA"
FT   gene            39536..40468
FT                   /locus_tag="Veis_0028"
FT   CDS_pept        39536..40468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0028"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="KEGG: pol:Bpro_0896 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55821"
FT                   /db_xref="GOA:A1WDW4"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WDW4"
FT                   /protein_id="ABM55821.1"
FT                   /translation="MTATRTPPSAMPASAAPCAAPYGTPSPAAPEGAHTAAAGRGAPVS
FT                   LPRLAQLRAAGEKITMLTAYDATFAALADAAGVECILVGDSLGMVCQGLPSTVGVQLDT
FT                   MAYHSACVARGLHRVQGSAWLVADLPYGSYAESREQALRSACVLMQAGAQMVKLEGGGW
FT                   TAPTVEFLVQRGVPVCAHLGLTPQSVHALGGYRVQGKTDAGARTLRQQARELQDAGAAL
FT                   LVLEMVPAALARDITDALPHCHTIGIGAGNGTAGQVLVLHDMLGMNLGKMPRFVHNFMQ
FT                   DAGSVHGAIAAYVQAVKQGRFPDDALHAW"
FT   gene            40590..41432
FT                   /locus_tag="Veis_0029"
FT   CDS_pept        40590..41432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0029"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: pol:Bpro_0895 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate--beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55822"
FT                   /db_xref="GOA:A1WDW5"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WDW5"
FT                   /protein_id="ABM55822.1"
FT                   /translation="MLIARSIADLRQALAPYRHPAFVPTMGNLHDGHIALMRLAKPLGD
FT                   VTVASIFVNRLQFLPHEDFDSYPRTWEADCAQLQAVGCDLLFAPREADLYPQPQTFKLH
FT                   PDPALADRLEGQFRPGFFVGVGTVVLKLFACVLGKTGGTAVFGKKDYQQLMVIRQMVQQ
FT                   LALPIEIVAGETCRAADGLALSSRNGFLSLAERQEAVALPLALQQLARRWREARNPGPA
FT                   LEQQALDALRARGWQPDYLTVCRRADLQPATAQDAPGTLVALGAARLATTRLIDNLEF"
FT   gene            complement(41568..42623)
FT                   /locus_tag="Veis_0030"
FT   CDS_pept        complement(41568..42623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55823"
FT                   /db_xref="InterPro:IPR011201"
FT                   /db_xref="InterPro:IPR031321"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDW6"
FT                   /protein_id="ABM55823.1"
FT                   /translation="MRVFNCDHCGHLVFFDSVRCLHCGSALAFLPDALAMAALAPAPRD
FT                   GPLLWRRMGEHGGAMYRMCHNHSAYQACNFAVPASDAVALCASCRQTRVLPDLSQPAHL
FT                   GRWQQIEAAKRQLFYTLARLGLEPVPGRCGPVFEFLADLPGDPAILTGHHGGTITLNVA
FT                   EADDGERARRRIALGEPYRTLIGHLRHESGHFYWDQLVRDGDRSAPFRSLFGDERQDYA
FT                   AALQAHYAKGHDLGDWSAQHVSAYATAHPWEDWAETWAHYLHMIDLLETAASYQASVTV
FT                   PAPRAALRHHVTDPFASPRPAFQDMVRQWVPLTLLLNSLNRSLGQSDAYPFALSSGAMA
FT                   KLRFVHDLVQA"
FT   gene            complement(42665..44071)
FT                   /locus_tag="Veis_0031"
FT   CDS_pept        complement(42665..44071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0031"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; CHASE3 domain protein; histidine kinase,
FT                   dimerisation and phosphoacceptor region; KEGG:
FT                   pol:Bpro_0880 multi-sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55824"
FT                   /db_xref="GOA:A1WDW7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDW7"
FT                   /protein_id="ABM55824.1"
FT                   /translation="MRGDYPEIKPMNLQEGTRRWLPKVRKMALSLPMALLAAAVLVGIN
FT                   ETGHMRSQDAVQQMSLGQSTRSDVNSLLQSMLDAETGQRGYLLTGAETYLEPYDRAVAT
FT                   VQTHLDRLRSQLSGFPEDAQELALLSRRVVRKLAEMDLSLRLRRQGNEDAWKFILNTDV
FT                   GQEHMQAIRRHAQVLSERSDQRVQHGQRQIGQSLMLSRIGIATVTLIGLCAFYMYLRQT
FT                   RAVQQVGQREQEMLERERDRLEGLVRERTATLSELANHLQQVREQERGHLARELHDELG
FT                   ALLTAAKLDVARLKSKLDAAAPDIAERLAHLTQTLNSGIALKRRIIEDLRPSSLSNLGL
FT                   TAALEILTREFAGHAGIEVETSLESVQLPEAVQLTVYRMVQEALTNIGKYAKAQQVLVS
FT                   VHAHPGHVAVQVRDDGQGFDPAALPPTSHGLAGMRHRVEAAGGRLSITSRPGGGTLLSA
FT                   ILPLRARQPA"
FT   gene            44140..44772
FT                   /locus_tag="Veis_0032"
FT   CDS_pept        44140..44772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0032"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2; KEGG: pol:Bpro_0881
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55825"
FT                   /db_xref="GOA:A1WDW8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDW8"
FT                   /protein_id="ABM55825.1"
FT                   /translation="MIRIGIVDDHAIVRSGLRQFLSEQVDLRVQGEAANGRQAIDLVRN
FT                   QEIDVLLMDLSMPGQSGLDALAMLRAKAPDMGILILSGYPEEHYAINLIRQGASGYLNK
FT                   ECEPAQIVQAIRTIALGRRYLTPVVAELLARQLGSKDERPAHQQLSEREFQVFLKLARG
FT                   ATTGDIAEALSLSVKTVSTYRTRLMEKMGLSSNSDLTYYALKNRLID"
FT   gene            complement(45035..45496)
FT                   /locus_tag="Veis_0033"
FT   CDS_pept        complement(45035..45496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0033"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pol:Bpro_0882 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55826"
FT                   /db_xref="GOA:A1WDW9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDW9"
FT                   /protein_id="ABM55826.1"
FT                   /translation="MQTRAAQARALLATLEPSVKLRTYFVEDNATIRENLIGTLEELAS
FT                   VQAVGVAETEDAGKEWLTTHAGQWDLAIVDLFLRQGNGLGVLAACRARRPGQKIVVLSN
FT                   YATPDVRMRCTQLGGDAVFDKSNEIDALVAYCVLHGSRSADPGTGPVLP"
FT   gene            complement(45576..46325)
FT                   /locus_tag="Veis_0034"
FT   CDS_pept        complement(45576..46325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0034"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: rfr:Rfer_1307 UBA/ThiF-type
FT                   NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55827"
FT                   /db_xref="GOA:A1WDX0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDX0"
FT                   /protein_id="ABM55827.1"
FT                   /translation="MTDDQLLRYSRHILLDEMGIEGQERVLAAHALIIGVGGLGSPAAL
FT                   YLAGAGVGHITLVDDDVVDLTNLQRQIAHTTARVGRPKVESAAAALAALNPQVRVTGLQ
FT                   ARVDAATLDGLVQKATVVLDCSDNYATRHAINAACVRQAKPLVAGAVLRFDGQLTVLDP
FT                   RDAQSPCYACIFAPDADFEEARCATMGVFAPLVGVVGALQAAEALKLLAGIGQSLAGRL
FT                   WMLDGRSMRWNCIRVQRSPGCTVCAPR"
FT   gene            complement(46637..48073)
FT                   /locus_tag="Veis_0035"
FT   CDS_pept        complement(46637..48073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0035"
FT                   /product="C-terminal processing peptidase-3. Serine
FT                   peptidase. MEROPS family S41A"
FT                   /note="KEGG: pol:Bpro_0885 carboxyl-terminal protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: PDZ/DHR/GLGF
FT                   domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55828"
FT                   /db_xref="GOA:A1WDX1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDX1"
FT                   /protein_id="ABM55828.1"
FT                   /translation="MGHRLRIAGWVAVGVVAGALTTVSLQTLARGAMAPLPLEEIQQLS
FT                   AVFGLVKTDYVEPVDDKKLITDAIAGMVASLDPHSQYFDKKSFKEFREGTSGRFVGVGI
FT                   EITQDDGLIKIVSPIEGSPAFRAGLKTNDLITRIDDTAVKGLTLNEAVKRMRGEPGTKV
FT                   TLTVFRRDENRTFPVVITREEIKTQSVKGRLLEPGYAWIRLSQFQERTVDDFVRKVEEI
FT                   YRQEPQLKGLVLDLRNDPGGLLDAAVAISAAFLPENVTVVSTNGQLADSKAIFKAAPDY
FT                   YQRRGSGDPLRRLPAALKSVPLVVLVNEGSASASEIVAGALQDHQRATIMGSQTFGKGS
FT                   VQTVRPLGPDTGIKLTTARYYTPSGKSIQAKGIVPDVMVDESQEGNLFAALRVREADLD
FT                   KHLGSGQGEEKKDEAREKAREEARLRLEDEAKKPVADRRAPEFGSDKDFQLQQALNQLK
FT                   GHAVLVSKTLTERKEEKKDN"
FT   sig_peptide     complement(47984..48073)
FT                   /locus_tag="Veis_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.815) with cleavage site probability 0.615 at
FT                   residue 30"
FT   gene            complement(48218..48955)
FT                   /locus_tag="Veis_0036"
FT   CDS_pept        complement(48218..48955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0036"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: pol:Bpro_0886 phosphoglycerate mutase 1
FT                   family; TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55829"
FT                   /db_xref="GOA:A1WDX2"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WDX2"
FT                   /protein_id="ABM55829.1"
FT                   /translation="MHQLVLIRHGESTWNLENRFTGWTDVPLTPTGVSQALSAGRLLKA
FT                   EGYMFDLACTSVLQRAIHTLWHVLDEMDCSWLPVVGDWRLNERHYGALQGLNKADMARQ
FT                   YGADQVLLWRRSYDTPPPALAVSDPRCERNDRRYAGVPAVPLTECLKDTVARVLPFWTQ
FT                   VIAPAIVSGKRVVLVAHGNSIRALVKYLDRIAEADIVGLNIPNAIPLVYELDANLSPIR
FT                   HYYLGDADAAAQAAAAVAAQGQA"
FT   gene            complement(49114..51003)
FT                   /locus_tag="Veis_0037"
FT   CDS_pept        complement(49114..51003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0037"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: pol:Bpro_3810 dihydroxy-acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55830"
FT                   /db_xref="GOA:A1WDX3"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDX3"
FT                   /protein_id="ABM55830.1"
FT                   /translation="MTDTHPSPQHATAPDEAAHGIAKGLPDYGDRGFSLFLRRAFIKGA
FT                   GYTDAALGRPIIGIANTASAYNPCHGNAPQLIEAVKRGVLLAGGLPMDFPTISVHESFS
FT                   QPTSMYTRNLMSMDTEEMIRAQPMDAVVLIGGCDKTVPAQLMGAASAGIPAIALITGAM
FT                   LTGAHRSQRVGACTDCRRYWARFRAGEIDAQEIADVNRQLVASVGTCSVMGTASTMACI
FT                   AEALGMTVPGGASPPAVTADRIRVAEQTGAQAVAMARSGLTIDKVLTARAFENAMRVLL
FT                   AIGGSTNAIVHLTAIAGRMGYDIDLDAFDRMGRQTPVLLDLKPSGAHYMEDFHHAGGMA
FT                   TLLRELKPLLHLDALTVTGRTLGEEIERAGPGFAQQVVRPLERPIYPQGGIAVLQGNLA
FT                   PGGAIIKQSTADAALMEHEGRAVVFENAEDLARRIDSDGLDVTQADILVLKNIGPKGAP
FT                   GMPEAGYIPIPRKLARAGVKDIVRISDGRMSGTAFGTIVLHVTPEAAVGGPLAHVRNGD
FT                   RIRLSVRERALTLLVDDQELARRASAHPVVAPRADRGYRKLFLQSVTQADQGVDFDFLR
FT                   APVTRARLPASGAWHDAACPPAPPSLPGAMPEAGLRAARTSADPPSAIPPTAP"
FT   gene            51205..52203
FT                   /locus_tag="Veis_0038"
FT   CDS_pept        51205..52203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0038"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   reu:Reut_B3949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55831"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDX4"
FT                   /protein_id="ABM55831.1"
FT                   /translation="MAASLLRSRWCQTVASALALATAFWATATQAQDYPQRPVKLLVPY
FT                   PPGGATDVIGRVLAQQLTLELGQPVVVENRPGAAGNLGASAVAKEPPDGQTLLMGALTS
FT                   HAINSVLFTAKAPFHLEQDFEPIALVGRVPLVITVGPTVKSANLAQFIALAQSRPGTLA
FT                   YASAGNGSPQHLAAELLQRQAGVKLLHVPYKGSGPALNDLMGGQVDVIIDTLPATQAFI
FT                   KGQRLRALAVTTAQRVAALPEVPTAAQAGLQDFELGSIFGVLAPAGTPRPIVERLSAAL
FT                   GAILSRPAVRDSLSTQGAMPAFMTPEQTRAAIRSEVARWSKLVAQSAITLE"
FT   sig_peptide     51205..51300
FT                   /locus_tag="Veis_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            52347..52754
FT                   /locus_tag="Veis_0039"
FT   CDS_pept        52347..52754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0039"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: rfr:Rfer_1310
FT                   rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55832"
FT                   /db_xref="GOA:A1WDX5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDX5"
FT                   /protein_id="ABM55832.1"
FT                   /translation="MKFIIDNWYLFLVALASGGMLLWPLIKNARDGALTPARVVQMINR
FT                   EKAVVIDVCETEEFAAGHVVGARNLPLGQIEERLPGVVKNKALPVVLVCATGARARRAV
FT                   TMARKLGYDNAQAMAGGLAAWRAASLPVEKT"
FT   gene            52771..53031
FT                   /locus_tag="Veis_0040"
FT   CDS_pept        52771..53031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0040"
FT                   /product="glutaredoxin 3"
FT                   /note="TIGRFAM: glutaredoxin 3; PFAM: glutaredoxin; KEGG:
FT                   rfr:Rfer_1311 glutaredoxin, GrxC"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55833"
FT                   /db_xref="GOA:A1WDX6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDX6"
FT                   /protein_id="ABM55833.1"
FT                   /translation="MQAVKMYTTAVCPYCVRAKQLLKARGVEQIEELRIDADPAARQQM
FT                   MALTGRRTVPQIFIGQTHVGGYDDLVALDGRGQLMPLLGAA"
FT   gene            53068..53577
FT                   /locus_tag="Veis_0041"
FT   CDS_pept        53068..53577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0041"
FT                   /product="protein translocase subunit secB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: rfr:Rfer_1312 protein-export
FT                   protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55834"
FT                   /db_xref="GOA:A1WDX7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WDX7"
FT                   /protein_id="ABM55834.1"
FT                   /translation="MPRRVSFCCNPSQETVTMADQDNPVFQIQRVYLKDLSLEQPNSPA
FT                   ILLEQEQPNLDIQLGVEATPVGEGFFEVAVTATVQTKIKDKTMFLVEAKQAAIFEIRNV
FT                   PEDQMGQIMGVVCPQIVYPYLRGNVADVINRAGFPPVHLGEINFQGMYEQQQAQAAGAA
FT                   APVTTQ"
FT   gene            53643..54653
FT                   /locus_tag="Veis_0042"
FT   CDS_pept        53643..54653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0042"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: rfr:Rfer_1313
FT                   glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55835"
FT                   /db_xref="GOA:A1WDX8"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WDX8"
FT                   /protein_id="ABM55835.1"
FT                   /translation="MKIIVSGAGAWGCALALSAARHPAGHAVTLWARDASQAERMRAER
FT                   QNARYLPGLPFPPALTLASGDLAALWPGADLVIVATPMAALRGMLLALHGCTAPVAWLC
FT                   KGFEAATGAESGGLLAHEVQALVAPRLLAGAFSGPSFAQEVALGQPTALVAASPHDRVR
FT                   AALVGALHSPSLRVYANEDIVGVEVGGAVKNVLAIATGLCDGLALGLNARAALITRGLA
FT                   EMTRLGVALGARPETFMGLSGLGDLVLTATGDLSRNRRVGLLLAQGRSLARTLESLGHV
FT                   AEGVYSARTVARRAALLGVEMPITRAVVALLDGRLSPADAVALLMGRGPASELMH"
FT   sig_peptide     53643..53726
FT                   /locus_tag="Veis_0042"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.462 at
FT                   residue 28"
FT   gene            54844..55770
FT                   /locus_tag="Veis_0043"
FT   CDS_pept        54844..55770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0043"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: mlo:mlr2437 rhizopine catabolism protein MocC"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55836"
FT                   /db_xref="GOA:A1WDX9"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR030823"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDX9"
FT                   /protein_id="ABM55836.1"
FT                   /translation="MTVKIGINPITWTNDDMPELGGDTPLEVCLSETAQAGYRGTELGG
FT                   KFPRNSRALAAVLARHGLELVSGWYDGRILDRSVDEEFAAALPHLSLLRAAGAAHVVYA
FT                   DTSRGRHGGIFQPISKRPKLQADEWGAYGAKITELAERMADFGVGMAFHHHMGTIVETD
FT                   AEVGLLMRHSGKAVGLLFDTGHCLFSGGDPASLLDRHIDRVVHVHCKDVRPAILQKARS
FT                   TDMSFMAAVLDGIFTVPGDGGVDFTALLTQLAQRGYCGWLVVEAEQDPKKANPLTYATM
FT                   GYRNLERMAIDAGLTVLTGVPSRSATV"
FT   gene            complement(56329..57810)
FT                   /locus_tag="Veis_0044"
FT   CDS_pept        complement(56329..57810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0044"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: mlo:mll2434
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55837"
FT                   /db_xref="GOA:A1WDY0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDY0"
FT                   /protein_id="ABM55837.1"
FT                   /translation="MDILKGPDLKKINSLDAIVLDAALKSTLKRQLYEQLRRLISGRIL
FT                   APGSALPSTRQLAKDLAIGRNTVVAAYEQLITEGYLHNRHTACPVVVDLPSGPMSHEDE
FT                   RAYPFRPSISRRGEMMMGEPFYFGAAGQPAFHPGMPDAQEFPFTAWSRLLARRGASGRD
FT                   TLFGTYDVLGFPPLRETIASYLNAARGMRCSTEQVVIISGAQGAFDLLARLLLDPGDTV
FT                   WMEEPGYFGAQSAFEVAGARLAPLHVDGGGWSLDGWPSPAPRVICVTPSCHHPLGATMR
FT                   MEQRLRLLEIAESCNAWIIEDDYDSEYRFQGQPIPAMQGSDASRRVIYVGTFSKLLFPA
FT                   LRIGFMVLPAGLVSGIAQAINVSGHVPPLLLQAALFDFINEGHMAKHLRRTRRLYAMRR
FT                   EAFLTMGEAQLSQWLQWAPGQSGIQTTAFCRDGLDDHAIAAAAKKRGIHVSPLSMQYRH
FT                   GKPRHGLVLGYAATSVSHMDSGMQKLREALLEVAG"
FT   gene            57940..58923
FT                   /locus_tag="Veis_0045"
FT   CDS_pept        57940..58923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0045"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="KEGG: rxy:Rxyl_1721 periplasmic binding protein/LacI
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55838"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDY1"
FT                   /protein_id="ABM55838.1"
FT                   /translation="MTSARTRTPRRCLALAALALAALAAPVALAQGKKETIYFVGIASP
FT                   ADPFHGVIARGAEQAGKDLGVHVVYIFPDKVTLTDYNAKIEQAIAAQPQGIVILGIDEK
FT                   GSRPLAQRARELGIRLGFNPAPPVKDKPLRTPDDLYVSRVGSDEYSAGRAAAERLLTEK
FT                   VKGKVVCGIQIPGDLTLSTRCQGVSERLKEAGIKTAIIEIANEPGQAAELLATYLRANP
FT                   DTGAVITLGGPPNAGAREARKAAKRPDLLLGGFDMDAATLQSIVDKDMLFTVDQQPFWR
FT                   GYIPVLGITHHLRYGLQQANYFLSGPSIVDAANARAALKLSRDGVR"
FT   sig_peptide     57940..58032
FT                   /locus_tag="Veis_0045"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 31"
FT   gene            58972..60018
FT                   /locus_tag="Veis_0046"
FT   CDS_pept        58972..60018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0046"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: mlo:mlr2441
FT                   permease protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55839"
FT                   /db_xref="GOA:A1WDY2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDY2"
FT                   /protein_id="ABM55839.1"
FT                   /translation="MGTSTPLPRFLMRLRSLLLRAETAAAAACLMTLVGFSIASPLFLS
FT                   KESLISITNLVAELGIISIGVTLLMIGGHIDLSVGAVVGISSYMTVYFSSIGLPPALAF
FT                   LGALAISAALGLVNGLLVMRTGLGSFIVTLGTMHVFRGLLTAWTGGFPVSSDIAEPMRS
FT                   IVSGALLPGGFRMSLVWFAMLVLGATFTLLRTRFGNWTYAIGQNPEAARNLGVPVERTT
FT                   VALFVLCSLCGGIAGIVQVARFQSVDALRGEGAELLAIAITVIGGTLLTGGYGSAIGSM
FT                   FGALIFGMVQVGLVLVGAPGYYFKTLVGATLVGAVLVNQSFSKLVASGGFLKSKAARKP
FT                   SPPARSQR"
FT   sig_peptide     58972..59091
FT                   /locus_tag="Veis_0046"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.874 at
FT                   residue 40"
FT   gene            60015..60758
FT                   /locus_tag="Veis_0047"
FT   CDS_pept        60015..60758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0047"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rxy:Rxyl_1719 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55840"
FT                   /db_xref="GOA:A1WDY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDY3"
FT                   /protein_id="ABM55840.1"
FT                   /translation="MKQAVLEARNIWKSYGPVPILEDVSIEAHAGRVLVLLGDNGAGKS
FT                   TLIKILSGVTAPSAGALLMDGQPVSFQTPRDARQRGIATVFQDLAVCNLLSITRNVVLG
FT                   REPMKRFGPFRWMDMKKAEEQTRQAFAVLGVNVGSDMGRPAAALSGGQRQSLAIARAML
FT                   FGSTCLILDEPTSALAVRQAHGVLDQIKAAAAAGQAVIFITHNFHHALLVGDEVVVLGN
FT                   GKVMAHFNTGETSLEELTRLVSMLH"
FT   gene            60776..61525
FT                   /locus_tag="Veis_0048"
FT   CDS_pept        60776..61525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0048"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: rba:RB3342
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55841"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDY4"
FT                   /protein_id="ABM55841.1"
FT                   /translation="MPHPRIASVVAVEPHPDDVEILCLGTLLKLKQEGTRLTIVCVTNG
FT                   DKGSGNQPDLPYPEVAAMRFREASSVAAALGAEFINLGAEDEYLYDTPELRNALAAVFR
FT                   RAKADVVLAPSPHCYQTDHTIASEIAFQAAHLSALPQLRITPPALPALPALPSAPAMYY
FT                   YDTLPGLDFEPSFYVDISGQMARKQELARMHTSQMASMKSQSDWDLVEAIEVLGRMRGL
FT                   QSGTRYAEAFRLCARYPRLKAWTQFPA"
FT   gene            61567..62514
FT                   /locus_tag="Veis_0049"
FT   CDS_pept        61567..62514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0049"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: bsu:BG11855 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55842"
FT                   /db_xref="GOA:A1WDY5"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDY5"
FT                   /protein_id="ABM55842.1"
FT                   /translation="MKIGLLTDSLGALPLDEVLQESAALGVQSVEFACGNWSSAPHIQL
FT                   DRMLDDSAHRANFLARLSDHGLAISALNCSGNQLHPGPSGKAHHQVVEKTIRLAALLEV
FT                   ERVVMMSGLPGGPGDANPNWITTDWPAECLRILEHQWQEVLIPYWQRLVEFANHQGIRK
FT                   LCLELHGHQAVYHPASFWRLREAVGNTVGVNYDPSHPMWMAADPIAAVRALGDAIYHVH
FT                   AKDTRIETVPAGIDGMLETRAASQVAQRSWNYVTLGYGHGEAWWKQFLAALHMSGYDDV
FT                   LSIEHEDMAMSPLEGVRKSVRLLQNCAVNLKNQG"
FT   gene            62617..63705
FT                   /locus_tag="Veis_0050"
FT   CDS_pept        62617..63705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0050"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   mlo:mlr2436 NADH-dependent dyhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55843"
FT                   /db_xref="GOA:A1WDY6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDY6"
FT                   /protein_id="ABM55843.1"
FT                   /translation="MSRVKVGVIGAGTISQVEHVPNLIRLRDKFELVGIADPSKTARDF
FT                   ITASYGVKGFETPEALFGEPLDAVVIGSPDMLHHEQVLAALDLGLHVFCEKPLCYSPEE
FT                   IDDIIAARNEAGKVVQVGYMKRFDPNYQLALQHLPGTAQTLRYISVEVNDPDAWPFIRH
FT                   HATGRGTDIARSMIEAAAAKQKTQIARAIGHQANAATVRGFATAYASALVHDVNAVHGM
FT                   LDVLGVPDGKIVGAEIFANGDGGQGAVRLLDGQALWNMAHLSVPALADYKERITLFFDD
FT                   AIMALEFPSPWLNHQPTRVTVKKSDGHTLSRTELRAGFEEAFVEEMIGFWGAIVNGDKV
FT                   RNPAEDARRDQALLCGLGRMAH"
FT   gene            63990..64427
FT                   /locus_tag="Veis_0051"
FT   CDS_pept        63990..64427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vfi:VF1170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55844"
FT                   /db_xref="InterPro:IPR018988"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDY7"
FT                   /protein_id="ABM55844.1"
FT                   /translation="MAYENNEMKFVAVVNRKHSLASILNALAHTAFGLSGKGVNPEHLL
FT                   DYSNSASGFLAKIDEYPFIILDAKNSNQLQTLVSSVMSNQRIAYNVFTTSMIGTCAEAQ
FT                   LKATREALNDGLDFVVVVLFGAREDVDPLTRKFSLTKGEMP"
FT   gene            64424..65329
FT                   /locus_tag="Veis_0052"
FT   CDS_pept        64424..65329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0052"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bbr:BB4263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55845"
FT                   /db_xref="GOA:A1WDY8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDY8"
FT                   /protein_id="ABM55845.1"
FT                   /translation="MNQALSRPAASVEMQAYLLGLMSVAAFALTLPCAKVLAGPLSAMQ
FT                   IGLFRSMLAALAALPILWFTRSARPNASQVKRLLLLSLGIVYGFPILTAVGMRYVPVGH
FT                   GGVVLAALPLATAIFGSLITKDRPPLLFWLASIGGFVAVALFAAWRSGIGGGFYLGDLA
FT                   LLGAVALAGFGYAQGGALSKEMQGWEVMCWALVLNLPVLLPLSLLYFNAADFAGFGSVS
FT                   WAALAFLAFVNSLLGFFSWNRALALGGIQRISQLQLLQPFFTYGYSIILMGEAFDPLAL
FT                   LICVAVIGLVVVSKRALLKH"
FT   sig_peptide     64424..64540
FT                   /locus_tag="Veis_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.530 at
FT                   residue 39"
FT   gene            complement(65841..67013)
FT                   /locus_tag="Veis_0053"
FT   CDS_pept        complement(65841..67013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0053"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; KEGG: rso:RSc1248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55846"
FT                   /db_xref="GOA:A1WDY9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDY9"
FT                   /protein_id="ABM55846.1"
FT                   /translation="MINGEIALGQPIPWGLVGGGQSSQIGYIHRSAALRDGSFALVAGA
FT                   FDIDAERGRQFGQRLGVSAERCHADYRALFEAEARRPDGIRAVSVATPNDTHFEICQAA
FT                   LHAGLHVVCEKPLCFTSAQARELLALSGAKNKIVGVTYGYSGHQLIEQARAMIARGDLG
FT                   QIRIVQMQFSHGFHSTAVEAANPSTRWRVDPKFAGPSYVLGDIGTHPLYISTLMLPELK
FT                   IERLLCSRQSFVQSRAPLEDNAFTIMQYAGGAIGYLWSCAVNAGSMHGQQIRVIGANAS
FT                   LQWWDERPNQLRYEIQGQPAQVLERGMDYLHPDALHDDRIGAGHPEGLFEAWSNLYYRF
FT                   ALAMDATDRRDAKALSGIRYPDIHAGLEGVRWVENCVRSADAGGVWVDYR"
FT   gene            complement(67147..68076)
FT                   /locus_tag="Veis_0054"
FT   CDS_pept        complement(67147..68076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0054"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: hch:HCH_01166 ABC-type
FT                   sugar transport system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55847"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDZ0"
FT                   /protein_id="ABM55847.1"
FT                   /translation="MRIRLLPVAVVCACLWLAPAAQAQRIAVSVANTGPWLSLVSRGMS
FT                   TYAASQKGLDLKLHDAQDDIARQLNQIQNFIAQKVDAIIVVTVDTQATPRMTQLASAAG
FT                   IPLVYVNHPPAEGKLPPKVVFVGSDEADSGTLQTREVCRLLGGKGRVAVMIGDLSNQSA
FT                   IQRTQDVREVIAKPPCQAIKIVAEQSADWSRVKGANLMTNWITAGIPVDAVIANNDEMA
FT                   IGAIQALKAARKLDTVVVAGIDATQDALAAMKAGELKVTVFQDAIGQGRGAVDAALKLI
FT                   RGQPVPSKLWVPFELVTPANIDKYLGKN"
FT   sig_peptide     complement(68005..68076)
FT                   /locus_tag="Veis_0054"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 24"
FT   gene            complement(68112..69203)
FT                   /locus_tag="Veis_0055"
FT   CDS_pept        complement(68112..69203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0055"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: rso:RSc1243
FT                   probable sugar transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55848"
FT                   /db_xref="GOA:A1WDZ1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDZ1"
FT                   /protein_id="ABM55848.1"
FT                   /translation="MKTTDMGAPDPAAGAHGANPGPGAQAATTPCTPGTPGTMRQRKWP
FT                   PEWSTLLVLAGIGLFFEAVGWVVVGQSFLLNPQRLQIIVLQMAVIGIIAVGVNLVIITS
FT                   GIDLSSGSVVAAAAVVSASLAQVADFPRAVFPQLTDLPLIWPILAGVTVGLLVGLINGS
FT                   LVAFTAIPPFIATLGTMVAVRGFAKWFTNGTPVSMLTDDFAAIGAGINPVLIFVLIAVI
FT                   FHVVLRYTRFGKFTYAIGANRQAAIVSGINVRHHLVWVYMVAGVLSGIAGTVTAARAIS
FT                   GQSGMGVMYELDAIAAVVIGGTSTAGGLGRITGTVIGVLILGVMTSGFTFIRIDAYYQE
FT                   MVKGAIIVAAVIADQYRNQKRRG"
FT   gene            complement(69246..70415)
FT                   /locus_tag="Veis_0056"
FT   CDS_pept        complement(69246..70415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0056"
FT                   /product="Inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; KEGG: rde:RD1_0217 myo-inositol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55849"
FT                   /db_xref="GOA:A1WDZ2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDZ2"
FT                   /protein_id="ABM55849.1"
FT                   /translation="MIKVGLLGAGRIGKVHARSIVADQRSQLLAVADINAQAAQQLAAT
FT                   CGAKARSAQEIIADPGIDAVLIATSTDTHAALIEAAVHAGKAVLCEKPVDLDLDRALAC
FT                   QAVAAQAGRPVMIGFNRRFDPHFAALKRAFDAGDIGKGELLSITSFDPAPPPASYVKSS
FT                   GGLFRDMAIHDLDMACWLFAALPVSVTALGASIIDPAIGAEGDVDTAVITLGFADGRMA
FT                   VIKNSRRAAYGYDQRVELLGATGLLSVGNVLENTLTRITSAGAHSAKPEYFFLERYMQA
FT                   YAAEWRAFIDAVTAGTDYPVTLQDGVNALALAQAATLSCHSGKTVQLDGGRPVSAARPP
FT                   EGAHTAAEGEGIPASAARPPEGAHTAAEGEGLPMSAARPPAGEGAPASA"
FT   gene            complement(70470..71276)
FT                   /locus_tag="Veis_0057"
FT   CDS_pept        complement(70470..71276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0057"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: mlo:mlr7629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55850"
FT                   /db_xref="GOA:A1WDZ3"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDZ3"
FT                   /protein_id="ABM55850.1"
FT                   /translation="MQRSFELAACAEMLWRDKPMLWRVKRLTEMGFQVGLWNWPDHDLA
FT                   LLERSGARFSIMNGYLRGRLADDEGAAELLRTARETAQVGKRLGVARLNLHGTGLGADG
FT                   LPVTPCDVVTGPMWIKARDTLARIADLAEQQEVCFTLENLNRSVDHPGVPFARAADTLA
FT                   LVSAVNHPRLRLNLDLYHAQIGEGNLIDLCRRCLPWIGEVQVADVPGRQEPGSGEINYA
FT                   GVARALHALGYRGPVALEAYASGEPEAALQAFQRAFTVQGAGVAGV"
FT   gene            complement(71328..72128)
FT                   /locus_tag="Veis_0058"
FT   CDS_pept        complement(71328..72128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0058"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rde:RD1_0486 sugar ABC transporter, ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55851"
FT                   /db_xref="GOA:A1WDZ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDZ4"
FT                   /protein_id="ABM55851.1"
FT                   /translation="MTAAAQPQPQPLVEMRAIEKRFGNIIALSGVSFSIHAGECHCLLG
FT                   DNGAGKSTFIKTMSGVHKPSGGTMLVNGAEVVLESPRQAMNAGIATVFQDLAMIPLMSV
FT                   TRNFFMGREPTKGWGPFKRFDIRQANQVTMAEMQRMGIRLREPEQAVGTLSGGERQCVA
FT                   IARAVYFGAKVLILDEPTSALGVRQTANVLATIDRVRKLDVGVIFITHNVRHAMAVGNR
FT                   FTVLDRGRTLGTATRSEITAEQLQNLMASGQELATLDGSLGGTV"
FT   gene            complement(72130..73287)
FT                   /locus_tag="Veis_0059"
FT   CDS_pept        complement(72130..73287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0059"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_CH02360 probable sugar ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55852"
FT                   /db_xref="GOA:A1WDZ5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDZ5"
FT                   /protein_id="ABM55852.1"
FT                   /translation="MQRLPAPRPHQPSFLEDAMNHASGPADDRLTHRSWFSRWMKRPEL
FT                   GAVAGLLLVTVFFMLTADPVMFSLAGLVNFLTPAAQLGILALGAALLMIGGEFDLSIGS
FT                   MIAFAGLIFSTAIVIFELPLVLAVLLTLLVVAVIGCVNAWIVISTGLPSFIVTLAFLFM
FT                   LRGLSLVGLKWATGGSTQLRGVTEAVQDSSLLWLFNGKAFTGWFAFMGEHGLIPRFPNG
FT                   VPMITGIPVEICWFVGLTALATWVLLRTPLGNWIFASGGDATAAKNSGVMVRNVKTGLF
FT                   VFAALCAGLVAIITVLDSGSTDARRGFQKEFEAIIAAVIGGCLLTGGYGSAVGAFLGSI
FT                   IFGMVMIGLTYTRIDQDWYLVFLGAMLLVAVLFNNTIRKRVTGER"
FT   gene            complement(73304..74239)
FT                   /locus_tag="Veis_0060"
FT   CDS_pept        complement(73304..74239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0060"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: rde:RD1_0488 putative
FT                   sugar ABC transporter, periplasmic sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55853"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDZ6"
FT                   /protein_id="ABM55853.1"
FT                   /translation="MTFARQLVRCAFAAALSAACAWGQAQTIAVVTHGQANDAFWSVVK
FT                   NGVEAAAKDAGVKVSYRAPESFDMVAMSRLIDAAVNQKPDGLVVSLPDASALGPAIERA
FT                   VKAGIPVITINSGLEFSKKLGAVLHVGQSEYDAGKSAGEKLKSMGGKNGICVNQEVGNV
FT                   ALDLRCKGFADGFAGKSKVLPTGNDPAEVRAKVKAALDSDAGIDTIMVLGAATSGDPSL
FT                   AAAKDTGRSAKLLIAAFDLSAGFLKAIAAKEAAFTIDQQQFLQGYLPVSFLALHAKYGV
FT                   MPAGNVPSGPNLITADKAAQAIDLSAKGIR"
FT   sig_peptide     complement(74168..74239)
FT                   /locus_tag="Veis_0060"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.803 at
FT                   residue 24"
FT   gene            complement(74299..75849)
FT                   /locus_tag="Veis_0061"
FT   CDS_pept        complement(74299..75849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0061"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_1425 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55854"
FT                   /db_xref="GOA:A1WDZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDZ7"
FT                   /protein_id="ABM55854.1"
FT                   /translation="MFVATPDRPAPTGGGRPPVPPGPACLLQVRGVSKSFPGVVALDNV
FT                   QFRLRPGSVHALLGENGAGKSTLMKIIAGVYAPDQGQILLRGQPVTLASPRAALSHGIA
FT                   MIHQELNLMPYMTVAENIWICREPLGRLGLVDHGALRQRTQALFDRLAIDIDPEAEVRS
FT                   LTVANRQMVEIAKAVSFDSDVLIMDEPTSALTDKEVNHLFRIIGQLRAQGKGIVYITHK
FT                   MSELFEIADEFSVFRDGKYIGTHASCDVTRDDIIQMMVGREITQLFPKEEVPIGAVVLS
FT                   VRDLAVKGVFRDVSFDLRAGEFLGLAGLVGSGRSNVAEALFGVVPATSGEIRIDGQPVR
FT                   IDSPAKAMRHGLAFLTEDRKESGCFLILDLLANLETAVLRSRFVKYDFVQQAPLRRDCQ
FT                   QMLRTLQVKAPGLHETIQNLSGGNQQKVLIGRWLLTEPKILILDEPTRGIDVGAKAEIH
FT                   RLVTRLAAQGVAVLLISSEMPEVLGMCDRILVMHEGRMTGIVERKDATQVRIMELASR"
FT   gene            complement(75875..76900)
FT                   /locus_tag="Veis_0062"
FT   CDS_pept        complement(75875..76900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0062"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   bbr:BB0238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55855"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDZ8"
FT                   /protein_id="ABM55855.1"
FT                   /translation="MATRKPGPDFRRDTMTQRIALRLFAVLFAATLLAGAAQAQPAAYP
FT                   QQPLKWVVPYAPGGTTDVIARQLAVRMGQTLGQSVIADNKPGAASIIGATFIARSAPDG
FT                   YTVGTADSGTLAFNPAMYASLGYDAGKDFSLIGGLGRMPLVLAVHPSFPAKDVQEFLAL
FT                   VRKSPGAVSSASAGSGSPLHVALELFKQQTRTDILHVAYKGAAPALQDLMAGQVNSMFV
FT                   DLPASLSMIKAGKIRVLAVATPQRLALLPDVPTMAEAGVPGYQAYAWQGLVGPAGLPTP
FT                   VLERLNKELVAALSHAQTRSRLQEIGIEPMPMAPQQFADFVHDEQKRWSGVIKAASIRL
FT                   D"
FT   sig_peptide     complement(76781..76900)
FT                   /locus_tag="Veis_0062"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 40"
FT   gene            complement(76944..77873)
FT                   /locus_tag="Veis_0063"
FT   CDS_pept        complement(76944..77873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0063"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bur:Bcep18194_A4568 ABC
FT                   sugar transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55856"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WDZ9"
FT                   /protein_id="ABM55856.1"
FT                   /translation="MKPLLMAVATAAALVAPLASAQKIGVTMATFDDIFLNILRNSMAD
FT                   AARKAGASVQIEDAGSDVGKQLSQIQNMIAQKVDAVIVNAVDTDATPKMTRLLTEARIP
FT                   LVYVNRKPADFEKLPASVVMVASDEMAAGRLQAEQVCKLLGGKGSILVLMGDLSNESTR
FT                   SRTKAVDDVVAGKECSGISIADRREGKWSRTRGQDITINWLSSGLKFDAIVSNDDEMAL
FT                   GAINALKATKKWTPRTIVAGIDATPDALASMKAGDLKVTVFQNAAGQGAGAIDAAIRLS
FT                   GKQSVERFVNIPFELVTPGNMARYAGKN"
FT   sig_peptide     complement(77808..77873)
FT                   /locus_tag="Veis_0063"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 22"
FT   gene            complement(78013..78945)
FT                   /locus_tag="Veis_0064"
FT   CDS_pept        complement(78013..78945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0064"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: rso:RSc1241 putative
FT                   rhizopine-binding precursor signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55857"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE00"
FT                   /protein_id="ABM55857.1"
FT                   /translation="MKTLLMAVVTATAALAAPLASAQKIGVTMSQFDDNFLTILRNSMA
FT                   DSARKAGVSVQIEDAGGDVGKQLSQIQNMIAQKVDAVIVNTVDTDATPKMTRLLTEAGI
FT                   ALVYVNRKPVDFEKLPPGMAVVASDETVSGKLQAEQVCKLLGGKGSILVLMGDLSNEAA
FT                   RSRTKAVEDVLAGKECSGIKIADKREGKWDRTRGQDIATNWLSSGLKFDAIVSNNDEMA
FT                   LGAINALKATKKWTPQTIVAGIDATPDALASMKAGDLKVSVFQNAVGQGAGAIDAAIKL
FT                   ARKQHQERFVSIPFELVTPENMARYAGKN"
FT   sig_peptide     complement(78877..78945)
FT                   /locus_tag="Veis_0064"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.901 at
FT                   residue 23"
FT   gene            79185..81209
FT                   /locus_tag="Veis_0065"
FT   CDS_pept        79185..81209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0065"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: bch:Bcen2424_1423
FT                   PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55858"
FT                   /db_xref="GOA:A1WE01"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018659"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE01"
FT                   /protein_id="ABM55858.1"
FT                   /translation="MDLTNRQVTMSALNFPTGRPIDLACLGRVAVDLYAQQYGSRLEDA
FT                   RSFQMYLGGSSGNLAFGVARLGLKSAMISRVGDEQMGHYLRAALEREGCDTSQLQTDPQ
FT                   RLTALVLLALKDRDNFPLLFMRENCADMALRADGISADFIAGCRALAVTGTHLSTPGTR
FT                   EAALTALGYARRHRVVRVLDIDYRPVLWGLTPRGAGANRYLPDASVTQRLQQVLGEFDL
FT                   LVGTEEEFLIAGGVPHQLMASLQAVRQHSQAVLVVKRGALGCCVIEGALPARIEDAPGY
FT                   PGEHVEVLNVLGAGDAFLAGLLTGLLQGRDWAEATRIANACGAIVVSRHACSASMPTPA
FT                   ELAHWFSGQRNPKVDADRQLAHLHRVTVARQRWDKLCVMAFDHRSQFYELAREAGAAEE
FT                   RIQRLKLLLVRAAEQVERSQQLQGQIGVLIDGGAYGSDALAQATGRGWWVGRPVELPGS
FT                   RPLRFDGTRSIGSALVHWPTEQVVKCLVHYHPDDPVDLRLAQEQTVLELWQATRASGNE
FT                   LLLELIPPCLQPPADAGPQTHASAEDEVVLRAVKRFYNLGVKPEWWKLAPMRPEGWSRL
FT                   AALIAERDSHCRGAVILGLNQPLAYLADSFRAATDPVVKGFMVGRTLWAQAALQWLRGQ
FT                   IDDQALTDAVADNFARLVQAWQQRLDSPANTSIPTTTEA"
FT   gene            81212..83095
FT                   /locus_tag="Veis_0066"
FT   CDS_pept        81212..83095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0066"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: bur:Bcep18194_A4566 acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55859"
FT                   /db_xref="GOA:A1WE02"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE02"
FT                   /protein_id="ABM55859.1"
FT                   /translation="MQASTRLTVSQALVRYLAALKAEVIQPDGRTDILPYCAGVFAIFG
FT                   HGNVAGLGEALQAEKDRLPTLRAHTEQGMANAAVAFAKAHFRQRIMAVTSSIGPGATNM
FT                   LTSAALAHVARLPLLLLPADVFVSRLPDPVLQQVESFGQGDVSANDCFRPVTRYFDRIM
FT                   APEQLLVALPRALQVLTDPAQCGPVCLALPQDVQTFAHDWPEDFFHPALIRMRRPPADA
FT                   QELAAACALLKSAKRPLIVAGGGVLYSQAWDALRSFAQTHGVPVSETQAGKSSLAWDHP
FT                   LNLGAIGVSGSPAANGAAEQCDLLFAIGTRLQDFTTGSHALYPQARLLSLNIQPLDAAK
FT                   KRGQPLLADVRTGLGQLTAALAGWRADPDWSASCRHQAAAWATRVTELTTHDPGDALPY
FT                   DAEVIGAVRESATDVGLDSADNDIVVCAAGTLPAELHKLWRSALPGNYHMDYAYSCMGY
FT                   EVAGGLGVKLARPEREVIVIVGDGSYMMLNSELASSVLLGRKIIVVILDNRGYGCIERL
FT                   QIGSGGASFNNMLDDCVPEGGARSAIDFAMHGRSMGADAVHVRDTEELRRELHRARAAS
FT                   KSQVLVINTTHQRTTGDGGAWWEVAVPEVSARAEVAAAHRAYLQAKTRQRR"
FT   gene            83143..84099
FT                   /locus_tag="Veis_0067"
FT   CDS_pept        83143..84099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0067"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: bam:Bamb_1301 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55860"
FT                   /db_xref="GOA:A1WE03"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR030823"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE03"
FT                   /protein_id="ABM55860.1"
FT                   /translation="MSWNVRIGINPLSWSNDDLPSLGGETPLETALREGAEIGYAGFEL
FT                   GYKFPADGPALKARLAEFGLVCVSGWYSGALAEPAPGQSDAQAVAAELERCQPHMRKLQ
FT                   HNDVTVVVYGECAGTIQGRIDMPLAKRPRFAGATAWQRYAERLNAFGAQLLARYGIRLA
FT                   YHHHMGAYVQAPADIDQLMALTDPASVFLLFDTGHAWFGGAADPVALLRKHAARVVHVH
FT                   CKDVRPQIIDQARNGGWSFLDSVINGAFTVPGDGAIDNRAILRVLKDVGYQGWLVVEAE
FT                   QDPAVAPSYAYARKGHDTLRALVDQSSVCHGPGQRER"
FT   gene            84121..84948
FT                   /locus_tag="Veis_0068"
FT   CDS_pept        84121..84948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0068"
FT                   /product="Myo-inositol catabolism IolB domain protein"
FT                   /note="PFAM: Myo-inositol catabolism IolB domain protein;
FT                   KEGG: rso:RSc1237 putative myo-inositol catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55861"
FT                   /db_xref="GOA:A1WE04"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE04"
FT                   /protein_id="ABM55861.1"
FT                   /translation="MTTSPLLIKAAPGREICCVTPASAGWSHVGFRALRLQAGASETLE
FT                   TGTRELCVVVLTGSIDAEVAGQRHAGLGRRDSVFEECAPDALYLPGGQRLTITATRAAE
FT                   VALCSAPCAGGNKPVRRIDGTGMRRSTRGAGSNLRHVCDILMGDNPAAERLLVVEVITP
FT                   AGHSSSYPPHKHDDDAAPGETRLEETYYHRIDPPQGFAFQRVYTDDRSLDEACVVENHD
FT                   VVLVPRGYHPVVTPHGYRLYYLNVMAGPRRAWAFRNDPAHEWLLRPDGTGTAA"
FT   gene            complement(85093..85431)
FT                   /locus_tag="Veis_0069"
FT   CDS_pept        complement(85093..85431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0069"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: nmu:Nmul_D2814 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55862"
FT                   /db_xref="GOA:A1WE05"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE05"
FT                   /protein_id="ABM55862.1"
FT                   /translation="MMKQRVMDGAGPREKSGQVVADPGLQGVDRFQIKSGLVQAIAWTM
FT                   QHRSLTQQAMAEISGIARPRLSLALRGDFSQLSERKLMDALTRLGFDIEIKVKRTRKAQ
FT                   GVRQLVLS"
FT   gene            85661..86503
FT                   /locus_tag="Veis_0070"
FT   CDS_pept        85661..86503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0070"
FT                   /product="farnesyl-diphosphate farnesyltransferase"
FT                   /EC_number="2.5.1.21"
FT                   /note="PFAM: Squalene/phytoene synthase; KEGG:
FT                   pol:Bpro_2017 squalene/phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55863"
FT                   /db_xref="GOA:A1WE06"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017828"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE06"
FT                   /protein_id="ABM55863.1"
FT                   /translation="MTPQQYVQQKAVASGSSFYYAFLFLPAPRRAAITAFYAFCREVDD
FT                   VVDSQMIDPGVARTKLAWWQSEVVKAYAGQPSHPVMQALMPHTAEYGIAQRHLQAVIDG
FT                   CRMDLEQTRYLDIAGLTGYCHLVAGIVGEVTARIFGQTDERTTQYAHMLGLAFQFTNII
FT                   RDVGEDALLGRVYLPLSELQQFGVKVHELLERRYSDRFTALMRFQAERAHRLYDQALAL
FT                   LPEVDRRAQKPGLMMASIYRTLLREIGHENFQVLHQRIRLTPLRKFWLAWKVQALGRM"
FT   gene            86787..88145
FT                   /locus_tag="Veis_0071"
FT   CDS_pept        86787..88145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0071"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: rfr:Rfer_1548 amine
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55864"
FT                   /db_xref="GOA:A1WE07"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR017830"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE07"
FT                   /protein_id="ABM55864.1"
FT                   /translation="MKVAVIGAGWAGMAAAIAHAQAGRRVTVFEAARRVGGRARAVPGA
FT                   LPDGSAVTLDNGQHILIGAYRESLRLMRLVGVDTDAALLRLPLTLLFADGQGLQLPDLP
FT                   PPLDALLGIARAKGWHWRDKLALLRTAALWRLRGFRCAPPVSVAQLCARLSPRLMAEFM
FT                   APLCVSALNTPVHAASGQVFLRVLQDSLFSGRGGSNLLLPRTDLGALFPQAAAHWLRRH
FT                   GGQIITGQRVCGLLPSAGAGWQVSGGGASERFEHVTLACPPWEARRLVAGIARLDAAGQ
FT                   RAARCWSAAADGLRFAAIATVYVHAAGVRLPQPMLALRSTAEQPAQFVFDRGWLGGPPG
FT                   LLAFVVSASDGERAAIERQVLQQARATLAHRESGAPGTQPPLRLVQTVLEKRATFACTP
FT                   GLQRPGMQVLPGLSACGDYVQGPYPVYPATLEGAVLSGSAAAAQARPSPAWRR"
FT   sig_peptide     86787..86849
FT                   /locus_tag="Veis_0071"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.945 at
FT                   residue 21"
FT   gene            complement(88183..89091)
FT                   /locus_tag="Veis_0072"
FT   CDS_pept        complement(88183..89091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0072"
FT                   /product="HflC protein"
FT                   /note="TIGRFAM: HflC protein; PFAM: band 7 protein; KEGG:
FT                   rfr:Rfer_2299 HflC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55865"
FT                   /db_xref="GOA:A1WE08"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE08"
FT                   /protein_id="ABM55865.1"
FT                   /translation="MNRVGLIASTVLVALALMNSMLFVVDQRQFGVLYALGQIKDVITE
FT                   PGLNFKLPPPFQNVTYIDKRLLTLDSTDTEPMLTAEKQRVVIDWYVRWRISEPTAYIRN
FT                   VGQDESAGAMQLNRVVRNAFQEEINKRTVKELLSLKREALMADVKREVLEAVRGVKPWG
FT                   VDVVDVRITRVDYVEAITESVYRRMEAERKRVANELRSTGAAEGEKIRADADRQREITI
FT                   ANAYRDAQKSKGEGDAQAARIYAEAFGRDPQFAQFYRSLEAYKASFNKKSDVLVVDPSS
FT                   SDFFKAFQGHAPAAAQPGARK"
FT   sig_peptide     complement(89017..89091)
FT                   /locus_tag="Veis_0072"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.918 at
FT                   residue 25"
FT   gene            complement(89102..90460)
FT                   /locus_tag="Veis_0073"
FT   CDS_pept        complement(89102..90460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0073"
FT                   /product="HflK protein"
FT                   /note="TIGRFAM: HflK protein; PFAM: band 7 protein; KEGG:
FT                   rfr:Rfer_2300 HflK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55866"
FT                   /db_xref="GOA:A1WE09"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE09"
FT                   /protein_id="ABM55866.1"
FT                   /translation="MLPERIRGMFNLNDPRWGRGEDKSDDAAGPPDDRPGTPPAGQRGD
FT                   DKRPGRPGRSGNTQPPDLDEIMRDLNRKLGGLFGGKNGAGRGPGSGGNGGGSGGGFQPD
FT                   MKSAGVGVGLIAGIVFVIWMGTGFFIVQEGQQAVITQFGMYKSTVGAGFNWRLPYPIER
FT                   HELVFVTQIRSEDVGRDNIIKSTGLRESAMLTADENIVEIKFAVQYRLNDARAWLFESK
FT                   NPRDAVVQAAETAVREVVGKMRMDTALAEERDQIAPRVRTLMQTILDRYKVGVEVVGIN
FT                   LQQGGVKPPEQVQASFDDVLKATQERERAKNEAQAYANDVIPRAVGSASRLSEEADAYK
FT                   ARIVAQAQGDAQRFSSVLAEYQKAPQVTRDRMYLDAMQQVYGNVTKVLIESRQGTNLLY
FT                   LPLDKILRNAGAETGTQEPSAAPSSVIPAIPPANLLNDPRARDSNRTRERESR"
FT   gene            complement(90545..91708)
FT                   /locus_tag="Veis_0074"
FT   CDS_pept        complement(90545..91708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0074"
FT                   /product="GTP-binding protein, HSR1-related"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; KEGG:
FT                   rfr:Rfer_2301 small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55867"
FT                   /db_xref="GOA:A1WE10"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE10"
FT                   /protein_id="ABM55867.1"
FT                   /translation="MSSQAGSAAVVLVGVDLGLPHFDGELEELGLLAQAAGMQPVARMA
FT                   CKRKAPDAALFVGSGKADEIRSLAQLHGAEEVLFDQSLSPAQQRNLEQHIELPVNDRTL
FT                   LILEIFARRARSHEGKLQVELARLQYLSTRLVRRWSHLERQSGGIGGRGGPGEKQIELD
FT                   RRMIGAAIKRTRERLVKVKRQRSTQRRQRERRDTFNISLVGYTNAGKSTLFNALVKAGA
FT                   YAADQLFATLDTTTRQLYLANAGRSVSLSDTVGFIRDLPHGLIDAFEATLQEAVDADLL
FT                   LHVVDASNPDFPEQMAQVERVLHEIGAADIAQMLVFNKLDALPAQRRPLRLQDQYERAG
FT                   QGLERWFVSARSGEGLDLLRQALAAKVLATPADIAPADSVQLPYARP"
FT   gene            complement(91787..92041)
FT                   /locus_tag="Veis_0075"
FT   CDS_pept        complement(91787..92041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0075"
FT                   /product="RNA-binding protein Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein, core; KEGG: rfr:Rfer_2302 host factor
FT                   Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55868"
FT                   /db_xref="GOA:A1WE11"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WE11"
FT                   /protein_id="ABM55868.1"
FT                   /translation="MSNKGQLLQEPFLNTLRREHVPVSIYLVNGIKLQGQIESFDQYVV
FT                   LLRNTVTQMVFKHAISTIVPGRAVHFSTAEPADANSNNG"
FT   gene            complement(92152..93558)
FT                   /locus_tag="Veis_0076"
FT   CDS_pept        complement(92152..93558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0076"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein, HSR1-related; KEGG: rfr:Rfer_2303
FT                   small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55869"
FT                   /db_xref="GOA:A1WE12"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WE12"
FT                   /protein_id="ABM55869.1"
FT                   /translation="MKPVMALVGRANVGKSTLFNRLTRSRDALVADFAGLTRDRHYGNG
FT                   KQGRHEYIVIDTGGFEPDVASGIYREMARQTQQAIAEADVVVFVVDVRAGVTAQDHDIA
FT                   HYLRRAGKPCVLAANKAEGMQQDQGGKWAEFYELGLGTVHPVSAAHGQGIRSLVEMALE
FT                   PLSPPDDGADAAARDLPDADGVDGVDGVDGADGRIIRLAVAGRPNVGKSTLINTWLGEE
FT                   RLVAFDTPGTTRDAITVPFERNGQRFELVDTAGLRRKGKVFAAVEKFSVVKTLQAIESA
FT                   HVVLLLLDASQGVTEQDAHIAGYILESGRAVVLAVNKWDATDDYQRQLLERSIETRLAF
FT                   LKFASLHRISAKKRQGLGPLWTAIVQAHKAATCKMSTPVLTRLLLEAVQFQSPQRQGLF
FT                   RPKMRYAHQGGMNPPVIVIHGNGLEHVTDTYKRFLEGRFRKEFDLVGTPLRIELKTSHN
FT                   PYVDEGRGGR"
FT   gene            complement(93574..94767)
FT                   /locus_tag="Veis_0077"
FT   CDS_pept        complement(93574..94767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0077"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="SMART: Pyrrolo-quinoline quinone; KEGG:
FT                   rfr:Rfer_2304 pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55870"
FT                   /db_xref="GOA:A1WE13"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017687"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE13"
FT                   /protein_id="ABM55870.1"
FT                   /translation="MRASPETLDTASGRSLPWRGVACALLLAAVTGCSSWGGGSGSGSA
FT                   KPAPADLGVNVPTLGVRQVWTARIGSVAGLPLAVHTAGPVVTLASADGVLAAIDARTGG
FT                   DLWRMALGESLSAGVGSDGKSVAVVSRNNALIVVDSGRERWRGALTAQVLTAPLVAGGR
FT                   VFVLAADRSVAAYDAATGRRLWVLQRPGEPLVLRQAGVLLAVGDTLVAGLSGRLVGIDP
FT                   DNGSLRWEAPLASARGSNDVERLVELVGRSSRVGDSVCVRSFQATVGAVGCVDTARGVV
FT                   RWTRAASGAEGVDGDGDAIFGTESNGTVIAWRRSDGTRLWDSDRLKHRKLTAPLLLGRS
FT                   VVVGDDTGWVHFLSRTDGTPLNRMATDGSGIAAAPTVAADTLVIVTRNGAVGGFRPD"
FT   sig_peptide     complement(94630..94767)
FT                   /locus_tag="Veis_0077"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.822 at
FT                   residue 46"
FT   gene            complement(94764..95444)
FT                   /locus_tag="Veis_0078"
FT   CDS_pept        complement(94764..95444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55871"
FT                   /db_xref="GOA:A1WE14"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE14"
FT                   /protein_id="ABM55871.1"
FT                   /translation="MAHHLDLEEQEQLDRLKHFWRAWGTPITSVLIVVAGAIAGWNGYQ
FT                   YWQNRQAAQAAALWDVADMAVRAGDQARMEQAFGDLKAKYPGTAQAAQAGLALAKALQD
FT                   AGKTDGAKQALEWVAQQSADEGLEALARLRLSSLLMDQKNHEEALQQLSGNFAPAFAAI
FT                   VADRKGDILWLQDKRPQAIAEYRKAYQGFEDGLEYRRLVEIKLDALGAAPQDVAASAAQ
FT                   ARQP"
FT   gene            complement(95455..96780)
FT                   /locus_tag="Veis_0079"
FT   CDS_pept        complement(95455..96780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0079"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: pol:Bpro_2607 histidyl-tRNA synthetase;
FT                   TIGRFAM: histidyl-tRNA synthetase; PFAM: tRNA synthetase,
FT                   class II (G, H, P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55872"
FT                   /db_xref="GOA:A1WE15"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE15"
FT                   /protein_id="ABM55872.1"
FT                   /translation="MNNAAKKPSPAPEKLAAVRGMNDILPPESARWEWLEDKVRTLMAR
FT                   YAYRNIRTPIVEPTALFVRGLGAVTDIVEKEMYSFDDRQSGEPLTLRPEATAGVVRAVA
FT                   EHSLLYDGGKRLYYMGPMFRHERPQRARYRQFHQVGAEALGFPGPELDAELILLAHALW
FT                   RELGLRAVRLELNSLGEPHERLAHRAALSAYLKQHAELLDEQARRRLDSNPLRILDTKN
FT                   PAMQAMVEAAPRLIDFLGRESLAHLHAVQAILDANGVAWTINPRLVRGMDYYNLTVFEF
FT                   VTDQLGAQGTICGGGRYDYLIGQMGGKPAPAVGWALGMERVLELLDAQATAWPCLVPDV
FT                   YAVIPCASVLPLALATLERLRQHGLAVQMHAAPAGEQGMGSMKFQFKKADASGARYALV
FT                   FGEDERARGMVSVKALRDGAGTQVEHALDTLAQWAGTLQSPR"
FT   gene            complement(96793..98118)
FT                   /locus_tag="Veis_0080"
FT   CDS_pept        complement(96793..98118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0080"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="KEGG: pol:Bpro_2608 1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphate synthase; TIGRFAM:
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase;
FT                   PFAM: IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55873"
FT                   /db_xref="GOA:A1WE16"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE16"
FT                   /protein_id="ABM55873.1"
FT                   /translation="MANTRDLLDTTPGACDAPCRDDAPVAIAAPLPRRARQATLAWGAR
FT                   LVTVGGAAPVRVQSMTNTDTVDAIATAIQVKELAQAGSELVRITVNTPEAAAAVPHIRE
FT                   QLDKMGESVPLIGDFHYNGHRLLTDFPACAQALSKYRINPGNVGRGDKHDKQFGQMIDA
FT                   ALRWNKAVRIGVNWGSLDQDLLADLMDANSRRSVPWQLRQVMYEALISSAIGSARRAEA
FT                   MGLDGDQIILSCKLSGVQDLIAVYRALARRCDYALHLGLTEAGMATKGTVASTAALAVL
FT                   LQEGIGDTIRVSLTPQPGQARAQEVLVATEILQALGLRAFVPSVTACPGCGRTTSTLFQ
FT                   DLAKQIDDFLRDRMPVWRLRYPGVENLRVAVMGCIVNGPGESRHADIGISLPGTGEAPA
FT                   APVFIDGQKAMTLRGDNIASEFHQLVERYIEKRFGAMAAPTV"
FT   gene            complement(98118..98990)
FT                   /locus_tag="Veis_0081"
FT   CDS_pept        complement(98118..98990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_2609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55874"
FT                   /db_xref="GOA:A1WE17"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE17"
FT                   /protein_id="ABM55874.1"
FT                   /translation="MTEAADGQATAGGLLRQAREASGMHIAALAGILKVPVSKLEALEA
FT                   DDHSVLTDTVFVRALAASVCRTLKVDAAPVLALLPQNLPRLSANGAGINAPVKSSAASA
FT                   TAFPGSASRSVILVVLALLLGALLLFFYPRHPPDAGVTPAPADAPATTGSAADPAAQAP
FT                   TAASDMAAVPEPPAAGMAGSAAVHSSAAMAPASATAAQVAAGAGAGAGSAQLLVLRARS
FT                   QSWVQVRDATGALALQRTLSAGESVSVAAPTPLSVVVGRADGTEALVRGNPFDLRAVAR
FT                   DNVARFEVK"
FT   gene            complement(98983..99840)
FT                   /locus_tag="Veis_0082"
FT   CDS_pept        complement(98983..99840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0082"
FT                   /product="type IV pilus biogenesis/stability protein PilW"
FT                   /note="KEGG: pol:Bpro_2610 tetratricopeptide TPR_2;
FT                   TIGRFAM: type IV pilus biogenesis/stability protein PilW;
FT                   PFAM: TPR repeat-containing protein; Tetratricopeptide
FT                   TPR_2 repeat protein; SMART: Tetratricopeptide domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55875"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013360"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE18"
FT                   /protein_id="ABM55875.1"
FT                   /translation="MVAGLTGHWPHRGHRTFTACGAVLAALAMVCVAALAGCASRSSQG
FT                   VVSNADAGLITPSDEPENRRRARLRLELAANYFETGQAAVALDEVKQALAADPEYADAY
FT                   NLRGLIYMGLSDFPQADDSFRRALALRGQDPSLLHNYGWLLCQQHKYLQADQYFARAIA
FT                   NPAYTARGKTLMTRGLCQSGAGQLAEAEQSFLKSYEFDAANPVVGYHLAALLLRRNELT
FT                   RAQFYIRRLNNSEFANAESLWLGIKVEHALGDSVAMRQLADQLRKRFPDSSELGAYERG
FT                   AFND"
FT   sig_peptide     complement(99703..99840)
FT                   /locus_tag="Veis_0082"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.485 at
FT                   residue 46"
FT   gene            complement(99996..101171)
FT                   /locus_tag="Veis_0083"
FT   CDS_pept        complement(99996..101171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0083"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="TIGRFAM: radical SAM enzyme, Cfr family; PFAM:
FT                   Radical SAM domain protein; KEGG: rfr:Rfer_2310
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55876"
FT                   /db_xref="GOA:A1WE19"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WE19"
FT                   /protein_id="ABM55876.1"
FT                   /translation="MSTTNLLEFDRDGLADFCARLGEKRFRATQLFRWIHQRGASDFDA
FT                   MSDLARALRDKLKGCARVQAPPVISGQASADGSVKWLFDVGAGNAVEAVFIPEDERGTL
FT                   CVSSQAGCAVGCRFCSTGHQGFSRNLSSGEIIAQLWFAEHALRRRLKTEDRVISNLVMM
FT                   GMGEPLQNLAALLPALRVMLDDHGYGLSRRRVTVSTSGVVPMIDRLARDCPVALAVSLH
FT                   APNDALRDQLVPLNRKYPIDELLQACKRYLAHAPRDFITFEYCMLDGVNDQIGHARQLV
FT                   ELVGRAAIRCKFNLIPFNPFPASGLLRSAHDQILAFAQVLGAAGIVTTVRKTRGDDIAA
FT                   ACGQLAGDVRDRTRVAERMAKQRTMQLQLQLNSSRRAEPSAAGVIGCGESI"
FT   gene            complement(101185..101610)
FT                   /locus_tag="Veis_0084"
FT   CDS_pept        complement(101185..101610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0084"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="PFAM: nucleoside diphosphate kinase; KEGG:
FT                   reh:H16_A2368 nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55877"
FT                   /db_xref="GOA:A1WE20"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WE20"
FT                   /protein_id="ABM55877.1"
FT                   /translation="MAIERTLSIIKPDAVAKNVIGQIYARFEAAGLKIVAARMVHLARP
FT                   EAERFYAVHKERPFFKDLVEFMISGPVMVQVLEGENAVLKNRELMGATDPKKAQTGTIR
FT                   ADFADSIDANAVHGSDAAETAQAEVAFFFPGLNIYPR"
FT   gene            complement(101730..103292)
FT                   /locus_tag="Veis_0085"
FT   CDS_pept        complement(101730..103292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0085"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /EC_number="5.4.99.-"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; KEGG: rfr:Rfer_2312 pseudouridine synthase, Rsu"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55878"
FT                   /db_xref="GOA:A1WE21"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE21"
FT                   /protein_id="ABM55878.1"
FT                   /translation="MNDTTPDTPAAAAQPGSAPAHAARGQETTTSTARGQETTTSAAQG
FT                   QETTRTAPGQETACAAQGRETHTAHDPPADTAATRQQAGPPLAAVDGPAEPTAASAEAG
FT                   AQRERHHPAEPGASRGRPRPPGPRRPAAIAVEGYRLADVVSGRFDADDAASDLPPPKRV
FT                   LLPQVETPKLHKVLAQAGLGSRLEMEQLILEGRISVNNEPAHIGQRIQFGDQVKVNGKP
FT                   IRYRIDPPPARVIAYHKPVGEVVSHDDPHNRPTVFRRLPRLVQGKWQSVGRLDLNTEGL
FT                   LLLTSSGELANQLMHPRFGLEREYAVRVLGALSNEEKQKLLDGVRLDDGIASFGTIEDG
FT                   GGEGANCWYRVTIAEGRNREVRRMLEAVGHAVSRLIRIRYGAMVLPRGLKRGTWLELDE
FT                   RDIRALAQAAGARAPALSTRTPTDARAGKQRERSGPPMGNGPRRGRSPQGPAAGARAQN
FT                   PRRDGGGQGVGAGGNHAGPRAAAQPDPMQTSVGYIGGDSLSRLRQSKRRPAGAGPRRGG
FT                   GGR"
FT   gene            complement(103292..103942)
FT                   /locus_tag="Veis_0086"
FT   CDS_pept        complement(103292..103942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0086"
FT                   /product="condensin subunit ScpB"
FT                   /note="TIGRFAM: segregation and condensation protein B;
FT                   PFAM: chromosome segregation and condensation protein ScpB;
FT                   KEGG: rfr:Rfer_2313 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55879"
FT                   /db_xref="GOA:A1WE22"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE22"
FT                   /protein_id="ABM55879.1"
FT                   /translation="MNTVDAKRILETALICAPQPVPLRELRVLFNDALGADTLKVLLQE
FT                   LQLDWAQRGVELVQVASGWRFQSRPQMREYLDRLHPEKPPRYTRATLETLAIMAYRQPV
FT                   TRGDIEDIRGVAVNSLTIKQLEDRGWVEVIGHRDSVGRPALFATTRQFLDDLGLQSLDQ
FT                   LPVLDDPSGDTDVLAAMAAAARGLIAPEAEPAPAEDLFRNEHVDAPAGIQEST"
FT   gene            complement(104197..105231)
FT                   /locus_tag="Veis_0087"
FT   CDS_pept        complement(104197..105231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0087"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="5.4.99.-"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   KEGG: rfr:Rfer_2314 pseudouridine synthase, RluD"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55880"
FT                   /db_xref="GOA:A1WE23"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE23"
FT                   /protein_id="ABM55880.1"
FT                   /translation="MPHSPPDGKAPVCGELGEPAGAGDDLLEPADEADGELRQMQIGAR
FT                   QHAARIDRALVELVPEFSRSYLQQLLAQGGVSLNGRPVRKAASRVNAGDRVVLEMRPTV
FT                   QSQAFRPQPMDIDVVYEDAHLLVLNKPAGLVVHPAPGHWSATLLNGLLARDANALLLPR
FT                   AGIVHRLDKDTSGLMVVARDRATMDALVAQIARRQVQRQYLALAHGAWSGPRSRSVQAP
FT                   IGRDPRNRLRMAVVDLARHAGKCARTDVLCLDATPQGCWLQCRLHTGRTHQIRVHMASL
FT                   QHPLVGDGLYGGAPLGALQRQALHAERLAFVHPATGQALQFHAEVPQDMQQALSSWGLG
FT                   YNAR"
FT   gene            complement(105237..106124)
FT                   /locus_tag="Veis_0088"
FT   CDS_pept        complement(105237..106124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0088"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: Peptidoglycan-binding LysM; peptidase M23B;
FT                   KEGG: pol:Bpro_3059 peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55881"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE24"
FT                   /protein_id="ABM55881.1"
FT                   /translation="MLMFVSRGLVLVCGLAVAALLCGCGTRLHKAPVEDRGSSLALQQP
FT                   AKPPPPGAENAGKPGYYTVKPGDILIRIGLETGQGWKDIARWNDLDNPNLIEVGQVLRV
FT                   VPPLPVAPAPDSGVVTRPVTSSTVVPTTPAMAPAGAASATAPAATPAAAPAPGATIVAA
FT                   APATPTPAAEDDLSLIWPAQGALIAGFHEVRNKGYDIAGKAGDPVLAAADGRVVYAGSA
FT                   IRGYGNLIILKHNNTFLTAYAHNRSLQVQEEQTVRKGQKIAEMGDTDADRVKLHFEIRR
FT                   NGRPVDPSRYLPAR"
FT   sig_peptide     complement(106032..106124)
FT                   /locus_tag="Veis_0088"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.630 at
FT                   residue 31"
FT   gene            complement(106129..106896)
FT                   /locus_tag="Veis_0089"
FT   CDS_pept        complement(106129..106896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0089"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: pol:Bpro_3060 protein-L-isoaspartate
FT                   O-methyltransferase; TIGRFAM: protein-L-isoaspartate
FT                   O-methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55882"
FT                   /db_xref="GOA:A1WE25"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE25"
FT                   /protein_id="ABM55882.1"
FT                   /translation="MQRRPGPPARFPARLPGSDPPAPRPAAAAPAGAAGSAPSALTGLM
FT                   RARMVQRLAAGGMASAPVLQAMGAVERHRFVDSALGNQAYEDISLPIGLGQTISKPQVV
FT                   ARMCELLLGAEVARAGGLGRVLEIGTGCGYQAAVLSFLAREVYTLERLRGLYDKARDRL
FT                   RPLRLANVHLLFGDGMPGYAKGAPYAAIIAAAGGDAVPQAWCDQLAVGGRLVAPMALSG
FT                   GPQMLLVIDKTLHGLEQSVLEPVHFVPLKSGIA"
FT   gene            complement(106896..107675)
FT                   /locus_tag="Veis_0090"
FT   CDS_pept        complement(106896..107675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0090"
FT                   /product="3'-nucleotidase / 5'-nucleotidase /
FT                   exopolyphosphatase"
FT                   /EC_number="3.1.3.6"
FT                   /EC_number="3.1.3.5"
FT                   /EC_number="3.6.1.11"
FT                   /note="KEGG: rfr:Rfer_2782 stationary-phase survival
FT                   protein SurE; TIGRFAM: stationary-phase survival protein
FT                   SurE; PFAM: Survival protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55883"
FT                   /db_xref="GOA:A1WE26"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WE26"
FT                   /protein_id="ABM55883.1"
FT                   /translation="MKILISNDDGYQAPGIVALHDALKTLEGVTVQVVAPEHNNSAKSN
FT                   ALTLHSPLYVHQAASGFRYVNGTPADCVHIALTGLLGYRPDLVVSGINNGANMGDDTIY
FT                   SGTVGAAMEGYLFGVPAIAFSQVDKGWGELEAAAAKAREIVAQLRAQNLVDPQAPWLLN
FT                   VNIPNMPLTALRPIALCRLGRRHAAERVIVQQSPRGEAMYWIGGAGPAKDDAQGTDFYA
FT                   TAHGHVSITPLKVDLTDHDSLADWAQTAMRLAPGACI"
FT   gene            107807..108781
FT                   /locus_tag="Veis_0091"
FT   CDS_pept        107807..108781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0091"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rfr:Rfer_2783 alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55884"
FT                   /db_xref="GOA:A1WE27"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE27"
FT                   /protein_id="ABM55884.1"
FT                   /translation="MHAWLCTEPTGVQALAWTELPTPAPQAGEVLIEIRAASLNFPDLL
FT                   IVQNKYQKKPPLPFVPGSEYAGVVAAVGAGVTQLKPGQNVACLSGTGGFGTHAIAAAEL
FT                   CLPLPDGFSHVDAAALIMTYATSHHALADRAQLQAGETVLVLGAAGGVGTAAIQIAKTM
FT                   GARVIAAASSAEKCALCRSIGADASIDYSQDNLREAIKTLTDGQGPQVIYDPVGGDLSE
FT                   PAFRSIAWRGRHLVVGFASGPIPALPWNLALLKGASIVGVFWGDFARREPRSNAAMMGQ
FT                   LAQWYAQGKIKPVIDRTMPMAELPAAYARMGARGVMGKLVLVN"
FT   gene            108832..109461
FT                   /locus_tag="Veis_0092"
FT   CDS_pept        108832..109461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0092"
FT                   /product="Phosphodiesterase/alkaline phosphatase D-like
FT                   protein"
FT                   /note="KEGG: rfr:Rfer_1326 alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55885"
FT                   /db_xref="GOA:A1WE28"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE28"
FT                   /protein_id="ABM55885.1"
FT                   /translation="MLHAAWAASAGSAPRRAWSRSPALGRNPFALGVASGEPAPDGLVL
FT                   WTRLLLAEPGQQQTPYSVRWELAHDSRFARIVQRGQAPALPQLGHGVHVQLHGLAPERW
FT                   YHYRFMLGDAVSATGRTRTAPAPGMLPAALRLAFASCQRWEHGHYAAWRHLAADQPDLV
FT                   SRHRSSVGLRWPSKRIAALHRLPIRSVLASAAPCAALRWLRAAYDI"
FT   sig_peptide     108832..108891
FT                   /locus_tag="Veis_0092"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.658) with cleavage site probability 0.584 at
FT                   residue 20"
FT   gene            109839..111800
FT                   /locus_tag="Veis_0093"
FT   CDS_pept        109839..111800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0093"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="KEGG: rfr:Rfer_2203 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger, CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase catalytic core, N-terminal
FT                   domain; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55886"
FT                   /db_xref="GOA:A1WE29"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE29"
FT                   /protein_id="ABM55886.1"
FT                   /translation="MSIPASFIQELLARIDLVDIVGRYVPLKKGGVNLMGLCPFHEEKS
FT                   PSFSVSPAKQFYHCFGCGKSGDAISFLMAQAGLDFVEAVQDLARQAGLQVPDDNSSPAD
FT                   KERAAAARQKQATLSEVLEKAAAAYRQHLHDTPHAIAYFKSRGVSGAIAERYGLGYAPD
FT                   GWRSLASCFARYDDPLLAESGLVIVNAEDGGKRYDRFRNRVMFPIRNVKGECIGFGGRV
FT                   LGQDKPKYLNSPETPVFHKGHELYGLFEARSAIHEQGYALVTEGYMDVVALAQRGFPNT
FT                   VATLGTACTPEHVQKLLRFTASVVFSFDGDAAGRRAARKALDGALPHASDTRSIKFLFL
FT                   PAEHDPDSFIRSHGPEAFARHVGDAVPLSRFLLETASEGCDLGSAEGRAHMASNARPLW
FT                   TALPDGVLKRQLLAELAQLTQLDARDLSDLWSPDHSRQSQRPANPGHPPALDDRHPPRD
FT                   ASNGHGDSGGYAVQRPAWRKSADWQSGNGNRRAAPWPPSQPRLPRTPNASRADHAARLL
FT                   LAHMDLLQELTHDDHSTLCAQPAPHGPLFAWLEAQFHERGPVAWARLRESLREHECEAL
FT                   ALKVMTGAHAQTEGELQELWLELRDLLNRMQIEDIKQQQKLLILQAAQDPTALDRYRAL
FT                   EQKRTALQNAAVSAASAA"
FT   gene            112053..112316
FT                   /locus_tag="Veis_0094"
FT   CDS_pept        112053..112316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0094"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   KEGG: noc:Noc_0665 excisionase/Xis, DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55887"
FT                   /db_xref="GOA:A1WE30"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE30"
FT                   /protein_id="ABM55887.1"
FT                   /translation="MSTSTNEGEILTIGQGADYLKVTQRTIYRPAAAKEIPAFGVGGVW
FT                   RFSRVDIDGWIEQQSRPVPGHAGNGTGKRPSDKGDQEERKQC"
FT   gene            112310..115042
FT                   /locus_tag="Veis_0095"
FT   CDS_pept        112310..115042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA2686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55888"
FT                   /db_xref="InterPro:IPR007555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE31"
FT                   /protein_id="ABM55888.1"
FT                   /translation="MLNLTLREEFRGNRLKGTAIELSNDKNTGATQMAAEAFLQITYPT
FT                   RDLLKGIEAVGPNQGRPVVVIGERGLGKSHLMAVLYHAVNDAASTRVWLNHWAATLGDP
FT                   QIAKIALRDGMQVIGESLHRQRCKFLWDLLFDHHPHGAYIEGKWAGMGAAKTDIPSDQL
FT                   ILELLQHRPTMLLLDEFQTWYDGLTNSKQHPWKNWAFTFIQILSEIAKEHPDLLVLVIS
FT                   VRNGGGDAYQQVHRVNPVVIDFQAGGDAERIQQDRRRMLLHRLFDNRRQIAAASIESLV
FT                   AGHVAESFRLLEVPPSEQERKRREFTESWPYAPHLLRLLEEQVLVATDAQETRDMIRIL
FT                   ANLYKTRGAAAPVLTAADFRLDDDASGIAALLDSVSNERHRALRTKARQNIIAVTEAVA
FT                   DHARRAPHLQELVSALWLRSIAVGNLAGAEGATLQADITRSQAIDDNAFQVELATIVEN
FT                   SFNIHQDGLRLVFREEENPRAKLRACARNDKLFADGSDQAQLARQIRYVIGSADEVAKT
FT                   FRVIALPKAWQTDPWSALDEAERPERWDERLPILVLPEEPDHLGLRLGRWLRDHLQKRR
FT                   NTVRFLLPCSGSTNAFQDRDLLILARAEMKAQEWSGQNPEYKKLHSEFQAALRDKLKKR
FT                   FDRFAVLQRWNFADPGQCTFSVESLKKQGAQIPEGIEEALTNDLFVPEDFEDLVLQAAS
FT                   ENAALGKLLRELQEPRPAGQDCIAWLGETTMKERILRLCAKGKVAINLRGMEYLQTHPG
FT                   EDEDTAWRRLRPKLSLTGRHLDDVFVMLPSAVPATGGSTPPAPAPAPTSGGGSFGGDGG
FT                   TPPVPGGDMFPGAPPAPTPEGIFGGDGSTARPRIPLSNPATSPLNLIGKIEGWGIGPAT
FT                   KVAQVSIKISTATGAQLKELLKKLPEGMTFELNLEKEDD"
FT   gene            115042..116034
FT                   /locus_tag="Veis_0096"
FT   CDS_pept        115042..116034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA2685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55889"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE32"
FT                   /protein_id="ABM55889.1"
FT                   /translation="MALTAAALHALTQGSDADAWRVIVGHAVEIARKPLAAGNAPSEVV
FT                   KRDREVGELDLFLSSSGWDLWQAFGNSVERTSDRLVRWWAEPFSAKAVLILDGLSLREL
FT                   PWLLQGAKEHGFTTREVSAHASELPGATNEFAQALGFGSRSQLRSNGGGLAHKLQPAHT
FT                   ESSDMPWQDCAGLIDGAPNWVFWHHWPDSKMHHLSGAGHGLDTLARDAAERLGSNDFWA
FT                   FVERLATGRRLVITSDHGYAATGDFSDADGEVKRFLKQTFASGRSAKGSGDTGPFMPPV
FT                   ALRINSPHGAHLLALGRWKWKSQSGYPTLTHGGLSLLEVLSPFVVLSNE"
FT   gene            116064..117080
FT                   /locus_tag="Veis_0097"
FT   CDS_pept        116064..117080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0097"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5; SMART:
FT                   AAA ATPase; KEGG: she:Shewmr4_2522 AAA ATPase, central
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55890"
FT                   /db_xref="GOA:A1WE33"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE33"
FT                   /protein_id="ABM55890.1"
FT                   /translation="MAQSDLLVDLFKTATSGDQLAFRKIAEGLIQEEKQKGHRLLAERL
FT                   AKALQANATPFARPPAAKMNGGSMNKELFYEMTPERNLDSLILPEKIKTQVRELIEEQH
FT                   RSELLHAHNLHARNRVLLAGPPGNGKTTLAEALAFELMYPLIVIRYETLVGSYLGETSS
FT                   RLKNVLDYARTQRCVLFFDEFETLGKERGDTHETGEIKRVVSSLLLQLDAMPDYVVVVA
FT                   ASNHPELLDKAVWRRFQLRIELPRPSREQLTICIASIAQRCNINFGYEPETLAKHLSGL
FT                   NFAEVEEFCLGVVRRAVLDMKTENAKPLTQLKLEQWKSRFKSAHDKPATTASKGIDR"
FT   gene            117080..119698
FT                   /locus_tag="Veis_0098"
FT   CDS_pept        117080..119698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_2521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55891"
FT                   /db_xref="GOA:A1WE34"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE34"
FT                   /protein_id="ABM55891.1"
FT                   /translation="MENHFPLLVFPQARTIDPPKGSGFTPSKPHLPEHDRQVARLDAQL
FT                   ASLQQDFDRYKADISGSVAGLEPETVLVIEIAGHFDEFRQAVEAIGLEWLGEWDVDDIE
FT                   PDEDFFEQDKKGEKTDKPVKVRVFLSFGNEAGMRELLSLWGHWKNRHTLPRGKTKWRDV
FT                   FNQTLQIRRWGMEEALRETGMLDRWRDLLDPINPAQPIHCQIELFYRKSEDRRRQGERN
FT                   VVALLEAAAGRTLSSFIDMPEIAFHAVKAELPAESIRQLLNDLDSEAHDTDIQIFKFHG
FT                   VMYFRTTGQSLAVTEDGEGVDTEIAEGVVNLPPIAAILDGAPNVQHQALKGRLLPDDPD
FT                   NLSAQYQPGERKHGTAMASLVVHGEMAGGQSDPLPRLVYVLPIMQPDPHSMNRSEHVPD
FT                   EIFFEDRIARAVRRMFEGEGTTPAQAPGICIINLSIGDPARPFIHTPSPWARLLDWLSW
FT                   KYRVLFCVSAGNYPDAIDIALSGPEYLALTDTKKVEHVLKCIQTQLSGRRILSPAESIN
FT                   AITIGATHSDNGGNYYQGQRTDLLPSASLFSPAARLGHGFRRSIKPEILLPGGRQLYRT
FT                   PVLDSQTIYQLDGGLAAPGQQVAWDSNQAGALSQTAHTRGTSNATALATRSAARIYEVL
FT                   DALRAEHGENIPQELISVLIKALLVHGAKHDNDARKAIISALKPPAHQSKEVTGRYLGY
FT                   GAVDIERVLACTEQRGTVLGCGEIHENEIHEYRLPLPPGLASCRVWRRMVVTLAWFTPI
FT                   NPNHRYLREAKLELSPSGGWEDSQLKLEPQEADRHQVLRGTVQHEVREGEKKIAAYQDG
FT                   DSILLQVTCKKDATAKLDHAIPYGLAVTLEVAEGIPIPIYEQLRTRLQARLAVGAAGGT
FT                   R"
FT   gene            119698..122913
FT                   /locus_tag="Veis_0099"
FT   CDS_pept        119698..122913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA2684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55892"
FT                   /db_xref="GOA:A1WE35"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE35"
FT                   /protein_id="ABM55892.1"
FT                   /translation="MATKKEQLAQEVAKIVGAGKAVAMETVDFNDPNRPKTCLEVDFPI
FT                   LPVNQVAIIEGNAGKPIYQMSKWWARRRSSVFRSMLIAAATKAPEDKSHAARLVWDNYY
FT                   ANHQKKGAFKHLKVADIFMGGGTTLVEGSRLGMQMIGNDLNPVAWFVVKQELADVDLEE
FT                   VRKLLADIEAEVKPQIMPYYCCDGPNGETGRWTHLPSKQAMPAGFDPLAIPRQERKDYG
FT                   YEGPEIIYTFWAKHGPCQVTGCGHRTPIMSSPVMAVKSISVKHWEHACSQCGGDFHVEE
FT                   NAARMAPDVPLYVAPGEYPHSTLDPVRGALCPHCGHAEMIKLGKGKNKKVELSLLVHPQ
FT                   WLAGSPRQNASGQPYGGSAQDDAAATTRWDQARAGKIRLLEVRGALPDAVTCPETGATF
FT                   APEKGTVPKKSHYACGACGTVQDVLSTIEATGKTGPMAAYAVQGHAPKRDAEGMPYRGR
FT                   FFAAYDVEHARQYDAALVEWDARKNGDLKDYWPRSAVPFGFMTGIANGDIREGHGFTHW
FT                   WTMFNPRQLLVHAQLLKAVTTAGDYDWKVREFVLGAFQQYLRNQSLFTLWNVQGDKLEP
FT                   QFANNNYHPKSTVVENCVFPSLGRGNWASCIEGINEGREWAAQPWEAVSIESLKRRDPA
FT                   LAEQLAGKSEKVMPGDPVRGAAVLQGSSTDLAQIGSASLDLVITDPPFGGLLHYSELSD
FT                   FFYVWLRLALKEKYPDYFGAEYTPKSLEAVANRAREPEDPDGFYQRLLTQCWREAHRLL
FT                   KPGGILAFTFHHSEDEPWVAVLESLFDAGYYLEATYPIRSDETKGEGEFGSKTIEYDII
FT                   HVCRKRTEEPKPVSWGRMRREVMADVRQLQAMLENHAKEGLPAADIQVIRRGKALEYFS
FT                   RHYGKVFVDEGRAISVKDALVGINQLIDDDADKGKEAPPVNAEPMTRQFLRTFGTATEI
FT                   KRDQLQKFLKGSITTPDEFVQRGWCAEKNKLFTRTEPLEFAREWSGRHRRKLTSDLDQA
FT                   LVLIGACIDGSGINASDTLKNGHFKPHVALKPLLEWLHRNGPDQPTRNAAARAVSIYTA
FT                   WHASQAHRSVQGSLFDGDGEYEA"
FT   gene            122910..123410
FT                   /locus_tag="Veis_0100"
FT   CDS_pept        122910..123410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA2683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55893"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE36"
FT                   /protein_id="ABM55893.1"
FT                   /translation="MRQLLDTVWQRRGTSWLWDEVARNQICTASQVWSLRQFLRAADNW
FT                   PDDLPSNDNQTLVVAGLDGSLDLLAPADAEAWLGDVIKPAVLSFQDGYQGEAALVFWLP
FT                   MGDKRLDVQKSTDAVNWLCAAPHGQSRLDFSRILWGEANEYPQEILLRDGGKSAGLFHL
FT                   RIT"
FT   gene            123422..125413
FT                   /locus_tag="Veis_0101"
FT   CDS_pept        123422..125413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0101"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG: fnu:FN0830
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55894"
FT                   /db_xref="GOA:A1WE37"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE37"
FT                   /protein_id="ABM55894.1"
FT                   /translation="MSSILPINVDDLLRLQGVESARVEFKASWDEKTTGSQIIRTICAF
FT                   ANDFQNLNGGYIVLGVAEQDGAAVLPAKGLSEKEIEDAQKWIRGRCNVIDPVYQPVLSP
FT                   EIHEGQRILVIWAPGSQARPHQAPESVEKGASRKFYIRLGSETVDADRQPELKTQLMQL
FT                   TARVPFDDRRALQASVLDIRETKVREFLNDIGSGLVDEADTKTLYRALRIADPVNGHDA
FT                   PRNVGLLFFSQNPEQWFPGARIEVVQFAGDSSGNTLEEKVFSKRPVQEQLRECLAYLEG
FT                   LSVRMIQKLPGRTQAGHWVSYPSLALREALVNAVYHRSYEGVQEPVKVYLYPDRMEIIS
FT                   YPGPVPGVEIKHLDGSAPLPPVPARNRRIGELLKELRLAEGRGTGIPKVRRTMEQNGSP
FT                   PPRFDFDEARSYFRVTLPVHPEYQAILALQDVAHLRAVGDVQGTLQRLQEAYKANPATL
FT                   GVAVELAKELVSKGDVHGAENIHQQFKASAPAANSASLITLIASAWLDAGKQKEAVSWL
FT                   NKLPLLDAIGDAFEAAIQEKRAGRFEKAHRYFQLAGDAVLQDVKALHEFAQVKMKLADK
FT                   ARPRHRSESRVAYTKLLDEAREMLQRVVQMNAPRARHAWAWYDLGRVLRWSKAALPEVR
FT                   RAFEKAVENDPHEDRFSRALKELDDRNG"
FT   gene            125397..126437
FT                   /locus_tag="Veis_0102"
FT   CDS_pept        125397..126437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0102"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; type III restriction
FT                   enzyme, res subunit; SMART: DEAD-like helicases-like; KEGG:
FT                   mca:MCA2682 prophage LambdaMc01, helicase, SNF2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55895"
FT                   /db_xref="GOA:A1WE38"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE38"
FT                   /protein_id="ABM55895.1"
FT                   /translation="MIAMAEIEAESALQPGERITHHEYGQGVVLDPARDGYLRAFFSVG
FT                   ERRVPVGSVQRQLSRTERILRAVAGGADRGRKAWLSCEAHALPVVESASALTSARIDLL
FT                   PHQVVLTHRIATASPRHYLIADEVGLGKTIETALILRELVSRGELKRALMVVPAGLVNN
FT                   WHRELNAVFHLDFEVFGSEGDITDRKTNAFARHDRLIASIDTLKRPARIRRLLDAPRWD
FT                   LVVFDEAHHLAAYRTGGKVRKTENYKLAEALKGHSRDLILLSATPHQGNHFQFWMLAQL
FT                   LNPALFGSPEEMVENRHRLNTVMLRRTKADACRPDGSPLFARRWVHTESFLMGPQERLF
FT                   YEKLRE"
FT   gene            126500..126925
FT                   /locus_tag="Veis_0103"
FT   CDS_pept        126500..126925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_3644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55896"
FT                   /db_xref="GOA:A1WE39"
FT                   /db_xref="InterPro:IPR025058"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE39"
FT                   /protein_id="ABM55896.1"
FT                   /translation="MKLTAGFIAGATLVPLALIHFYWAFGGAWGKDSAIPSDRKGVKLF
FT                   QPGLPACLLTGLLLLLCAVNIFMGAGIMPMLFVSPPTVILGLWATTLIFVLRAIGDFKY
FT                   IGFFKSINDTEFGRRDSLFFSPLCLFLAILCLAMAMA"
FT   sig_peptide     126500..126592
FT                   /locus_tag="Veis_0103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.698 at
FT                   residue 31"
FT   gene            127292..128185
FT                   /locus_tag="Veis_0104"
FT   CDS_pept        127292..128185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA2682 prophage LambdaMc01, helicase,
FT                   SNF2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55897"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE40"
FT                   /protein_id="ABM55897.1"
FT                   /translation="MCDKISKLFHVGKWSASPAHNGRLSFAICSRGRYQGHEGHGTPST
FT                   RATPLTIAKASLSSKTPEGFNIYRKQSATLLEARPQRGHIGETWLRSSAVSPRSQCRCG
FT                   IKRIFLPHLADGFDLARRQGHQGRALGFLMAIFQKIAASSFAAVRRTLKRRLLMLTLHE
FT                   ALLRDKDLDIEGRERLTSQARDLIHEEFGLPRDNIGRSEVERVLADLRHQLIRKLDEDA
FT                   LEMASDPHGSEYVAVRAEEAAGAVVALHLPEERLRIGALLKVFPQQRETKTQKLLDGLG
FT                   TLWRQNPNEKIVVFAT"
FT   gene            128301..129788
FT                   /locus_tag="Veis_0105"
FT   CDS_pept        128301..129788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0105"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   xom:XOO_1836 ISXoo5 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55898"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE41"
FT                   /protein_id="ABM55898.1"
FT                   /translation="MPEPTDTADFFRSRLAEMIDLRHPLAVLASRLPWTQIEAALAPYF
FT                   ARRVRAGRVLEHDDLFGPSLQVAGAGVAAAGRPRLPLRLMASLLYLKHVYKLSDEELVE
FT                   RWAENVQWQFFSGMTFYEPRLPCDATQIGRFRSILGEAGVEELLKATIDTAVASKAIKP
FT                   AEFERVIVDTTVQEKAIAHPVDSRLLEIARAKVVAAAKRAGIALKQTFAKEGKNLRRRA
FT                   GGYAHAKQFKRLKKVLKRQRTVLGIVLREVQRKLCKLPATSVPAVDRLRALMGRAERIR
FT                   TQRPKDKNKLYALHAPEVECIGKGKARRPYEFGVKVSVAVTHKQGLVVGARSFTGNPYD
FT                   GHTLAEQLEQVKILTEDTGASPKQAVVDLGFRGVDAANPGIQIIHRGRFKSLTDAQRRW
FT                   LKRRQAVEPTIGHLKHDNGMDRCWLQGATGDALHAVLCAAGYNIRWLLRAIMRLGLKGL
FT                   LLRLIALLRTLIGVPHFFASNEITPSRAAARFAAIAK"
FT   gene            129817..131148
FT                   /locus_tag="Veis_0106"
FT   CDS_pept        129817..131148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0106"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; KEGG: mca:MCA2682
FT                   prophage LambdaMc01, helicase, SNF2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55899"
FT                   /db_xref="GOA:A1WE42"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE42"
FT                   /protein_id="ABM55899.1"
FT                   /translation="MDLIAREIDQTFPGQGVEVLRGGDHGAKVAAERRFRQKDGPRVLI
FT                   CTAAGREGINLQFARILFNFDLPWNPMDVEQRIGRIHRYGQNHTAQVYNFVLSDTIEGR
FT                   IFLMLDEKLVEIARTVGKVDDRGKVAEDLRAQILVYNFVLSDTIEGRIFLMLDEKLVEI
FT                   ARTVGKVDDRGKVAEDLRAQILGQLSERLNYARLYQEALSDPELQRTRVELEAALSNSR
FT                   EARQVVFDLFQDLEGFSLDDYKPFSDVSSSLDRLVRFLCAAVMQRQQKLLKVDEQTYDL
FT                   MTADGARRARFTLNRDSATNQDDLELLGLDHPLVQEELGRWRSVPPEDIGIAVAGDVEE
FT                   PVLLSLWMVETSAGNGERRVVVQPIAIEHDGTRVPAVERRCERYLQAPASAPRLAPEQR
FT                   LALFAQAVEPALQRELQQKGAVNGDGSYSAELIAYAEINSDGRG"
FT   gene            complement(131316..132683)
FT                   /locus_tag="Veis_0107"
FT   CDS_pept        complement(131316..132683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0107"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: pol:Bpro_4702
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55900"
FT                   /db_xref="GOA:A1WE43"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE43"
FT                   /protein_id="ABM55900.1"
FT                   /translation="MLSIHNPATGEILAILPADDAASVAAKSRLARAAQTAWARVALQE
FT                   RLACVGRFRAGVVRELESLARTMTQETGKPITMSRNELNGLLARIDFFSAETAASIASE
FT                   TVFDDATTQEQIEHVPLGLIANISAWNYPWFVGSNVLIPALLTGNAVLYKPSEFAALTG
FT                   LAMTRLWHEAGVPKDLLACLIGAADVGSALLDQDLDGVFFTGSHATGQRIAQTLAPRLV
FT                   KLQLELGGKDPSYVCADADPQTAAAALADGAMYNTGQSCCSVERIYVHEAIHDSFVHAF
FT                   VETVRSFKLGDPLQDSSYIGAITRAPQLAVLQAQVDDALAKGARLLTGGKRLSGPGNWF
FT                   EPTVLIEVDHRMALMREESFGPIIGIQRVSDDAEALRLMNDTRYGLTAGVYTPDAARAR
FT                   ALLAQIDAGSVYWNCCDRVSPRLPWSGVGDSGVGLTLSRYGIQTFTRPKAWHLRRV"
FT   gene            complement(132686..133462)
FT                   /locus_tag="Veis_0108"
FT   CDS_pept        complement(132686..133462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0108"
FT                   /product="peptidase C26"
FT                   /note="PFAM: glutamine amidotransferase class-I; peptidase
FT                   C26; KEGG: pol:Bpro_4701 peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55901"
FT                   /db_xref="GOA:A1WE44"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE44"
FT                   /protein_id="ABM55901.1"
FT                   /translation="MERLKIGVSACLFHPDPGRRAFASKTLHYLEQSVAHWIMAGGAMP
FT                   VLIPSPTGDTARGDVTLADYAQWLDGVVMHGGADLWPGNYGEQPLRPEWAGDKLRDDYE
FT                   IALLKAFVAAGKPAFGICRGLQLINVAFGGSLYQDISSQTASTLRHQDMQAYDRLFHGL
FT                   HIEPQSRLSELLPQPGRVNSVHHQAIKALAQGFVVEARCPEGGIIEAIRHQGCARGGPW
FT                   VAAVQWHPEFHKPEYGVIDDSALLTDFLSAAARQKT"
FT   gene            complement(133465..134601)
FT                   /locus_tag="Veis_0109"
FT   CDS_pept        complement(133465..134601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0109"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   pol:Bpro_4700 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55902"
FT                   /db_xref="GOA:A1WE45"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE45"
FT                   /protein_id="ABM55902.1"
FT                   /translation="MDPLHGFSFPTPIRFGPGARKHVARHLLEQGLRRPLIVTDGALAA
FT                   LPVLAEFQTHLSGLQVALFCGVFGNPTCAQVMAGAQAYRQHQADCVIGFGGGAALDVAK
FT                   VVGLAASHEGDILEYVWDHPQVRAIVHPLPYFVALPTTAGTGSEVGRSSVISENESHLK
FT                   RVVFSPKILARCVFADPELTLSLPPRVTAATGIDALTHNVESYLSPAYHPLCDGIALEG
FT                   TRIAAAALYTAVKEPGDLQARSDMMMASMMGAIAFQKDLGAVHSCAHALGAVCDLHHGL
FT                   ANALMLDTVMAWNLEAAPDKFERLAQACRIDGGGAAFAPWLKALKARIGISGGLAAHHV
FT                   QPSQLPRLVEVASQDICHRTNVRPCSQADFERLFAQAM"
FT   gene            complement(134617..135993)
FT                   /locus_tag="Veis_0110"
FT   CDS_pept        complement(134617..135993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0110"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   pol:Bpro_4698 glutamine synthetase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55903"
FT                   /db_xref="GOA:A1WE46"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE46"
FT                   /protein_id="ABM55903.1"
FT                   /translation="MNDSSMAHPPLHPAVAAALESGSTKVKVAVSDVDGILRGKYLHRD
FT                   KFKSAAESGFSFCDVVLGWDAHDHCYDNTRLTGWQHGYPDALVRIDPGTARQVPWDRQV
FT                   PFFLGEFVNPDGSPHALCPRQTLKRVLKRAEKLGFTVLAGMEFEWFNFKESAQSWAAKQ
FT                   GVGPEPITPGMFGYSLLRMADNPGFFNALMDEMAAFDVPIEGLHTETGPGVYEAAISFS
FT                   EALAQADRAILFKTGAREIGKRFGIMPSFMAKWNQALPGCSGHIHQSLSDGQRNLFFDA
FT                   SSERKMSPLFESYLAGQIGFLMEFAPLFWPTINSYKRLVDGFWAPVKPSWGMDNRTASF
FT                   RVIAGSPKATRLETRCPGADINPYLALAAVIAAGLHGVEQGLKLSAPPITGTNQGAENV
FT                   ARAPRTLIETTRVLQHSRVAHDWLGDAFVEHFAATREWEWRQWLDGVTDWELKRYLEIV
FT                   "
FT   gene            complement(136265..136789)
FT                   /locus_tag="Veis_0111"
FT   CDS_pept        complement(136265..136789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0111"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   rme:Rmet_4644 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55904"
FT                   /db_xref="GOA:A1WE47"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE47"
FT                   /protein_id="ABM55904.1"
FT                   /translation="MARIPYYDLSQAPESYTRLIAARPPLNLYRMLAHAGKTAEGFLAL
FT                   GSAILRENTLDAKLREIAILRTGILCGASYEVHQHRRVARRVGLSDDKIDALGKDADRS
FT                   ALDATETLVLEFTDQVVLHVKAPDAMFEALCARLPHGQVAELVLVIGFYMLVSRFLENF
FT                   EVDIEPPGAVG"
FT   gene            complement(136865..138385)
FT                   /locus_tag="Veis_0112"
FT   CDS_pept        complement(136865..138385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0112"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: bxe:Bxe_B1961 ABC peptide transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55905"
FT                   /db_xref="GOA:A1WE48"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE48"
FT                   /protein_id="ABM55905.1"
FT                   /translation="MTTLHLPAAACCLLSLALLAPAAQAQKRGGTLTIGMEAEFSGFNP
FT                   AKARIFNQNTLAPASSVLETLFVFEGAQIVPRLGLDYAEAPDRLSATVRLRPGVTFHDG
FT                   TPFNADAVVAHYAWLLAPGTGINLSPIAPLKTVEKVDEMSVRFVLRQPWVALQSALAAE
FT                   NLVNFIGSPAALKNDPEGFHRKPIGTGPFIFKEWQAGDRIVMERNPHYWEPQLPYLERL
FT                   IYRVLPDANTRYQSIKSGQVDIGRMDTASHVLDARKNPQIKVHEYQGSGAISWNFNAAK
FT                   EPFNDQRVRAAVVHAFNAKAMLDTFFLGTTVATTDLFGPNSPWFCPRLNWRSHDLAKAR
FT                   ALLAEVGKPVKFQLVSTNTPTGRRQAGMVQQFAKEAGMEVDIRLTEQSQNVRVGLSGDY
FT                   QMGVWRFGDITGEPDGALAYYFGGENGTPVSRHDTARIDALLGKARAEPDQARRKALYC
FT                   DIAQIVSDEAYQLIPIRVTYYAIASPKVRNLGPITNSIIRTRSVWIGQ"
FT   sig_peptide     complement(138308..138385)
FT                   /locus_tag="Veis_0112"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            complement(138382..139413)
FT                   /locus_tag="Veis_0113"
FT   CDS_pept        complement(138382..139413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0113"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: rha:RHA1_ro09044 ABC peptide transporter,
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55906"
FT                   /db_xref="GOA:A1WE49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE49"
FT                   /protein_id="ABM55906.1"
FT                   /translation="MRPQASPAPPVLDVRDLDVVYALTGGQQMRAVERLSFAIGRGQTL
FT                   ALVGESGCGKSSVAKAVMQLVPTAGGVIRLEGQALGPLGGDALKRLRRRFQMIFQDPIS
FT                   SLNPQRTVRQILEFPLKVNGLFDKSESERRIRATLDIVGLDSQQMLGRYPHEFSGGQCQ
FT                   RISIARALILDPVLLVCDEPVSALDVSVRAQVLNLLGELRQRLGLSMLFISHDLAVVRN
FT                   VADCIAVMYLGRICEAGDAQHLLEHPAHPYTVALLSAVLHADPAVPPRRVALQGEMPSP
FT                   LSLPTGCRFRTRCPGAQALCAAAEPALTALADGRQVACHFPYSVARPAANASAFFQPED
FT                   IAP"
FT   gene            complement(139410..140480)
FT                   /locus_tag="Veis_0114"
FT   CDS_pept        complement(139410..140480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0114"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: rha:RHA1_ro09045 ABC peptide transporter,
FT                   ATP-binding component; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55907"
FT                   /db_xref="GOA:A1WE50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE50"
FT                   /protein_id="ABM55907.1"
FT                   /translation="MNRQTRLHDAALLRVRHLGVQFQTAQGPLHALTDVSLDVERARTL
FT                   AIVGESGSGKSVLACSILRLLGPAAQTAPEAQIFFGAQDLLRLERSAMQAVRGRRIAMV
FT                   FQDPMTALNPVRPIGVQLAEGLQLHLRLSRQAAQERATGLLAQVGIGSPERRMAQLPHQ
FT                   LSGGMRQRVVIAMAVACEPELLIADEPTTALDVTVQAEILDLLRGLQRGRQMAMILVTH
FT                   DLGVAAGYADDIAVMYAGQIVEQAPTAALLRQPRMPYTRDLLRAIARLDDPPHALLHSI
FT                   AGRPPVVRALAGGCRYAPRCDRRTMQCEAAQPGLESVACAEGAHWSTPLSTGMSAFGRP
FT                   GGAHAVRCWHPLEIAA"
FT   gene            complement(140477..141334)
FT                   /locus_tag="Veis_0115"
FT   CDS_pept        complement(140477..141334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0115"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rha:RHA1_ro09046 ABC
FT                   peptide transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55908"
FT                   /db_xref="GOA:A1WE51"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE51"
FT                   /protein_id="ABM55908.1"
FT                   /translation="MRAEWCAPGRWWRGKPRARALLRLGLPCAWLLGVLFLALAADWLP
FT                   LPSPTDMDFAAAGQGPGTAHLLGLDLDGRDIFARLAHGARVSLIVCSVAPLIGLVFGSA
FT                   LGLLAAYYGGVLRTAILALLDAMLAFPSLVFALGLTVVLGPSVHNVALALGVMSIPAFA
FT                   RIARANALPLIGREFVLAARTAGASDWQIMLREILPNMALSLLTYALTITSVMIVAEGS
FT                   LSFLGVGVPPPTPSWGGMIADGRESLERVPHVSLIPAAAMFLTVLSLNLLGDGLRQRRS
FT                   PGLA"
FT   sig_peptide     complement(141212..141334)
FT                   /locus_tag="Veis_0115"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.687 at
FT                   residue 41"
FT   gene            complement(141324..142244)
FT                   /locus_tag="Veis_0116"
FT   CDS_pept        complement(141324..142244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0116"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rha:RHA1_ro09047 ABC
FT                   peptide transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55909"
FT                   /db_xref="GOA:A1WE52"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE52"
FT                   /protein_id="ABM55909.1"
FT                   /translation="MLIVLALLSVATFSMLELLPGSVVDAMLSDNARPEEIARLQHALG
FT                   LDLPMHLRFLGWLGNALQGDLGRSPLSGESVSAAITHRLPVSILLMLLAQVLALLIALP
FT                   LGIWAGSNAGRRVDRWLSGGAFGVLAVPHFVLGLLLILLFAIWLRWFPATGYVPFGAEP
FT                   LASIHSLALPAATLALVEAPIYLRLLRSDIASTLRAPYITVARAKGLSERQILLRHALR
FT                   PSSFSLITVLGINVGHLIGGAVIIETLFALPGLGRLLIEAITQRDFVTLQGLVLFIGVA
FT                   FVAVNLVVDAVYALLDPRVGVRHAR"
FT   gene            complement(142797..143639)
FT                   /locus_tag="Veis_0117"
FT   CDS_pept        complement(142797..143639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0117"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: rme:Rmet_4948 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55910"
FT                   /db_xref="GOA:A1WE53"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE53"
FT                   /protein_id="ABM55910.1"
FT                   /translation="MNQQRTHAEPASSSLAGRVAIVTGAGSRSSEIGNGRAAAILLARR
FT                   GAQVLLLDARLDAARETERMIADEGGSAICAQIDVAEAEPCRQAVAIAVQAWGRVDILV
FT                   NNVGIGGPAGNAVDLDIAQWERALRVNVTSMMLMARYAIPEMRKLGAGAIVNIASIAGL
FT                   IGGTPALLYPTSKGAVINMTRAMAAHHGREGIRVNCVAPGMVYTPMVADRMTPEVREQR
FT                   RKRSLLQTEGSGWDVGQAVAYLASDEARWVTGVILPVDAGTTAGNAPSPGLKPDSSGG"
FT   gene            143827..144189
FT                   /locus_tag="Veis_0118"
FT   CDS_pept        143827..144189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55911"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE54"
FT                   /protein_id="ABM55911.1"
FT                   /translation="MTNPDTIEAGRHRPVSCHRSNVVGCAQPSERSARRIACPYRAVLA
FT                   SDATPRCASMASADRQMIRDATLAARASPSAQTTQRIPTCAQGAARLPAPSAWKRQTTG
FT                   ASGRIRARRDGCALRV"
FT   gene            complement(144204..145247)
FT                   /locus_tag="Veis_0119"
FT   CDS_pept        complement(144204..145247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0119"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: rme:Rmet_4950
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55912"
FT                   /db_xref="GOA:A1WE55"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE55"
FT                   /protein_id="ABM55912.1"
FT                   /translation="MKPKADKPGIKDVATRAGVSLGSVSRVINKVENVSPELRQRVLHA
FT                   IAELDYRLNHAAQTLRSRSSRTIGCMFTDVTNPLYANLYRIYEERFRANGYMVLLANSL
FT                   NNPEWELEILSMFQSRRMDGIIIAPGNERNASVLAAVQKIDLPAVILDRDMNVNQDLVL
FT                   FDHAPAVQQAMEHLIDQGHREIALVISGTQTRPMLRRIEGYQAGFAARGLPARADLQVL
FT                   LPASTAPAFDLVHELLQRPARPTALLTLGTSVLADVLNAIRAQGLRIPRDISVVSTGEP
FT                   DFARSHQPRISSVTVDLDAAVRESTALLLTRIREGRAAAPRRVVVPTIFTLRGSCGPAP
FT                   ATAPRTR"
FT   gene            145577..146662
FT                   /locus_tag="Veis_0120"
FT   CDS_pept        145577..146662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0120"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   rme:Rmet_4073 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55913"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE56"
FT                   /protein_id="ABM55913.1"
FT                   /translation="MNEQAPVMPPEARSRQGGAATSRRSLLLSLAGGLAGIGARWSTFG
FT                   FGVSAFGWPRGAHAQPGSYPQRPLRLVLGFPPGGATDHSARLVALKMAELLGQAIVVEN
FT                   RPGASGNIAAEHVARSAPDGYTLFYTTSTVHGINPHVHARLPYDPVADFAPVLYVSRTM
FT                   LVLLARNGLDVKSVPDLVALAKSRPGKLSYASAGLGSTQHLAGALFCRQTGIDALHVPY
FT                   KGSSPALTDLMSGQVDCTIDTLSASLPFIRGGKLNALAVSGLDRSPALPQLPTMAASGV
FT                   KDYAVSAWGGLLAPKGTPAAVVHVLNTAGNAALRTPELIARAAESGSELQGGTPERFGA
FT                   WIAQELARWKLAVAAAGDIGQ"
FT   gene            146659..147552
FT                   /locus_tag="Veis_0121"
FT   CDS_pept        146659..147552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0121"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="KEGG: rme:Rmet_4949 AMP-dependent synthetase and
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55914"
FT                   /db_xref="GOA:A1WE57"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE57"
FT                   /protein_id="ABM55914.1"
FT                   /translation="MNGPAPTRTCSALARQAHQGGCIGEMIRTAIGRFPQRVAFIDAGR
FT                   EIDYAALGRLIGQTMAALRRLGLQRGDGVMQLSGNRVEVFVVMAAAYLMGLRSVTLHAL
FT                   GGHDDHAYIVGDAEPSVFITEAAHGKQAQALRAACLGVAHWFSHDACAGFADFRALAAA
FT                   LEPEPLVPEAQPNDIIRLAYTGGTTGKPKGVMLANRSVWMQAVLLMAARGMRAGMRVLC
FT                   ATPISYGAGAMIVPTLASGGCFILQRGFDPGQFIDALQAQRANAAFLVPTMIYKLLDHP
FT                   RCASADFSSLELLSYV"
FT   gene            147661..148003
FT                   /pseudo
FT                   /locus_tag="Veis_0122"
FT   gene            147963..148853
FT                   /locus_tag="Veis_0123"
FT   CDS_pept        147963..148853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0123"
FT                   /product="Excinuclease ABC, C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC, C subunit domain protein;
FT                   KEGG: aba:Acid345_1092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55915"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE58"
FT                   /protein_id="ABM55915.1"
FT                   /translation="MQPFSITLFATTGDPEGIRHLDKSNWSGHGVVFNRKIFHLLKQEP
FT                   GFSQAGIYILVGNAAEETIYIGEADPVGDRLKNHVSNKERWVWGVYFFDRNHKIGKTEV
FT                   QYLESALVALAKKHDRAILLNKNNPTAPTMAPAAKATAEAFLVDMLLILPMLGINAFTP
FT                   PKQDDPSDQVQPVGSESDKFDTIVVPAREEGFKQRFLNEHCWFAVRINAKHISKLKFIA
FT                   AYQVAPVAAITHIAEIDAIVPYNDTGKYMIKFKGAATAIVPIPRPESSEVNMQSSRYAL
FT                   RDKLLAAKNLDQVWA"
FT   gene            148924..149730
FT                   /locus_tag="Veis_0124"
FT   CDS_pept        148924..149730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rle:pRL80099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55916"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE59"
FT                   /protein_id="ABM55916.1"
FT                   /translation="MEKIRKERILILAKTYPSPSAQYVETSCVAGISQDGAMRRLFPVP
FT                   FRMIEDGQQFRKWQWIDVRVEKAPKDHRPESHKIYVDTINCGDVIDTKKAWSGRWEWLE
FT                   KIPAFDSYDAIEATRRADGLSLALLRPKRLIGLDIFKARNPDWTDEEREKLLQEQMQGN
FT                   LFDEVEERRQVKQLRKVPFDFHYRYVYDTPEGEKERRHKIVDWEAGALFWKCRESHGTD
FT                   WEKPFRAKLEEDLGAKDLMFLMGNQHRFQDQWLIISLVYPPRAFLI"
FT   gene            complement(149727..150200)
FT                   /locus_tag="Veis_0125"
FT   CDS_pept        complement(149727..150200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0125"
FT                   /product="ISRm2011-2 transposase protein"
FT                   /note="KEGG: net:Neut_1256 ISRm2011-2 transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55917"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE60"
FT                   /protein_id="ABM55917.1"
FT                   /translation="MTRTRGRSPKGQRCIASVPHGHRKITTFIAGLRVNAVTAPMVLDG
FT                   PMDGEAFLAYIQQFLCPTLHPGDIVIADNLSSHKVSGVREAIEGVGATLRYLPPYSPDL
FT                   NPIEKFFSKLKALLRQAEQRTVDGLWNTIGHLLDCFTPQELSNYFSSSGYVST"
FT   gene            150496..150735
FT                   /locus_tag="Veis_0126"
FT   CDS_pept        150496..150735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55918"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE61"
FT                   /protein_id="ABM55918.1"
FT                   /translation="MPANLETMSNTFFKTRLDLVHPYSTDFKTLGNIGRTISLFYRLQH
FT                   PISQILRIRLHCILLQKKDAASYHELFGFKSNML"
FT   gene            complement(150732..151214)
FT                   /locus_tag="Veis_0127"
FT   CDS_pept        complement(150732..151214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0127"
FT                   /product="protein of unknown function DUF1130"
FT                   /note="PFAM: protein of unknown function DUF1130; KEGG:
FT                   jan:Jann_0586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55919"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE62"
FT                   /protein_id="ABM55919.1"
FT                   /translation="MTVFTIGYEGLDIDAFMSLLAEHGIETVVDIRELPLSRKPGFSKK
FT                   ALASVLNLSGLEYVHMVALGCPKLVRDRYQEDGNWKRYTDGFLKHLKTQKAAIDELSEL
FT                   AASSNCALLCYEADFNFCHRSMVANAVRDACGADVEHISATDAKTASPASLRLAFA"
FT   gene            complement(151257..152114)
FT                   /locus_tag="Veis_0128"
FT   CDS_pept        complement(151257..152114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0128"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   eba:ebA5346 transposase (IS4), fragment"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55920"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE63"
FT                   /protein_id="ABM55920.1"
FT                   /translation="MAPSLSCGGRPGHCHRWQESARGGTSGLRVARTASGIGLRRRIWP
FT                   DAGAIGLPRKVQRNHGHWRVAANAGARGSGCHHRRHGLPERDGRADRGRWWRLRACRQG
FT                   QPTHLAHALRDFFGTLDAPGYPVRQTCVHETLDKGHGRIETRRCTAAGDLDWLATLGLK
FT                   ERWKKITSVAGIDSSRVIGSKTETDRRYVISSLPADSERILHAVRMHWGIENGLHWCLD
FT                   VAFGEDACPIRLRNAALDFSLLRRAAMNLFRADHSRAMGLPKKRKAAAWNPDYLANILH
FT                   LREI"
FT   gene            complement(152207..152425)
FT                   /locus_tag="Veis_0129"
FT   CDS_pept        complement(152207..152425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55921"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE64"
FT                   /protein_id="ABM55921.1"
FT                   /translation="MGFQEQEMAEKDTLEELIEQLRQLKDPRVAGRTDHNLLDILVLAL
FT                   CAVMSGAQGWDDKRTGDARAKAGCVAI"
FT   gene            152528..153439
FT                   /locus_tag="Veis_0130"
FT   CDS_pept        152528..153439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0130"
FT                   /product="Rhs family protein-like protein"
FT                   /note="KEGG: pau:PA14_20520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55922"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE65"
FT                   /protein_id="ABM55922.1"
FT                   /translation="MRTYFLYTDEGLIAEATQTITINADQSISASAAPTITTQYGPRPD
FT                   SEFMTGVLFIKTKNGNGRDVVAYYHGNHLEVPLQATDNAGNVVWAANYNAFGRADVVTP
FT                   RSATGDSRINSQLRLPGQYEDVETGLHYNFHRYYDLDIGRYSQIDPIGLRGGLNGYVYV
FT                   NGNPLSFTDPLGLDVELRCRPAEIVAGLVNHCWLKTDTIEAGMNKRITCSRAGNELVNL
FT                   DSIWVVVSNHQCDIPTVITPVPFVDEDCVNRELQIGKPLGMFLPPFKSCQTFAQDVIQK
FT                   CAPSSISQPYIKYPIGRWRPRR"
FT   gene            153421..153900
FT                   /locus_tag="Veis_0131"
FT   CDS_pept        153421..153900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55923"
FT                   /db_xref="GOA:A1WE66"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE66"
FT                   /protein_id="ABM55923.1"
FT                   /translation="MATETMMKEFMKKWMTWMLTVLLLLAAALYLMWAIQYVWQGSFPG
FT                   SDTSKFAMAAALKFGVAVLCAVAPIVLRVRHWRESKWLLWMLTILLLLGAWPFLLLAIQ
FT                   NVWLESPPWADKSDDVIRAVFQFGVAVVYAVTPLVLWKQHRQRRGGSAQHRKSGN"
FT   sig_peptide     153421..153543
FT                   /locus_tag="Veis_0131"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.673 at
FT                   residue 41"
FT   gene            153964..154338
FT                   /locus_tag="Veis_0132"
FT   CDS_pept        153964..154338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55924"
FT                   /db_xref="GOA:A1WE67"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE67"
FT                   /protein_id="ABM55924.1"
FT                   /translation="MLPEQYQSALHQISDRKMAVETMMKEFMKKWMLWVLRALLLLAAI
FT                   ISLELAIFAAWQGSFPGSDISKYTMWAALQLGVAVLYAVTIIALQVRHWRESKWLLWVL
FT                   TILLLLGATPFLILAKIMCG"
FT   gene            154671..155087
FT                   /locus_tag="Veis_0133"
FT   CDS_pept        154671..155087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55925"
FT                   /db_xref="GOA:A1WE68"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE68"
FT                   /protein_id="ABM55925.1"
FT                   /translation="MLLLAAVIFLNAAMYAAWQGSFPGRDISKYTMWAMIRLGVAVLYA
FT                   VTLIALQVRHWRESKWLLWVLTILLLLGAWPFLLLAIQNVWLEPDPWEDKSDNVMWAVF
FT                   QFGVAVVYVVTPIMLWKQHRQRRGGSAQHRKSGT"
FT   gene            complement(155228..155485)
FT                   /locus_tag="Veis_0134"
FT   CDS_pept        complement(155228..155485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0134"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: pol:Bpro_1283 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55926"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE69"
FT                   /protein_id="ABM55926.1"
FT                   /translation="MALMITDECINCDVCEPECPNQAIALGLEIYQIDPHKCTECVGHF
FT                   DTPQCVQVCPVACIPADPQHPEDRATLWQKFQRLRATAPT"
FT   gene            155644..156606
FT                   /locus_tag="Veis_0135"
FT   CDS_pept        155644..156606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0135"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bja:blr3230 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55927"
FT                   /db_xref="GOA:A1WE70"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE70"
FT                   /protein_id="ABM55927.1"
FT                   /translation="MGLFFLKRSMTLLATLVGASIVVFLVLEILPGNTAQILMGPDAAP
FT                   DAVAALTAKLGLDRPAGLRYWDWVSGLLQGRMGDSHAYSSPVLDLVLERLALTVPLASM
FT                   AMLITTVLALAAGVYAAAHHNRLGDVGVMGLAQVGIAIPNFWFAILLILLFSVQLRWFS
FT                   AGGFPGWTEAAGGSPLAAFKALLLPAIALAVVQAAILARITRSAVLEVLREDFVRTARA
FT                   KGLSQRAVLWGHVLRNAMIPIITVMGLQFANLLAGTIVVENVFYLPGLGRLIFQSIANR
FT                   DLIVVRNCVLLLAAMVVVVNFAIDMLYALIDPRVKASDI"
FT   sig_peptide     155644..155721
FT                   /locus_tag="Veis_0135"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.696) with cleavage site probability 0.327 at
FT                   residue 26"
FT   gene            156606..157499
FT                   /locus_tag="Veis_0136"
FT   CDS_pept        156606..157499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0136"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bja:blr3231 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55928"
FT                   /db_xref="GOA:A1WE71"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE71"
FT                   /protein_id="ABM55928.1"
FT                   /translation="MASHPVAAAVAATAAATAAPGGWLQRALRQRNFAIGAVLALLLIA
FT                   AAALSLVWTPWSPYEMDLAAKLQPPTLSHWLGTDAFGRDVASLLLVGARNSILVGVIAV
FT                   GIGLSVGCALGLLAAARRGWVEELIMRLADFGFAFPAILSAIMLTAVFGAGIVNSIIAI
FT                   GIFNIPTFVRVTRASANALWSREYILAARACGKGGWRITLEHVLPNISSVLVVQATIQF
FT                   AVAILAEAALSYLGLGTQPPQPSWGRMLSEAQTLMFQAPLLAVWPGLAIALAVLGLNLL
FT                   GDGLRDLLDPRLARKR"
FT   sig_peptide     156606..156662
FT                   /locus_tag="Veis_0136"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.985 at
FT                   residue 19"
FT   gene            157534..158553
FT                   /locus_tag="Veis_0137"
FT   CDS_pept        157534..158553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0137"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:blr3232 ABC transporter ATP-binding
FT                   protein; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55929"
FT                   /db_xref="GOA:A1WE72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE72"
FT                   /protein_id="ABM55929.1"
FT                   /translation="MSLLEVSRLQIRLQTHRGPADAVRGVDFSLARGATLGLIGESGCG
FT                   KSITALALLGLLPEGAQVSGSIRFDGQELLGRSDAQLCQLRGNRIGMVFQEPMTALNPV
FT                   HSVGRQVAEPLRLHRGLGATAARQQATALLDRVGIADAARRFDAYPHQFSGGQRQRITI
FT                   AMALACGPDLLIADEPTTALDVTIQQQILDLISSLVAERNMALILISHDLGVISQNVDR
FT                   MLVMYGGSVVESGSTACVFAAMAHPYTRGLFAARPQWGGAVDAMGAPGQRRLATIAGTV
FT                   PELVDLPAGCPFAGRCSYTVDACHHERPPVQRVAADADGDHEVRCLRHEAIAEAVRKR"
FT   gene            158568..159494
FT                   /locus_tag="Veis_0138"
FT   CDS_pept        158568..159494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0138"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase; KEGG: bja:blr3233 ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55930"
FT                   /db_xref="GOA:A1WE73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE73"
FT                   /protein_id="ABM55930.1"
FT                   /translation="MTMMSMMTMTDSIPAPAAAEASALLEVKDLARSYQLPREHLFRPP
FT                   GKVHALDGVSFSMASGRSLGIVGESGSGKSTLARLVMALDIPTAGTVQLLGRDLHQLPA
FT                   AQLRQARRDFQMVFQDPYGSLDPRQTVERIVTEPLQAQRLHSRAAQREQAAQVLAQVGL
FT                   RHNDLGKYPHEFSGGQRQRIAIARALITKPRLIVADEPVSALDVSVQAQVLNLMQDLQQ
FT                   EFGITYMLISHDLAVVNHLCAQTLVLYQGRIVEQGAPAELFRNAEHPYTRALIAAVPQV
FT                   QPGRARARRAAAASAASGPAASAQAVV"
FT   gene            159578..161086
FT                   /locus_tag="Veis_0139"
FT   CDS_pept        159578..161086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0139"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: bja:blr3234 ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55931"
FT                   /db_xref="GOA:A1WE74"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE74"
FT                   /protein_id="ABM55931.1"
FT                   /translation="MLNRRTVLATGVSGVTGAIIALPLTAPLTALAQGRKDAVVLGMTL
FT                   EPPSLDPTTSAASAIAEVVHYNIFETLTKINTDGSVAPLLAESWEVSPDLKTYTFKLRR
FT                   GVKFQNGEPFTAATVKFAFDRSGSDKSSNKSKSTFASLTTQVVDDYTVVLLNKDIDPDL
FT                   LFVLGQAPFAIVEPKSADRNASQPVGTGPYRLGSWNRGSAVLLTAWEGFRNPAAIKIKR
FT                   ASFRFISDPAAQVAALLAGDVDAFPRITNRGVAQFKSDPRFQVVIGGSRAKTILAINNA
FT                   RKPLDDLRVRRAIAAAIDRKAVIAAATEGYGVPIGSHYVPGAFGYVDTTGVNPYDPGKA
FT                   IRLLAEAGVKTPLTLGMTLPPTPYARLGGEVIAAQLAKVGIIAKMENVEWAQWLSGTYG
FT                   GKNYDLTVIAHVEPFDLNNFANPDYYWGYQSPAFNALFDQIKNTARPAERARLLGQAQR
FT                   LLADDAVHAFLYQGQWVTVANKNLKGLWKDMPVFVNDISALSWS"
FT   sig_peptide     159578..159676
FT                   /locus_tag="Veis_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.977 at
FT                   residue 33"
FT   gene            161197..162603
FT                   /locus_tag="Veis_0140"
FT   CDS_pept        161197..162603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0140"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bme:BMEII0289
FT                   glutamyl-tRNA(gln) amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55932"
FT                   /db_xref="GOA:A1WE75"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE75"
FT                   /protein_id="ABM55932.1"
FT                   /translation="MSDLHDLSAHALMAAYRQRQLSPVEVTQAVLSHIARWEPHLQATY
FT                   LLRPEAALAQARASEARWLRGAPLSALDGVPGTIKENIATEGDPTPLGTAALAPAPAAA
FT                   ADAPPAARMRAAGAVIVAKTTMPDYGMLSSGLSSLHPLTRNPWNLAKGPGGSSAGGGAA
FT                   AAAGYGPLHIGTDIGGSLRLPAGWCGIFSLKPSLGRIPIDPPYTGRAAGPMTRSVADAA
FT                   ALMQLLSQPDARDSMSLPAQDIAWSQFDQGAERLRGLRIGLLLDAGCGLAPEPEVTAAV
FT                   EHAARLMQTAGAIIETMPPFMTQAMLDGMDQFWRMRTHTDLQALPAGRRDKVLPYIRAW
FT                   ADSVAGISGVELFNASQQFHLTRVHTVRACSAYDYVISPVAPMPAFDAELPSPTNDPLH
FT                   AMEHIGFTVPFNMSEQPAASINCGYTRSGLPIGLQIIGARFDDLGVLQLAHAFESIREP
FT                   QRAWPRPPGA"
FT   gene            complement(162640..163719)
FT                   /locus_tag="Veis_0141"
FT   CDS_pept        complement(162640..163719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0141"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   bbr:BB0768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55933"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE76"
FT                   /protein_id="ABM55933.1"
FT                   /translation="MPIRVQSLACAALLALGAALASGATAQPGTTAQPGTTAQPGTTAQ
FT                   PGIAAQPGTAPSDKASHWPSKPVTLVIPYPPGGSSDIVGRQLADRLREELGQTIVVENK
FT                   AGAATAIGATAVARAAKDGHTLLLSAGSTFTVAPHLSDKLQYKFDDFAPVAPVSATPFV
FT                   LVVRKDFPARNLREFAAYAQAHPGKVNNATNGQGGLGHLLGELVATGLGVQLTQVHYKG
FT                   AVPAAMDLIGGIVDSNVQALTNAVPNVNAGQYRALAVLSAERQPLLPQVPTFKELGYPQ
FT                   IVGDAWYAVFAPAGTPKPVLDKLGAAIRKITGSARFGEAMRKVGNQAQTGTPEQLRELT
FT                   LQQSRRWGDLIRQHGIEAE"
FT   sig_peptide     complement(163639..163719)
FT                   /locus_tag="Veis_0141"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.954 at
FT                   residue 27"
FT   gene            complement(163896..164942)
FT                   /locus_tag="Veis_0142"
FT   CDS_pept        complement(163896..164942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0142"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   bbr:BB0768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55934"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE77"
FT                   /protein_id="ABM55934.1"
FT                   /translation="MATPVQSFACAALLALGAALASGAPAQPGTTAQPGMAAQPGATAP
FT                   SDQASHWPGRPVTLVVPYPPGGTSDIVGRQLADRLREELGQTIVVENKAGAATAIGATA
FT                   VAHAAKDGHTLLLSAGSTFTVIPHLNDKLQYKLDDFAPVAPVCTAPFAFVVRKDFPARD
FT                   LREFVAYAKAHPGKVNNATNGQGSLVHLLGELVATGLGVQLTQVHYKGAMPASMDLIGG
FT                   IVDSNTEALTNAVPNINAGQYRALAVLSAEREPLLPQVPTFKELGYPQIVGETWYAVFA
FT                   PAGTPKPVLDKLGAAIRKITGSARFGAAMRKVGNQAQTGTPEQLRELTLQQSRRWEGLI
FT                   RQHGIKAE"
FT   sig_peptide     complement(164871..164942)
FT                   /locus_tag="Veis_0142"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.620 at
FT                   residue 24"
FT   gene            complement(164963..165592)
FT                   /locus_tag="Veis_0143"
FT   CDS_pept        complement(164963..165592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB0769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55935"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE78"
FT                   /protein_id="ABM55935.1"
FT                   /translation="MRMARHRCYVFTYQTVFLPALSANATGVNTMQNARWKQRPAGSHR
FT                   GGFGPDDQLGRMNLRTPEIRRQAFREVQQGLAFCLSLPLHHPGGNALLQHRKEPRFFHE
FT                   KRNYDYRLSNLCACFDDAVSDDAVMLYTQYSTQWDGLGHVGQMFDADGRPEKVYDNGFR
FT                   GGVDVLGPDDATPGPDGAATRFGARAIGIEHLAGAVGSPATPVATV"
FT   gene            165617..166168
FT                   /locus_tag="Veis_0144"
FT   CDS_pept        165617..166168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55936"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE79"
FT                   /protein_id="ABM55936.1"
FT                   /translation="MSRHRSDVVGCAQPSERSARRSAQPIPRVLASDATPRCASMASAD
FT                   RQMIGDATLGWRVDAGKSSEAMAAYPVACPSAGPVIGHRPHARGASRSTMKRRRRCGAR
FT                   PRGASLRRKAVLRTDSCCGAFEHAAQRKYGPGLHAVGDRFGALPPLAAPDGGPVQRAEE
FT                   GLGGAPGRPGGRRVWWSARS"
FT   gene            166215..166496
FT                   /locus_tag="Veis_0145"
FT   CDS_pept        166215..166496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55937"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE80"
FT                   /protein_id="ABM55937.1"
FT                   /translation="MSRHRSDVVGCAQPSERSARRIAQPIPSVLASDATPRCASMASAD
FT                   RQMIGDATLGMAQLLQPGLDDLASGAGSKRYAASSIGHTDTRTNGAAP"
FT   gene            complement(166592..167176)
FT                   /locus_tag="Veis_0146"
FT   CDS_pept        complement(166592..167176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0146"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="TIGRFAM: methionine biosynthesis protein MetW; PFAM:
FT                   Methionine biosynthesis MetW; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: pol:Bpro_4888 methionine
FT                   biosynthesis MetW"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55938"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE81"
FT                   /protein_id="ABM55938.1"
FT                   /translation="MTGKATMQALARLVPPGSRVLDLGCGDGAMLDYLQRERGCSGYGV
FT                   EIADANVLACVQRGVDVMQLNLDEGLAMFGDNSFDVVLQIDTLQHLRNAETMLRETARV
FT                   GRTGVVAFPNFAHWPNRLSVLRGRMPVTRRLPYQWYDTPNIRVGTYKDFEVLATKNSLR
FT                   ILDSFGLQDGQETRWLPNARAGTAVFHFERA"
FT   gene            complement(167173..168300)
FT                   /locus_tag="Veis_0147"
FT   CDS_pept        complement(167173..168300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0147"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="KEGG: rfr:Rfer_0406 homoserine O-acetyltransferase;
FT                   TIGRFAM: homoserine O-acetyltransferase; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55939"
FT                   /db_xref="GOA:A1WE82"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE82"
FT                   /protein_id="ABM55939.1"
FT                   /translation="MSFIATPQTMHFPDALPLQSGASIRDYHLAFETYGQLDAERANAV
FT                   LVCHALNASHHVAGVYAGQDDSKGWWDNMIGPGKPVDTDRFFVIGVNNLGSCFGSTGPM
FT                   HPHPDTGAVYGADFPVVTVEDWVNAQARLLDQLGIGRLAAVLGGSLGGMQALSWTLQYP
FT                   ERVRHAVVVASAPNLTAENIAFNEVARRAIVTDPDFHGGHFYRHGVIPKRGLRIARMIG
FT                   HITYLSDDLMNERFGRQLRQGLELKYSTQDIEFQIESYLRYQSDKFSDYFDANTYLLIT
FT                   RALDYFDPARSHGGNLTRALARAQARFLLVSFSTDWRFAPRRSREIVKALLDNRRRVSY
FT                   AEIDAPHGHDAFLLDDARYTGLMRSYFESITKELR"
FT   gene            complement(168439..169005)
FT                   /locus_tag="Veis_0148"
FT   CDS_pept        complement(168439..169005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0148"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   pol:Bpro_4890 protein of unknown function UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55940"
FT                   /db_xref="GOA:A1WE83"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE83"
FT                   /protein_id="ABM55940.1"
FT                   /translation="MEAFFIATALVALAEMGDKTQLLALVLAARFRKPWPIVLGILVAT
FT                   LVNHGLAGAVGAWVTTFAGPQLLRWLLGASFIAMALWMLIPDKLDAGQADHGLRWGVFG
FT                   TTVMAFFLAEMGDKTQIATVMLAARYDSWLWVVTGSTLGMMLANAPVVWLGERITRKLP
FT                   IRMVQSTAAVIFLVLGLLAILAPAG"
FT   gene            169345..169713
FT                   /locus_tag="Veis_0149"
FT   CDS_pept        169345..169713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0149"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; KEGG:
FT                   rfr:Rfer_4234 RNA-binding region RNP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55941"
FT                   /db_xref="GOA:A1WE84"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE84"
FT                   /protein_id="ABM55941.1"
FT                   /translation="MGNKLYVGNLPYSFRDEDLQQTFSQYGSVGSAKVMMERDTGRSKG
FT                   FGFVEMGSDAQAQAAIQGVHGQNFGGRDLVVNEARPMEPRAPRSGGFGGGAGGGGGGYG
FT                   GGRSSGGGGGYGGGRGSY"
FT   gene            170049..170576
FT                   /locus_tag="Veis_0150"
FT   CDS_pept        170049..170576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0150"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; KEGG:
FT                   pol:Bpro_4894 RNA-binding region RNP-1 (RNA recognition
FT                   motif)"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55942"
FT                   /db_xref="GOA:A1WE85"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE85"
FT                   /protein_id="ABM55942.1"
FT                   /translation="MGNKLYVGNLPYSVRDGDLEQAFGQFGAVASAKVMMERDTGRSKG
FT                   FGFVEMGSDAEAQAAINGMNGQPLGGRSIVVNEARPMEPRPPRSGGGGYGGGGGGGGGG
FT                   YGGGGGGGRSGYGGGREGGGGGGYGGGREGGGYGGGRSEGGFRSPYGSGNRSGGGGGRG
FT                   GGGYGGGNNSGY"
FT   gene            complement(170715..171500)
FT                   /locus_tag="Veis_0151"
FT   CDS_pept        complement(170715..171500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0151"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   pol:Bpro_4895 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55943"
FT                   /db_xref="GOA:A1WE86"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE86"
FT                   /protein_id="ABM55943.1"
FT                   /translation="MNHPLVFITGASSGIGQALALRFHRAGYRLALVARRTAEIEAWAG
FT                   AAGIGAGSHEIYRADVAVAERIIAAGQDCIARQGLPDVVIANAGISVGMDTAERDDIEM
FT                   MARTFATNNIGMAATFQPFVNAMARRRSGTLVGISSVAGIRGLPGHGAYCASKAAVISY
FT                   CESLRGEMRPHGVRVVTLLPGYIDTPLTRPNRYRMPFLMPASDFADRAFRAIGAGLSYQ
FT                   VIPWQMGVVATLLRMAPNALLDRLLAGRPRKRRQTDLLP"
FT   sig_peptide     complement(171438..171500)
FT                   /locus_tag="Veis_0151"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.733) with cleavage site probability 0.679 at
FT                   residue 21"
FT   gene            complement(171563..172180)
FT                   /locus_tag="Veis_0152"
FT   CDS_pept        complement(171563..172180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0152"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   rfr:Rfer_4235 protein of unknown function DUF1239"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55944"
FT                   /db_xref="GOA:A1WE87"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE87"
FT                   /protein_id="ABM55944.1"
FT                   /translation="MHRLQQGWDQLLQYLPVALMGLLALGSWWLVRNAPTPQWPILERQ
FT                   QRHQPDYVMKTFSVKNFDAAGRLQSQVQGRELRHYPDTGMLEIDQAHMRSISPEGQITV
FT                   ATANRALSNADGSQVQLFGNAIVTREPLPAKPGAPARPRLEMRSEFLQAFTSAHAERVR
FT                   SDQPVTLTRGRDRFTADGMEYDHRSQVLQLRGHVRGVLMPGP"
FT   gene            complement(172195..172740)
FT                   /locus_tag="Veis_0153"
FT   CDS_pept        complement(172195..172740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0153"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /note="TIGRFAM: hydrolase, HAD-superfamily, subfamily IIIA;
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI
FT                   family; KEGG: pol:Bpro_4897 phosphatase KdsC"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55945"
FT                   /db_xref="GOA:A1WE88"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE88"
FT                   /protein_id="ABM55945.1"
FT                   /translation="MAPALQIDPALLLRAQGLRVVFFDVDGVLTDGGLYFGASGETLKR
FT                   FNTLDGQGLTLLQKAGITPAVITGRDSAPLRLRLQALGVQHAAFGVADKRPAAEQILTT
FT                   LGLTWSQAAAMGDDWPDLPLLRRSAFACAPANAQIEVRHAAHFVTRACGGDGAARELCD
FT                   LLLVAAGRYAALLADFDA"
FT   gene            complement(172744..173745)
FT                   /locus_tag="Veis_0154"
FT   CDS_pept        complement(172744..173745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0154"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: pol:Bpro_4898 KpsF/GutQ family protein;
FT                   TIGRFAM: KpsF/GutQ family protein; PFAM: CBS domain
FT                   containing protein; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55946"
FT                   /db_xref="GOA:A1WE89"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE89"
FT                   /protein_id="ABM55946.1"
FT                   /translation="MTRACPTLPPFDAQQALRMARATFDIEAAALTGLAARVDGVFAQA
FT                   VQLVLRTRGRMVVMGMGKSGHVGRKIAATLASTGTPAFFVHPAEASHGDLGMVTGDDLV
FT                   LALSNSGESAELTAILPVLRRLGTPLIALTGGLQSTLARHAELVLDCSVQREACPLNLA
FT                   PTASTTAQLAMGDALAVALLDARGFRTEDFARSHPGGALGRKLLTHVSDVMRRGPEIAR
FT                   VPPEASFSALMREMSAKGLGASAIVDAAGQVLGIFTDGDLRRRIEAGAELRSATAAQVM
FT                   QTNPRCIAPDALAVDAAEMMETHAITSVLVIDSAGRLTGVVHIGDLMRAKVI"
FT   gene            173815..175800
FT                   /locus_tag="Veis_0155"
FT   CDS_pept        173815..175800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0155"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   sodium/hydrogen exchanger; KEGG: pol:Bpro_4900 potassium
FT                   efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55947"
FT                   /db_xref="GOA:A1WE90"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE90"
FT                   /protein_id="ABM55947.1"
FT                   /translation="MSSLALTLMYLLAAVLGVVACRSLKLPPMLGYLVAGVLIGPHALA
FT                   LAQNSEGVRHLGEFGVVFLMFAIGLEFSLPKLRAMRRQVFGLGLMQVVATMALVTGVAL
FT                   LLSHWIGGVWDMGWQTALALSGVMTMSSTAIVVKLMVERAELESGHGRWVMGVLLFQDL
FT                   AVVPLLVLIPALGSAPGQLLPALAWALLKAILLVGLLLIGGQRLMRWWLTLVARRKSDE
FT                   LFMLNLLLITLGLAWLTELAGLSLALGAFIAGVLVSETEYRHQVGTDIRPFHDVLLGLF
FT                   FITIGMLLDWHILLERWALVLALLTVSLIFKLAIILALARGMGATAGVALRTGLYLAQA
FT                   GEFGFVLLSLTSSNGLVQAALMNPILAAMVLSMLATPFLIMHSNRIVMRLVASDWLQQS
FT                   LQMTSIARKSINTSGHVLICGYGRCGQNLARMLEHERIPYMALDLDPDRVRQAAAAGDS
FT                   VVYGDATRLQALMAAGLVRASAVAITYADVPAALKVLANARSHAPQVPVVVRTQDDLHL
FT                   DVLQRAGATEVVPETIEGSLMLASHALALVGVPMRRVLRLVQAQRDARYQLLRGYFHGA
FT                   DDDTVNEIDQERLSSINLPAGSTALGKSLGQLALPAIGVRVVSLRRSDGRQGAAVDAAL
FT                   LAEGDTLVLSGHPAALILAQDKLLRG"
FT   sig_peptide     173815..173877
FT                   /locus_tag="Veis_0155"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.820 at
FT                   residue 21"
FT   gene            complement(175944..178190)
FT                   /locus_tag="Veis_0156"
FT   CDS_pept        complement(175944..178190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0156"
FT                   /product="thiol-disulfide interchange protein DsbD-like
FT                   protein"
FT                   /note="KEGG: pol:Bpro_4257 thiol-disulfide interchange
FT                   protein DsbD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55948"
FT                   /db_xref="GOA:A1WE91"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE91"
FT                   /protein_id="ABM55948.1"
FT                   /translation="MHQRRFHRLAAALVLALCLASASWTGASAQSGLGFGAAAGSSVVA
FT                   TPHLRAELLAHAPQGVTAGQPLWLGLAIDHQPGWHTYWKNPGDSGLPIQLDWTLQAGLE
FT                   AGEIAWPLPRKIPIGTLLNYGYEGTMLLPVPVTVASTFAPGPLAQDIRIDLHASWLVCR
FT                   ETCLPEEGRFTLQLPIRSSTALNGAAFEAAWQARPRPLADGAQGQAQPDGQHLQISVPG
FT                   LPAALRGKTLDLFPETPQVIASASPWTQAWNGDLWTARIPVSPERSSSPATLPVVLVEQ
FT                   SAERAVGQGAERPGYRAELQVPGPWPPVAAVAGVSPALQSALEANAAQAAGTAVSGAPA
FT                   PALLAALLGALLGGLILNLMPCVFPILAIKLVGFTRHGAGHGAGSAQRARHALRANGLA
FT                   YTAGVLLSFIALGALMLGLRAAGQAIGWGFQLQSPAVVAALAALFTLIALNLAGAFEFG
FT                   HLLPSSLAGLHLRHPVADSFLTGVLAVAVASPCTAPFMGAALGLAAQLPAPWALAVFAA
FT                   LGLGLALPCLVASWVPAVARALPRPGAWMDIARRLLAFPMFATVVWLVWVLGQQSGIDG
FT                   AGALLILLVGLGLVVWAMSLTGRARRWMATGSIAVMALLLWAFAPQVIRLAPATPSADA
FT                   STRWQAWAPGAAEQIVASGRPVFVDFTAAWCVTCQYNKQTTLANAEVLADLARKNVALL
FT                   RADWTRRDPAITAALTALGRNGVPVYVLYRPGHPPVLLPEVLSVAQLRAAIAGL"
FT   sig_peptide     complement(178101..178190)
FT                   /locus_tag="Veis_0156"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.787 at
FT                   residue 30"
FT   gene            complement(178260..179162)
FT                   /locus_tag="Veis_0157"
FT   CDS_pept        complement(178260..179162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0157"
FT                   /product="phosphoesterase, DHHA1"
FT                   /note="KEGG: rfr:Rfer_1390 phosphoesterase, DHHA1"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55949"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE92"
FT                   /protein_id="ABM55949.1"
FT                   /translation="MLPLQLQVAPDKNDPAPLILYHGRNCPDGFGAALAAWLYYGDSAQ
FT                   YLGLDHGQIHTVDDLPPVQGRAVYILDFSFAPAVLRAIDERAAKLVLLDHHKSAAEKLT
FT                   GFACRCGVLHFDMRKSGARLAWEFFHPHQPLPALFRYVEDRDIWKWEFAESAGFLSALD
FT                   MERQDFARWHELATLAPEELSLFIARGAAMDAKYRKLAADIAEGAQPLVFNGIEGLMVN
FT                   APGMFHSLVGDMLSARCGSFALLWSADASGVKAGLRAQRNFDCIALAESMGGGGHAQAC
FT                   GFRMSVARLPELLTGRFDA"
FT   gene            180072..180977
FT                   /locus_tag="Veis_0158"
FT   CDS_pept        180072..180977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0158"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: xcb:XC_3702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55950"
FT                   /db_xref="GOA:A1WE93"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE93"
FT                   /protein_id="ABM55950.1"
FT                   /translation="MSETPSPALSQPASGNLRGIVAMLAAMFFFSLMDAMLKALSASYP
FT                   AMQVAALRGWTALPLVALYVLWRGEWHRLLQVRWLLHLLRGGLTVAMLALFAYALRELA
FT                   LAEAYTLFFISPLLITALSTWVLREQVRAAHWAAIALGMVGVLVALRPSQEAFFTLGAL
FT                   AVLASAVCYAVSAIAGRMLTRTDPSSSLVFWTTTMLALGAGLLAWPQWVGVTWTHWPLL
FT                   AGLAVTGFLGQLAITEAFRHGQVSVVAPFEYTAIAWGVGLDCLLWQAVPGYSTLLGAVI
FT                   VIGSGLYLVRQERTQAVLPP"
FT   gene            181158..182345
FT                   /locus_tag="Veis_0159"
FT   CDS_pept        181158..182345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0159"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rfr:Rfer_0288 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55951"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE94"
FT                   /protein_id="ABM55951.1"
FT                   /translation="MQKRRLPGARGIALSIALATGLAALPVFAQDKPFKIGLILPMTGQ
FT                   QATTGRQIEAAAKLYMAQNGDTVAGRKVQLLVRDDTSLPDMTRRLAQELVVNDKVNVLA
FT                   GMGITPSALATAPLATQSKTPLVVMSAATSSITEASPYVVRTSFTLPQVSVPLADWASG
FT                   NGIKKVVTLVSDYGPGIDAEKYFSQRLSANGGQVTEALRVPLRSPDFAPFLQKVRDAKP
FT                   DALFVFVPSGASAAVMKQFLERGLGKAGIRLIATGDVTEDDQLNAMGDGALGVVTSHHY
FT                   SAAHPSPLNKQFVQAFEQANKGLRPNFMAVGGYDGMRVIYEALKTTRGVGDGDALLAAM
FT                   KGQVFESPRGPVSIDAQTRDIVQNVYLRKVERVDGQLYNVEFDVIEGVKDPGKSR"
FT   sig_peptide     181158..181247
FT                   /locus_tag="Veis_0159"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            182317..183252
FT                   /locus_tag="Veis_0160"
FT   CDS_pept        182317..183252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0160"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   pol:Bpro_3383 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55952"
FT                   /db_xref="GOA:A1WE95"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE95"
FT                   /protein_id="ABM55952.1"
FT                   /translation="MSRTPARAVDRCPCPLPAAAMLTLLFDGIAYGMLLFILALGLAVT
FT                   MGLMHFVNLAHGAFAMAGGYITVLLMQRLDVPFLVCLPLAFAGPALLGGVLERTLYRPL
FT                   YRKPHLDQVLFSIGLVFIAVAGADYFAGSTQQIMQLPEWLKGRTEWGSGAFMLGMGHYR
FT                   LFIIALCAALTVGLQYLLARTRWGSRLRAAVDDQRVAAGLGIDVNLVFLSTFAIGSGLA
FT                   GLGGALGAEMLGLDPSFPLKFMIHFLIVVAVGGTSSITGPLLAALLLGIADVAGKYYIP
FT                   KLGAFIVYSLMIVILLWRPQGLFVRQGGRK"
FT   gene            183346..184308
FT                   /locus_tag="Veis_0161"
FT   CDS_pept        183346..184308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0161"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rfr:Rfer_0290 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55953"
FT                   /db_xref="GOA:A1WE96"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE96"
FT                   /protein_id="ABM55953.1"
FT                   /translation="MEPRTPLSRERRWRWWEPVFWLLALAAPLVLPGQALIINTMAITA
FT                   LFALSLDLILGYAGIVSLGHAAFFGLGGYAAALFAKHVMPDPLVGLVVGMGAATLLGAV
FT                   ASLTILRGTDLTRLMVTLGVGLVLLELANRFDALTGGADGLQGVVLGPVLGRFEFDLSG
FT                   RTAAWYSLSLLLLFFLLARRIVQSPFGATLKAIRDNRLRAMAIGIPVTLRLAQVYTLAA
FT                   ALAGAAGALHTQTTGFASLDLFEFHRSADVLLILVIGGVGWLYGGILGAAGLMLLQDRI
FT                   SSVTPQYWMFWIGLFLVLLVLIGRDRLLRPWTWFEGRNA"
FT   gene            184305..185090
FT                   /locus_tag="Veis_0162"
FT   CDS_pept        184305..185090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0162"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rfr:Rfer_0291 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55954"
FT                   /db_xref="GOA:A1WE97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE97"
FT                   /protein_id="ABM55954.1"
FT                   /translation="MTQTAAQPPTVLATRGLGKRFGGISATCDVTLELKKGARHALIGP
FT                   NGAGKTTLINLLTGVLAPSEGTIVLDGQDITRLAPHQRVRRGMVRTFQINQLFDSLTPQ
FT                   ETLALAVAQQQGLGGQWWRPLGARRAVMQRCEQLLEQFQLTSVMAQETRVLAYGKRRLL
FT                   EIALALACAPRVLLLDEPVAGVPAGEREELLQTVAALPADVSVLLIEHDMDLVFRFASR
FT                   MTVLVNGAVLTEGDPDSIARDPRVQAVYLGAAEQESAHA"
FT   gene            185083..185850
FT                   /locus_tag="Veis_0163"
FT   CDS_pept        185083..185850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0163"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rfr:Rfer_0292 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55955"
FT                   /db_xref="GOA:A1WE98"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE98"
FT                   /protein_id="ABM55955.1"
FT                   /translation="MPELLRIEGLSAGYGQAVVLQDIALTLPEGQTLALLGRNGAGKTT
FT                   LIDTLAGATRQHAGTIHLGGVALHPLPAHQRAAAGIGWVPQERNIFASLTVHENLTAVA
FT                   RPARASAGTGEAAGTDAIAPARPRPWTPERVYDMFPRLAERKTHLGTQLSGGEQQMLAV
FT                   GRALVLNPRLLLLDEPLEGLAPIIVQELLRAIRRITREEGLSAIIVEQHPQAILAISDH
FT                   AAVLDRGRIVHTGSAATLRQQPGLLDGWLGVTR"
FT   gene            185856..186854
FT                   /locus_tag="Veis_0164"
FT   CDS_pept        185856..186854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0164"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_4316 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55956"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE99"
FT                   /protein_id="ABM55956.1"
FT                   /translation="MAIDRRTLVTLLATSCAGAAGVGAGAAVQAQTAWPTRPIRIVVPH
FT                   AAGGAADITVRTVGQKMAERLGHSVVIDNRPGAGGIVAGELVARAAPDGHTLLLISSGT
FT                   AVSAALFKQLPFDTLRDFAPVSLLARFDLAVAVRAGGRMTTLAELLAYARANPGQLDIG
FT                   TPQIGSTQHLAAELFKVTAGIDAQIVPFNGTPALIAAVRGGQVQVLVDILGALMPHIGA
FT                   GALQALAVLGARRATQLPQVPTVRESGGRLEHFNVSSWNGLAAPAGTPAALLERLSRTV
FT                   QAALARPDVKNRLLELNLDAQGSTPAQLGEHLAADMRRWSEVIAQAGIARQ"
FT   sig_peptide     185856..185948
FT                   /locus_tag="Veis_0164"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.720 at
FT                   residue 31"
FT   gene            complement(187003..187923)
FT                   /locus_tag="Veis_0165"
FT   CDS_pept        complement(187003..187923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0165"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_4318 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55957"
FT                   /db_xref="GOA:A1WEA0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEA0"
FT                   /protein_id="ABM55957.1"
FT                   /translation="MDLRQIEYFVRVAELGSFTRASVVLGIAQPALSRQVRLLEVELRQ
FT                   SLLLRNGRGATPTEAGQLLLKHGRSILHQVARAREELGRVRGALAGRVAIGLPPSIAKV
FT                   LTVPLTRAFRAQLPDAALAISEGLSVAMQELLTTGLLDIALLYNTASGPGMETTALLEE
FT                   DLFLVQRRSPGQPDAEALAQAPLPLDELSRFPLVIPTRPNALRMLVESELAARGQRPQI
FT                   SLEIDGVAAILDLVADGAGCAVLPMNAVSTCGKPDAFDARPIDGASQTRLRSKLFMAVS
FT                   SQRPATLTQQAMAQLIRSTLQTLYR"
FT   gene            188251..189063
FT                   /locus_tag="Veis_0166"
FT   CDS_pept        188251..189063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55958"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEA1"
FT                   /protein_id="ABM55958.1"
FT                   /translation="MRNCASNGQRSLRDYPGWDAIFAIRGLRRAGPAAAGHRFLVPALD
FT                   SARAVPGARAKDAATAMIEPPACATDRRLRHGLGASASGAVARRHPGTTPPGWPPAVPA
FT                   SQPQRRASAGTSVLRGLHRGIRQPTCGKSCPWSDSMERISHHNPRHAHSGAHQHPSCRS
FT                   RCASIPALCATPCARPIRDRRARHAVGRPLPTPWCHGLQSVRAVATVRASSDRCSAAAA
FT                   FMFASVPAIIGDMHRTVADCQYRRHRQPPSTGNLLAPRRRQIVCGGRR"
FT   gene            189060..189752
FT                   /locus_tag="Veis_0167"
FT   CDS_pept        189060..189752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0167"
FT                   /product="putative ABC transporter, periplasmic molybdate
FT                   binding protein"
FT                   /note="KEGG: rfr:Rfer_0340 putative ABC transporter,
FT                   periplasmic molybdate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55959"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEA2"
FT                   /protein_id="ABM55959.1"
FT                   /translation="MTRLGLRCIASMATRQLLVELLPGFTQRSGHGASVESVAGVDAAR
FT                   RVQDGEVFDLVLLASDAIDKLMAAGRLLPGSKVDWVCSGMAVAVRAGAPLPDIHSEEAL
FT                   RQTVLAADRIGHSTGPSGVALVRLFRRWGIADALHERMVQAPPGVPVGALIAAGAAELG
FT                   FQQHSELLHVPGIHIVGPLPPALQINTTFSAAVGAQSLQVDAARALLAYLASPLAQDAK
FT                   RRQGMEPA"
FT   gene            189797..190834
FT                   /locus_tag="Veis_0168"
FT   CDS_pept        189797..190834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0168"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: pol:Bpro_4320
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55960"
FT                   /db_xref="GOA:A1WEA3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEA3"
FT                   /protein_id="ABM55960.1"
FT                   /translation="MSLIIDCHGHYTTAPKALEDWRNAQIAGIRNPAAMPAVADLKISD
FT                   DELRASIAGNQLRLMQERGSDITLFSPRASFMAHHIGDFEVSSRWAAICNALCHRVCTL
FT                   FPEHFVPVAMLPQSPGVAPASCIAELEKCVHEYGAVGINLNPDPSGGHWSSPPLTDRHW
FT                   YPLYEKMVQYDLPAMIHVSTSCNPCFHTTGAHYLNADTTAFMQCLQGDLFKDFPTLKFL
FT                   IPHGGGAVPYHWGRFRGLAQEMKKPLLEEHLLDNIFFDTCVYHQPGIDLLHRVIPVRNV
FT                   LFASEMIGAVRGIDPQTGHCYDDTRRYIEACGTLSAQDRQQIYEGNARRVFPRLDARLK
FT                   AREMA"
FT   gene            190985..191902
FT                   /locus_tag="Veis_0169"
FT   CDS_pept        190985..191902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0169"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: rpe:RPE_0749
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55961"
FT                   /db_xref="GOA:A1WEA4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEA4"
FT                   /protein_id="ABM55961.1"
FT                   /translation="MSAFSKTPGWLDWHPNPGKPHWQLPAGAVDAHCHVFGPGAEFPYA
FT                   PERKYTPCDAGKAQLYALREHLGFARNVVVQATCHGSDNRALVDALRHSGGRARGVASV
FT                   ERSVSDEQLQALHDAGVRGVRFNFVKRLVDVTPRDELMEIAARIAKLGWHVVIYFEAAD
FT                   LPGLWDFFAALPTTVVVDHMGRPDVSQPVDGPDFGLFLELMHQHPHVWSKVSCPERLSL
FT                   TGPPALNGERNAYADVLPFARRVVQAFPERVLWGSDWPHPNLRDHMPDDGLLVDYIAQI
FT                   AQTPALRQQLLVDNPMRLYWPEEC"
FT   gene            191965..193296
FT                   /locus_tag="Veis_0170"
FT   CDS_pept        191965..193296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0170"
FT                   /product="Protocatechuate 4,5-dioxygenase"
FT                   /EC_number="1.13.11.8"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase, class III
FT                   enzyme, subunit B; Extradiol ring-cleavage dioxygenase
FT                   LigAB, LigA subunit; KEGG: art:Arth_4373 protocatechuate
FT                   4,5-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55962"
FT                   /db_xref="GOA:A1WEA5"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011986"
FT                   /db_xref="InterPro:IPR014159"
FT                   /db_xref="InterPro:IPR034937"
FT                   /db_xref="InterPro:IPR036622"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEA5"
FT                   /protein_id="ABM55962.1"
FT                   /translation="MSLDKPYLDVPGTIIFDAEQSRKGYWLNQFCMSLMQADNRARFKA
FT                   DERAYLDRWALTEAQKQAVLARDLNQCLRLGGNIYFLAKIGATDGKSFQQMAGSMTGLS
FT                   EEQYRDMMISGGRPANGLRVPGENGATRTQPAPPAQPTGARPAKARISAAVFSSHVPAI
FT                   GAAIDQGKTQQDYWKPLFAGYDLSRQWLREHRPDVILLVYNDHATAFSLEMIPTFAIGT
FT                   AAQFQPADEGWGPRPVPPVIGHPELAAHIAQSVIQQDFDLTIVNKMDVDHGLTVPLSLM
FT                   CGQPLAWPCPVIPFAVNVVQYPVPSGRRCYQLGQAIRRAIESYDADLNVQIWGTGGMSH
FT                   QLQGPRAGLINKEFDNAFLDQLITDPEAAASIPHIDYVREAGSEGIELVMWLIARGAMS
FT                   DVARGATPDAAADGATGRPPKVVHRFYHVPASNTAVGHLILENP"
FT   gene            193293..194246
FT                   /locus_tag="Veis_0171"
FT   CDS_pept        193293..194246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0171"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   rpa:RPA4703 4-carboxy-2-hydroxymuconate-6-semialdehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55963"
FT                   /db_xref="GOA:A1WEA6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEA6"
FT                   /protein_id="ABM55963.1"
FT                   /translation="MTPTIKVALAGAGAFGIKHLDGIKNIDGVQVAALIGRELDKTCAI
FT                   AARYGIAHAGIDLAEALARPDIDAVILCTPTPLHAEQTMACLRAGKHVQVEIPLADSLQ
FT                   DAQAVLALQRQTALVAMCGHTRRFNPSHQYLHQRIRKGEFNIQQMDVQTYFFRRSNTNA
FT                   LGQARSWTDHLLWHHAAHTVDLFAYQTNSPIVQANAIQGPIHPELGIALDMSIQLKAAN
FT                   GAICTLSLSFNNDGPLGTWFRYIGDSATYIARYDDLFTGNEERIDVSTVDVSMNGIELQ
FT                   DREFFAAIRERREPNASVGRVLACYQVLHQLAQQLQ"
FT   gene            194313..195440
FT                   /locus_tag="Veis_0172"
FT   CDS_pept        194313..195440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0172"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   ppu:PP_3360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55964"
FT                   /db_xref="GOA:A1WEA7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEA7"
FT                   /protein_id="ABM55964.1"
FT                   /translation="MQYDAFADWVRQTSFAGLPLWNLMLALAAAVASYVLIGLLLRLLT
FT                   GRAKTWASLTGGAAARTGVDVLEGTSRPLMLVLALLIGASLLDLPGRWENRLDQLWFVA
FT                   MALQMGLWGRRAIDLGVHRYLERHGPANAATGTAQQVGASATLLSWGLRSLLWSVVLLA
FT                   ILSNVGVNITAFIASLGVGGIAVALAVQNILGDLFASLAIAVDKPFEVGDFITVGSISG
FT                   TVQVIGLKTTRIRSLQGEQIVVSNTDLLKQTISNFRLLETRRIVFGFGVAYGTTPEQAQ
FT                   AIPGLVRRLIEAQPKLRFDRAHFKAFGASSLDYEVVYFVEDPAYGVYMDLQQSINLGLM
FT                   RELQALGVEFAVPTRTLHIASAPAQGPGSELLAAR"
FT   gene            complement(195485..196111)
FT                   /locus_tag="Veis_0173"
FT   CDS_pept        complement(195485..196111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0173"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   mes:Meso_4561 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55965"
FT                   /db_xref="GOA:A1WEA8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEA8"
FT                   /protein_id="ABM55965.1"
FT                   /translation="MQAVIEAIEMDVIRGRILPRNRLIEDHLMEDYAAKRHVVRAALAQ
FT                   LQRLGVVVKPPHLGAHIRRFDAQSLRDLYHLRAVLHRAAVASMPLPVAPDRLMQVRHAA
FT                   QAHAMAAATGDLVAIHRSNMLFHRLFYGLCDNAYLAESIRLHDWLSFPARAYAIAEPQA
FT                   LEQACAEHAAMVAALAAGDQGQLERLAVAHMGRARAIYEQRYLRA"
FT   gene            196313..196630
FT                   /locus_tag="Veis_0174"
FT   CDS_pept        196313..196630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3685 betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55966"
FT                   /db_xref="GOA:A1WEA9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEA9"
FT                   /protein_id="ABM55966.1"
FT                   /translation="MFRGLASWTSHPGNHQAGTMATRQAASELISIDPANGAEIARVRI
FT                   TSAQELDAVVARAWNAFRHSGWKSLLPHQRALVLHAIADGLAAEKQALARLRCCSTPAS
FT                   R"
FT   gene            196627..196905
FT                   /locus_tag="Veis_0175"
FT   CDS_pept        196627..196905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0175"
FT                   /product="uracil-DNA glycosylase"
FT                   /note="KEGG: bbr:BB0210 uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55967"
FT                   /db_xref="GOA:A1WEB0"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEB0"
FT                   /protein_id="ABM55967.1"
FT                   /translation="MKEGQAASHAGKGWEELTDAVIRHVAEGPRPVVFMLWGSHAQSKR
FT                   AFIPQDRGHLVLLSKHPCPLSALRPPVPFIGNGHFGKARAFREQHGY"
FT   gene            196902..197228
FT                   /locus_tag="Veis_0176"
FT   CDS_pept        196902..197228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55968"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEB1"
FT                   /protein_id="ABM55968.1"
FT                   /translation="MTCIAAGCDVQFLEICTSNGVSIMQTKLTLRLEERLITQAKARAQ
FT                   RHGKSLSQLVADYFVQLDEPVAAQRQALEAPLPPVVASLRGALKGVADLDEGAWREHLR
FT                   TKHQ"
FT   gene            197225..197632
FT                   /locus_tag="Veis_0177"
FT   CDS_pept        197225..197632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0177"
FT                   /product="PIN domain protein, putative"
FT                   /note="KEGG: sru:SRU_1578 PIN domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55969"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEB2"
FT                   /protein_id="ABM55969.1"
FT                   /translation="MRAVLFDTNVVLDVLLDREPHVHASAQAMALVERGEVRGFLCATT
FT                   VTTLFYLASRALDARRARGQIEALLRLFDVAPVTRLVLTDALGIGFADYEDAVLHEAAR
FT                   HAGVLCIVTRNVRDFSAATLPVLAPDEFLSG"
FT   gene            complement(197646..198557)
FT                   /locus_tag="Veis_0178"
FT   CDS_pept        complement(197646..198557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0178"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_1817 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55970"
FT                   /db_xref="GOA:A1WEB3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEB3"
FT                   /protein_id="ABM55970.1"
FT                   /translation="MRAHLLQDTTLRYFLEVAHSGSLTEASARLHVAASALSRQIAGLE
FT                   AQLGTPLFERHPRGMVLTAAGEILAIHARRTVLDAERALGEIGALQGLRAGQVRLATSD
FT                   AFANELVPRLCVEFQRTHTGIQFSVISLPTAQVPGAVRSGAADIGLCFSRAPHQDIEVA
FT                   YRQTAPVRALVPPGHPLARARSVSLAQMARHPLALPPPETTVRQMIDIVCSRQGLQMAP
FT                   VLISNHAKTVLNFVAHGGGLSVASEIAARHLVAAGAIVALPISDPGMDLRDLEVQTLAG
FT                   RSLPVAVQAFLDLLKERLPERW"
FT   gene            198761..199747
FT                   /locus_tag="Veis_0179"
FT   CDS_pept        198761..199747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0179"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_1818 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55971"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEB4"
FT                   /protein_id="ABM55971.1"
FT                   /translation="MRLISWSRGALGLACLLASASATVHAQAAWPDRPLRVIVPFPASG
FT                   ATDLVARVVTQRVAADLGQQMVVDNKPGAGGTIGTAEAAKAPADGYTLLLTTSSTHAIS
FT                   PHLMPRLAYDPRKDFTPVAHVADAPSVLLVTNSLPVKTVGELVAYGKAHPGKLNYATSG
FT                   NGTIVHLNTAAFSAQAGLEMTHIPYKGTALAIPDLIAGQTHVLFDSLPTGMPHAKAGRL
FT                   RALAVTSEKRSTLAPELPTLAESGLPGYSSVTWFGVYLPAGAPPALVARVHQAFAKAVQ
FT                   APEVAASLAKLGVEPAAPSTPAQFGAMVQADSNRWATVIRQHKITVE"
FT   sig_peptide     198761..198841
FT                   /locus_tag="Veis_0179"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.828 at
FT                   residue 27"
FT   gene            complement(199734..200120)
FT                   /locus_tag="Veis_0180"
FT   CDS_pept        complement(199734..200120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0180"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   reu:Reut_B3951 regulatory protein GntR, HTH:GntR,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55972"
FT                   /db_xref="GOA:A1WEB5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEB5"
FT                   /protein_id="ABM55972.1"
FT                   /translation="MQAVIEAIEMDVIRGRILPRNRLIEDHLMEDYAAKRHVVRAALAQ
FT                   LQRLGVVVKPPHLGAHIRRFDAQSLRDLYHLRAVLHRAAGASMPLPVAPDRLMQVRHAA
FT                   HHRTAVGGVREIPVEWMWVHVIPL"
FT   gene            200391..201827
FT                   /locus_tag="Veis_0181"
FT   CDS_pept        200391..201827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0181"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: rme:Rmet_4430
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55973"
FT                   /db_xref="GOA:A1WEB6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEB6"
FT                   /protein_id="ABM55973.1"
FT                   /translation="MATRQAASELISIDPANGAEIARVRITSAQELDAVVARAWNAFRH
FT                   SGWKSLLPHQRALVLHAIADGLAAEKQALARLQMQDNGKPWGECRSMVESAIGTFRYYA
FT                   GVCETLQTDVTPVRGDYVSFTVLEPFGVVAAITPWNSPIMNDATKVAPALAAGNAVILK
FT                   PSEDAPLLAPELARIAHAAGLPEHLLQVVQGRGADVGAALVSHHGVRMISFTGGTDSGK
FT                   AIAHAAAERLVPAALELGGKSPHIVFADAHREHAVAAVVAGIFGSAGQSCVAGSRLFIE
FT                   ECVYAEVLAQVVAQARRLRVAPPDAEGVEMGPLASLRHRERVIRFVARARAEGAQVLCG
FT                   GAVPAGAEFTAGAYYLPTVIDGLHPRAATCQEEAFGPVLVAFAFRDEADLIDQANGTAF
FT                   GLACGIWTENFKKAWRIGRALEAGSVWINTYKQSVASTPFGGVKSSGIGREKGIDGLKL
FT                   YTQVKSMYFGLHEQPLGISR"
FT   gene            201934..202815
FT                   /locus_tag="Veis_0182"
FT   CDS_pept        201934..202815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0182"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: rme:Rmet_1835 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55974"
FT                   /db_xref="GOA:A1WEB7"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEB7"
FT                   /protein_id="ABM55974.1"
FT                   /translation="MAIYGLGNMGYPIAERIGRHFPTQVFDLDDTRVEKARALFGAAPM
FT                   GRPQDLADTRVVVLCLPSPASSLSVIEQIAPHLPQGAVVIESSTVNPEHVHAGQKRLAP
FT                   FGVDVVDASILAGVEQMAAGSATLALGGKPDAIARSQGVLDAIASRQIHFGALGAGAAA
FT                   KVINNAVAHAVMVVVAEAGAMATAAGVGCEKLIALLSDPRMGLHRPLTYRYAQRVVKGD
FT                   YTGGMPLDAARKDSTLALQLAQTLGVPLFAIQGAHSVYDIAAAAGHGRQDYAVIAKLWA
FT                   GWGCPTVPGPGP"
FT   gene            202861..203862
FT                   /locus_tag="Veis_0183"
FT   CDS_pept        202861..203862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0183"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   reh:H16_B1820 probable extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55975"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEB8"
FT                   /protein_id="ABM55975.1"
FT                   /translation="MSDLASDWACPLSAGTRRRAACALGAWAFGAWATGNAWAAWPDKP
FT                   MELVVGFAAGGGTDTTARTLALHLSRRLGVPVVVSNKPGASGELGLAHVAKSAPDGYLI
FT                   GMSNMPGLVTLPMERRTRFKAGDFAYIANIVRDPSAFSVLGNSPYRSIDDLIADAKARP
FT                   GQISYGSTGTGTDDHLALVLFERLTGAQFTHVPYNGAGPLRTAVLGGHVLVGGMNLGEV
FT                   MPYRDKLRVLAQASPGRSRLAPDVPSFNEQHVDLVFNSERGIVAPAGLPADARQRLTDA
FT                   LRSVAADPLFQQQMQAQFTEMDYLEGAAWQARLEKAAAEFGALWKSAPWTDS"
FT   sig_peptide     202861..202980
FT                   /locus_tag="Veis_0183"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.978 at
FT                   residue 40"
FT   gene            complement(203880..205184)
FT                   /locus_tag="Veis_0184"
FT   CDS_pept        complement(203880..205184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0184"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pol:Bpro_1437 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55976"
FT                   /db_xref="GOA:A1WEB9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEB9"
FT                   /protein_id="ABM55976.1"
FT                   /translation="MPNPTQEFFPLAPSLWAATAVPAPATTPLDSNAQADVIVIGAGYC
FT                   GLSTALHLAERGVRVLLLEARQVGFGASGRNGGQVIAGLKHDPGELLRMFGAEPGQRLI
FT                   DFANGTADAVFGLIDKHGMDVPRVRQGWIQGAHTPAAVQLAERRARDWQAQGVAARPLD
FT                   RNETARLLGTDKYFGGWLDPRGGGVQPLSYARELARAAQAAGAVIHTDTPVTQLARANG
FT                   KWQAWTSRGLRVTAERVVLCTNGYTGDLWPGLRKTIIDANSFQVATEPLPDAVRKTILP
FT                   EGHVSSDARNLLLYYRLDHMGRLLMGGRGSFREPDAGQPGDWSHLEHIVAKLFPQAAGA
FT                   PIAYRWCGHVAITRDYLPHLHEPAPGLLIDIGCQGRGVGLQTRMGQALAQYLGTGDAKA
FT                   LPVPLSDLRPFPLHGLRRIYVSAVIGWYRMTDGGV"
FT   gene            complement(205194..205925)
FT                   /locus_tag="Veis_0185"
FT   CDS_pept        complement(205194..205925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0185"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: SMC domain protein; ABC transporter related;
FT                   SMART: AAA ATPase; KEGG: pol:Bpro_1438 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55977"
FT                   /db_xref="GOA:A1WEC0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEC0"
FT                   /protein_id="ABM55977.1"
FT                   /translation="MIEIRRLQKAFGKHQVLKGIDASIAQGEVVCIIGPSGSGKSTILR
FT                   CINGLESYSGGSVDIDGRRVDRQHASIKAIRAEVAMVFQRFNLFPHRTVLENVIEGPVY
FT                   VKGEDRASASARAKELLASVGLADKAAAHPPDLSGGQQQRVAIARALAMRPKAILFDEP
FT                   TSALDPELVGDVLQVMRKLAGTGMTMVVVTHEMQFAREVADRVIFIDGGVIVEQGRAAE
FT                   LLNHPQNPRTQDFLRRVLHPL"
FT   gene            complement(205922..206572)
FT                   /locus_tag="Veis_0186"
FT   CDS_pept        complement(205922..206572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0186"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pol:Bpro_1439 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55978"
FT                   /db_xref="GOA:A1WEC1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEC1"
FT                   /protein_id="ABM55978.1"
FT                   /translation="MSAFLRNVLEFLPILLQGAKLTVLVTLGSLLISTLLGLVWAAMRV
FT                   SGIGLLAKVSASVVNLLRGIPIIVLLFFIYFVMPDFGVSLTALQAGILGLGIAYSAYQA
FT                   ENFRAGIEAVDQGQVEAAQAMGMSWWLTMRRVLLPQAFRITLPSYGNIMIMMLKDSSQA
FT                   STITVTELALQGKLIATSTFQNATVFSLVALLYLIMCVPLILLVRHFEKRGKK"
FT   gene            complement(206638..207399)
FT                   /locus_tag="Veis_0187"
FT   CDS_pept        complement(206638..207399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0187"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; SMART: ionotropic glutamate receptor; KEGG:
FT                   pol:Bpro_1440 extracellular solute-binding protein, family
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55979"
FT                   /db_xref="GOA:A1WEC2"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEC2"
FT                   /protein_id="ABM55979.1"
FT                   /translation="MKPASRLAALLLATLTMACGGQASAQAVLKVGSTPTGNPFTFLDT
FT                   KTNTIDGLMADIVKAVGKTSGFAVQIEPMQFSALIGSLTSGRIDLISAAMFITPVRQQV
FT                   VDFSQPIYSYGEGIVVPVKDGTAYRSFSEFKGKRMGVQVGTAFVEPLHKLGIFSEVKLY
FT                   DTTADLMRDANAGRIDAGVLDYPIAAYAISRNLFPNLRMATTYQPTMVNDIGIATRKGD
FT                   TETMAKVNAALTKLKADGSIDAILKKWGLNH"
FT   sig_peptide     complement(207322..207399)
FT                   /locus_tag="Veis_0187"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 26"
FT   gene            complement(207500..208189)
FT                   /locus_tag="Veis_0188"
FT   CDS_pept        complement(207500..208189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0188"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2,
FT                   conserved barrel domain protein; KEGG: pol:Bpro_1441
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55980"
FT                   /db_xref="GOA:A1WEC3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEC3"
FT                   /protein_id="ABM55980.1"
FT                   /translation="MVAGGIVCETRSSCESFTKHSVPPLPTRPPPAPGVRRIHSIIDLW
FT                   LGEQLRRRRQALGLPLQQVARACGISVSLLSQLERGLRSISMRTLGALAQELRLPIETL
FT                   VRNTRYSEGEAEGAVARAGTHRRIDLGDKGIHKENLTPPAASGGVQMYRAVIDPGGSTG
FT                   DDLFLTHKGEQVGYVIEGQLDLFVQERLLKLKAGDSFCYGGDMSRRWRNPGQTSTTILW
FT                   AITCSPG"
FT   gene            complement(208534..208896)
FT                   /locus_tag="Veis_0189"
FT   CDS_pept        complement(208534..208896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_3547 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55981"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEC4"
FT                   /protein_id="ABM55981.1"
FT                   /translation="MISASFIFNQREYDDEYFALDGRIAEIAKATQGYIGEEAWQNLEN
FT                   GKVCTVYYWEGREGLRELMASAEHLRAKSQSAQWLAGYQVVVSEVIATYGTKDYDHLLN
FT                   KRPFDLGGWKGPPASP"
FT   gene            complement(208906..209151)
FT                   /locus_tag="Veis_0190"
FT   CDS_pept        complement(208906..209151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55982"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEC5"
FT                   /protein_id="ABM55982.1"
FT                   /translation="MAPKHTVAAGIAHGQRRRKPVALRAAAGLSSFDSGPDFAPDLATK
FT                   PGALSYTLHFLNAGERVHSGNTPVTQFPPHWVPATA"
FT   gene            complement(209263..210264)
FT                   /locus_tag="Veis_0191"
FT   CDS_pept        complement(209263..210264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0191"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: pol:Bpro_4826 glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55983"
FT                   /db_xref="GOA:A1WEC6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEC6"
FT                   /protein_id="ABM55983.1"
FT                   /translation="MTIKIGINGFGRIGRNVLRSAIENFSDLTVVAVNDLLEPDYLAYM
FT                   LQYDSVHGRFRGTVSVEGSHLIVNGNKIRLTQERDPAQLRWSEVGAEVVIESTGLFLDQ
FT                   ASARKHLDAGAKKVVLSAPSKDDTPMFVFGVNHDSYAGQAIISNASCTTNCLAPVAKVL
FT                   NDKWGIRRGLMTTVHATTATQKTVDSPSNKDWRGGRGILENIIPSSTGAAKAVGVVIPA
FT                   LNKKLTGMSFRVPTSDVSVVDLTVELSRPASYDDIKAEMKAQSEGALKGVLGYTEDKVV
FT                   ATDLRGDARTSIFDADAGIALDDTFVKVVSWYDNEWGYSNKCLEMVRVVCRG"
FT   gene            complement(210314..212395)
FT                   /locus_tag="Veis_0192"
FT   CDS_pept        complement(210314..212395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0192"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase, central region; KEGG: pol:Bpro_4827
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55984"
FT                   /db_xref="GOA:A1WEC7"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEC7"
FT                   /protein_id="ABM55984.1"
FT                   /translation="MANIQPHPQMANAIRALAMDAVQQANSGHPGAPMGMADMAVALWG
FT                   QHLKHNPADPRWFDRDRFVLSNGHGSMLLYALLHLTGYDLSIDELKNFRQLHSKTAGHP
FT                   EVGLTPGVETTTGPLGQGIANAVGFALAEKLLAAEFNRAGHVVVDHHSYVFLGDGCLME
FT                   GVSHEAVALAGVWKLHKLIALYDDNGISIDGQVTPWFADNTPLRFVACGWNVIGPIDGH
FT                   DADKVASAIAEAKKQTERPTLIVCKTRIGQGSPNRANSAKAHGEPLGAEEVALARAELG
FT                   WTSAPFVVEPDIYAAWDGRAKGQSAQAQWNERFAAYGQAFPALAAEFRRRMQGQLPAHF
FT                   EPLAAGIERAADGKRETVASRRASQLALQAFTAELPELLGGSADLTSSNLTHTTSTPAL
FT                   RFDAQGNVKTDAAAGAEAAAGGKIGRHINYGVREFGMAAIMNGLALHGGYIPYGGTFLT
FT                   FSDYSRNAIRMAALMRQRVIHVFTHDSIGLGEDGPTHQAIEHAASLRLIPHLDVWRPAD
FT                   TVETAVAWRVALSNQDRPTALLLSRQNLPYPHDAPKRDLAGIGHGAYVLSEPADRGLKK
FT                   KPVVVIIATGSEVQLALQAQRLLADRKIPVRVVSMPSTTRFDRQDRKYKKSVLPARLPR
FT                   VAVEMGVTDGWWKYGCAAVVGIDRFGESAPAPVLLGHFGFTADNVAATVQAVLKRKRK"
FT   gene            212686..213051
FT                   /locus_tag="Veis_0193"
FT   CDS_pept        212686..213051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_0026 S-adenosylmethionine
FT                   decarboxylase related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55985"
FT                   /db_xref="GOA:A1WEC8"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEC8"
FT                   /protein_id="ABM55985.1"
FT                   /translation="MTATVLLVSRHRSSVGLRWPSKRIAALHRLPIRSVLAARCALRCA
FT                   PMAARSLRHLIGDATLAQSHLCAHTWPEQRAVTLDVHVCNFGADHSGKAQPLREALPAL
FT                   FGPSTVLRHALQRGALP"
FT   gene            213189..213932
FT                   /locus_tag="Veis_0194"
FT   CDS_pept        213189..213932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0194"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: rfr:Rfer_0085
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55986"
FT                   /db_xref="GOA:A1WEC9"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEC9"
FT                   /protein_id="ABM55986.1"
FT                   /translation="MPAMLLAAGRGERMRPLTDTTPKPLLTVQGQPLLHWQLQALQAAG
FT                   VGQVVINTAWLGAQISAHFSNVFTHRGLTHPHRPLLISYSHEAVDFGAALGTAGGIARA
FT                   LPQLGPVFWLAAGDVFTPDFVFDPAAVQSFATSGQLAHLWLVPNPAHHPRGDFGLSAQG
FT                   LALNLPAQDPAPRYTYSSIALLRAALFAPPWCAIAAGNPGGVNAALAPLLRRAMDQHRV
FT                   GASLYTGRWTDVGTPERLALLNERY"
FT   gene            214101..215501
FT                   /locus_tag="Veis_0195"
FT   CDS_pept        214101..215501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0195"
FT                   /product="aminopeptidase P. Metallo peptidase. MEROPS
FT                   family M24B"
FT                   /EC_number="3.4.11.9"
FT                   /note="PFAM: peptidase M24; peptidase M24B, X-Pro
FT                   dipeptidase/aminopeptidase domain protein; KEGG:
FT                   rfr:Rfer_0086 peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55987"
FT                   /db_xref="GOA:A1WED0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A1WED0"
FT                   /protein_id="ABM55987.1"
FT                   /translation="MSSPPAPSSIYAQRRARLAAQLGQGGIAIIPTAPERPRNRDNDFA
FT                   FRHDSYFYYLTGFTEPGAALVLAHDGQSTLFCQPKDPEREIWDGYRLGPAAAPAALGVD
FT                   AAHPITEFDARLPRLLENSRCVWYPFGTHSGLAARLEGWLAAVRARLRYGALCPTMQGD
FT                   LCTLLDEMRLFKDGHEQDLMRRASRISAQAHIRAMQRSARMLRSGQALREYHLEAELLH
FT                   ALRDAGVQSTAYTCIVAAGANACVLHYRADAAPVRNGDLVLIDAGGELDGYASDITRTF
FT                   PANGRFTGPQRALYDLVLASQEAAVAAIRAGARFDDPHDASVAVLAQGLLDLGLLDGNR
FT                   VGRRDDVIASRAYFQFYMHRTSHWLGMDVHDCGSYLEPGEIGQVSQRRDPLTGQTISHR
FT                   PSRVLRPGMVLTVEPGIYVRPAAGVPEQFHHLGIRIEDDAIVTASGCELITRDVPVQAG
FT                   AIEALMRD"
FT   gene            215515..217005
FT                   /locus_tag="Veis_0196"
FT   CDS_pept        215515..217005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0196"
FT                   /product="Pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: pyruvate kinase; KEGG: pol:Bpro_4634 pyruvate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55988"
FT                   /db_xref="GOA:A1WED1"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1WED1"
FT                   /protein_id="ABM55988.1"
FT                   /translation="MQESAPDHHPSIPRKTRPMPTRRATKIVATLGPASSEPALLEAMI
FT                   RAGVNVVRLNFSHGKAQDHIDRAACVRAAAQRAGHEVAIMADLQGPKIRVGKFAEGRVL
FT                   LAPGAPFVLDASRTEPGDIDGVGLDYKELPHDVKGGDLLLLNDGLIVLSVDAVRGEQVH
FT                   TTVKIGGELSNNKGINKKGGGLTASALTAKDMEDIRTAMGFQADYVAVSFPKNATDMEM
FT                   ARQLCTVAASEQRHKPGLIAKIERAEAIPHLQAILRVSDGIMVARGDLAVEVGNAAVPA
FT                   LQKKMIRMARDMDKLVITATQMMESMITNPVPTRAEVSDVANAVLDGTDAVMLSAETAA
FT                   GRYPLETVTEMATICAAAEAAEEHRLDADFTGQTFDRIDQSIAMGALFTAHHLGAKAIV
FT                   AMTDSGATALWMSRHGIHVPIYALTPKVATQRKMAMYRNVLPLLMDTSADRDTALAQAE
FT                   QHLKSRGIVQQGDVYAITCGEPMGAPGGTNMLKICVVA"
FT   gene            complement(217010..217858)
FT                   /locus_tag="Veis_0197"
FT   CDS_pept        complement(217010..217858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0197"
FT                   /product="PAP2 (acid phosphatase) superfamily protein-like
FT                   protein"
FT                   /note="KEGG: pol:Bpro_4633 PAP2 (acid phosphatase)
FT                   superfamily protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55989"
FT                   /db_xref="GOA:A1WED2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A1WED2"
FT                   /protein_id="ABM55989.1"
FT                   /translation="MPSQSLSDAPPSPLRRHAHLCWTLAALAGVLAWDAGGQDLALARV
FT                   FGSAGGFALREQWFLTQVLHEGARRLGYLLLLLLTLGLWWPKGFLRRMAARDRWQMVVS
FT                   CLLALALVSAAKSLSATSCPWDLAQFGGVARHVSHWALGVRDGGGGRCFPAGHAAAGFA
FT                   FLGGYFALRHQLPGVARWWLAGALLAGLVLGGAQQLRGAHFMSHTLWTGWLCWSTGWLC
FT                   DVAAGALRRRSAASAGATTPDGQDRHAAGSADCATPVGRSHADSATGETGATGATTGAA
FT                   G"
FT   gene            complement(217907..218134)
FT                   /locus_tag="Veis_0198"
FT   CDS_pept        complement(217907..218134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA6579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55990"
FT                   /db_xref="UniProtKB/TrEMBL:A1WED3"
FT                   /protein_id="ABM55990.1"
FT                   /translation="MPGKIRPERDGPCARQGAPPPRESLRSGSRAAVDRALSRLSRQGK
FT                   LLRVARGPLRHASAAPARPGAARRSPGRGA"
FT   gene            complement(218148..219041)
FT                   /locus_tag="Veis_0199"
FT   CDS_pept        complement(218148..219041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0199"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bja:blr7198 transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55991"
FT                   /db_xref="GOA:A1WED4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:A1WED4"
FT                   /protein_id="ABM55991.1"
FT                   /translation="MLNPRQIEAFRTVIIMGGVTAAAQALSISQPAVTRLIHDLQYALG
FT                   LKLFVKRGTRLVPTNEALSLFREVERQFVGLERIQAAALSLRERRMGTLRIAALPAFNV
FT                   GFLPRLVSRYLQHKPGLNVTVYGSSSSQVADWVVSGFCELGFVQLPLDFPSLDVEPLPQ
FT                   ATAVAVLPQDHRLAARSVLGPRDFAGESFVSLEQMTQLRYQIDALFASERITREVRIET
FT                   PLSMIACALVAAGAGVSIVDPFTAAEYCGRGVVVRPFHPAILFDIAVIWAAGRCRSALA
FT                   QDFAHQVRAAVIGQGR"
FT   gene            219162..220199
FT                   /locus_tag="Veis_0200"
FT   CDS_pept        219162..220199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0200"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: bja:bll7197 ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55992"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1WED5"
FT                   /protein_id="ABM55992.1"
FT                   /translation="MKSMWFGVLSATAILAGAGSAFAQQKTLYVAGYGGSFEQMMRKEV
FT                   IPDFEKQARLRIEYVAGNSTDTLAKLQAQKGNQQIDAIIVDDGPAYQAVSLGFCGTLRP
FT                   APIYADVAPVMKFKSNQAIGLGMVATGLFYNKKVFAENRWPAPTSWADLNDPKFRKKLV
FT                   IPSINNTYGLHTLVAMAQLGGGSEANVEPGFKMIKEQTNPNVLVYESSAAKMVELFQSG
FT                   QAVLGVWGSGRVKAFADTGFPAEFVYPREGGFVLGIVGCPVEGSKNAVEANAFLQYMLS
FT                   PAVQMTLALRHGAGPANTRVVLTPQQHRGLPYGGQARALKALDWDTANARREEWTRRWN
FT                   REIER"
FT   sig_peptide     219162..219233
FT                   /locus_tag="Veis_0200"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            220269..221321
FT                   /locus_tag="Veis_0201"
FT   CDS_pept        220269..221321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0201"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: bja:bll7196 ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55993"
FT                   /db_xref="GOA:A1WED6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WED6"
FT                   /protein_id="ABM55993.1"
FT                   /translation="MASMSHLVLDGLGKSYGDVTVIAGLDLAVERGEFVSLLGPSGCGK
FT                   TTTLQMIAGFTPVDRGRILLDGSDLATVAPSKRGLGIVFQSYALFPHMTVAQNIAFGLE
FT                   MRGVAKSERDRRTLEAMALVDLDGFVERYPRRMSGGQQQRVALARALVIEPTLLLLDEP
FT                   LSNLDAKLREEMQGELRRIQRSVGTTTILVTHDQHEAMALSDRIVLMNQGRVEQIGTPD
FT                   AIYARPSSAFVAHFLGKTNILQGRGDGCGHVVIGPLSIPVAGAGAGAVALAVRPERLSI
FT                   DAPGARGFPARITGRVFQGAHWLLSADSEAGALWLLRSNDGSSIPADGQTVMLSFAPAD
FT                   AAVLENGAAP"
FT   gene            221318..222184
FT                   /locus_tag="Veis_0202"
FT   CDS_pept        221318..222184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0202"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bja:bll7195 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55994"
FT                   /db_xref="GOA:A1WED7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WED7"
FT                   /protein_id="ABM55994.1"
FT                   /translation="MTGMTKERRAPYWLVAPGLLVFLGLVIIPLGMTALLSFYDWGQYK
FT                   GIVAEFTLKNWIEIATDSYFFEIFLRSFRIALLVTLATMLIGVPQAYILRRMSPGWRSV
FT                   FLFVVIGPLLVSVVARTLGWALLLGSTGVVNQGLIALGLIRAPLEFMFTETGVIIALTH
FT                   VLIPFMILAVWASLQRLDPQIENAAMSLGAGGLTIWRRVILPQIVPGILSGAIIVFALA
FT                   ASAFASPAIIGGRRLKVAATLAYDEFLNTLNWPLGAAVAMFLLVALVAIIVGSNRLIER
FT                   RFAPVFE"
FT   gene            222193..222990
FT                   /locus_tag="Veis_0203"
FT   CDS_pept        222193..222990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0203"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bja:bll7194 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55995"
FT                   /db_xref="GOA:A1WED8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WED8"
FT                   /protein_id="ABM55995.1"
FT                   /translation="MRSNGPLALVFHTLFVVFMLAPLVIVCIVAFTPQGYLSLPTQGLS
FT                   LRWFKAIFAYPEFLRAFYTSLWLAALSSGIVIALAVPAALAIARYRFVGREAITALFMS
FT                   PLMVPHVVLGIAFLRFFTQIGLSGSFTGLVLSHCLIIFPFALRLVLAASYGMDRRIEQA
FT                   AISLGAGALTVFRRVTLPLILPGIVSGWLLAAINSFDEVTMTVFIASPATSTLPVRMFL
FT                   YLQDNIDPLIAAISACLIALTAALLFVFDRLYGLDRLFAGAAK"
FT   gene            222996..224153
FT                   /locus_tag="Veis_0204"
FT   CDS_pept        222996..224153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0204"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bxe:Bxe_B2706 putative FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55996"
FT                   /db_xref="GOA:A1WED9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1WED9"
FT                   /protein_id="ABM55996.1"
FT                   /translation="MTSTAQRKEADIAVIGGGVVGAALALGLARCGAVVTVLDGGDGAL
FT                   CASGGNFALIWVQSKGLGMPEYALWSRRSAQDWHGLAALLQDEAGIDVAHSQPGGFTPC
FT                   LSEAELEKRATAIQRLYRQPGLADFRYEVLDHAETRRRLPDISKHVVGAIYSPLDGHVN
FT                   SLRLWRALRAAGARRGIDYRASHVVGSIRPRDGGFRIGFHSGFHRPGHWGEIDAGRVVL
FT                   AAGLGNARLAPMVGLAAPLQPRKGQIIVTEKTAAFLHHPMASLRQTDEGGIMIGDSQED
FT                   CGFDTGVGQSVIAVMAERAVRTFARLAALHVVRSWSALRVMSPDGFPIYQQSHSHPGAF
FT                   VVTCHSGVTLAANHVLTLAPAIFAGQLPESVARFSARRFDVPPHV"
FT   gene            224134..224460
FT                   /locus_tag="Veis_0205"
FT   CDS_pept        224134..224460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bsl7192 putative sarcosine oxidase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55997"
FT                   /db_xref="GOA:A1WEE0"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEE0"
FT                   /protein_id="ABM55997.1"
FT                   /translation="MFRPMFDTGKGPAAASGARLAFTFDGRPLTGRAGDTVAAALLANG
FT                   VTACRATPVSGAPRAPYCMMGICFECLVVIDGIGNRQGCLEPLRAGMRIATQHGRRQTG
FT                   QVHG"
FT   gene            224457..225923
FT                   /locus_tag="Veis_0206"
FT   CDS_pept        224457..225923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0206"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: glucose-inhibited division protein A; HI0933
FT                   family protein; BFD domain protein [2Fe-2S]-binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bbr:BB0992 probable pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55998"
FT                   /db_xref="GOA:A1WEE1"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEE1"
FT                   /protein_id="ABM55998.1"
FT                   /translation="MKALTAPGQLAQSYDLVVVGAGPAGLSAATTAAQHGLDVLLVDEN
FT                   PAPGGQIYRAITSTPISDRAVLGQDYWRGADIVARFERAPASYAARCTLWSVTPHATRH
FT                   HGQAFEVGLSQGGCARLIDARQLILATGAQERPFPIPGWTLPGVMSAGAAQIALKSAAI
FT                   VPAGRTVVAGCGPLLYLLARQLAAAGAEIVALLDTTPRRYWSRAAAALPDFLRSPYALA
FT                   GLKLLAGLHLNRRLRFVGGVTGLSGAGQDRLAAVTFVRDGRTARIDCDTLLLHQGLIPG
FT                   VNLSNAAGCAHDFSAAGHCWVPRLDDWFTSSVPGIAIAGDGAGIAGAESAALRGEIAAL
FT                   AVAERLGRIDLAARERAATPLRAQLARALRGRRFLDLLYQPAAQFLAPPQDDTIVCRCE
FT                   EVTAGQIRDSAKRLGVTGPNRMKAFLRCGMGPCQGRLCGPTVVELIAQTHGMTPAQVGY
FT                   YRLRPPVKPVTLAELAALPQTEAAIEAVVP"
FT   gene            225920..227086
FT                   /locus_tag="Veis_0207"
FT   CDS_pept        225920..227086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0207"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bja:bll7190 putative sarcosine oxidase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55999"
FT                   /db_xref="GOA:A1WEE2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEE2"
FT                   /protein_id="ABM55999.1"
FT                   /translation="MNAQRRHADVIVIGAGIHGCSSALHCAMRGLSVIVLEKDHAGRHA
FT                   SGVNAGGVRQLARDVAEIALSNAAMALWHRIGELVDDDCGFSSDGQVLVAETEADLADC
FT                   RARVDMLRLRGFDHEELIDARELRRLIPAISGACPGGVVSRRDGAANPLRTTQAFKRKA
FT                   QALGASIREGVHAAKVLRDGALWCVQTDAGKFTAPRLVNAAGAWADRIAAGLGEPVPLT
FT                   VIAPMLMITEPLPAFIAPVVITRRRKLSLKQWANGTVLIGGGHRGWPLRDENRTLLDWQ
FT                   QLATSARTVQDLFPVMRTASILRAWAGIEARMPDDLPVFGPSARHEGVYHQFGFSAHGF
FT                   QLGPGAGAVMAEIIATGRSSVAIDGLGIGRFALARQDAAPDAGQGRSA"
FT   gene            complement(227379..228758)
FT                   /locus_tag="Veis_0208"
FT   CDS_pept        complement(227379..228758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0208"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase; KEGG: rsp:RSP_2155
FT                   histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56000"
FT                   /db_xref="GOA:A1WEE3"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEE3"
FT                   /protein_id="ABM56000.1"
FT                   /translation="MTHRIDHGFKAMKSINLIELSKLSPQQRKSLMLRTESDLSTYANA
FT                   VLPIIEDVRNRGDAALVHYAAQFEGAAIGLDSIRVSPAEFDAAFAMLDPKVVAAIEYGI
FT                   ENIRSFHTAQKPVQYWMKELRPGAFAGERITPIDTVALYVPRGKGSFPSTVMMLCVPAV
FT                   VAQVPTAYILTPAGPDGRVDAATLVAARLAGIETIFKVGGSQAVAAAAFGTSTIPKADK
FT                   ILGPGSPWVMAAKRALVDHLDPGIPAGPSESIVFADASADARLAALDVLIEAEHGPDSS
FT                   AFLVTTSRAIASAAIDWIAHFWNEMSARRVEFSATVLTGPRGGVLLADSVPSAMDFIND
FT                   YAPEHLEILGAEPFGYLHQIRNAGEILLGHATPMSIANFVLGPNAVLPTSFGAKTVSAL
FT                   SVHDFIKRTSIGYVTTKAFPPMAAMGRELAIYEGFDAHALALAPQRFDPPVARTQPMAA
FT                   E"
FT   gene            complement(228822..230204)
FT                   /locus_tag="Veis_0209"
FT   CDS_pept        complement(228822..230204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0209"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase C terminal;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: rfr:Rfer_2013 phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56001"
FT                   /db_xref="GOA:A1WEE4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WEE4"
FT                   /protein_id="ABM56001.1"
FT                   /translation="MTRQHFGTDGIRGTVGQPPITPDFVLRLAHAVGRVLRQTQERPVV
FT                   LIGKDTRISGYMLESALESGFNSAGVDVVLLGPLPTPGVAYLTCAQRASLGVVISASHN
FT                   PYPDNGIKFFSAQGSKLSDAWEQAVETALGEPPAWTNSANLGKARRLNDAAERYIEFCK
FT                   NTFAQDLSLKGLKIVLDAAHGAAYQVGPKVLRELEAEVIAIGCSPDGLNINHEVGATHP
FT                   DTLVRAVHAHHADYGIALDGDADRVLIVDATGRLYNGDELLYLMVADRMGRDEHVPGVV
FT                   GTLMTNRAVELALQARGVEFVRAKVGDRYILEELTRRDWALGGEGSGHLLALDRHTTGD
FT                   GIGSALQVLQACVRSRSTLAQLLAAVTLYPQVLLNVRLPPDQDWTTNRLLADAIQAVEQ
FT                   QLGASGRVLIRASGTEPLLRVMVEARDAQLADSCAQRLANAARAGWQGHTSLKNAPPMG
FT                   AN"
FT   gene            complement(230254..231153)
FT                   /locus_tag="Veis_0210"
FT   CDS_pept        complement(230254..231153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0210"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: pol:Bpro_2851 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase, DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56002"
FT                   /db_xref="GOA:A1WEE5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEE5"
FT                   /protein_id="ABM56002.1"
FT                   /translation="MPCPLPQSLRSQRRGARPLTDGFMIWQTARFSIDLTRPRVMGIVN
FT                   VTPDSFSDGGRHGSTATALQHCEQLLKDGADILDIGGESTRPGSTAVPLEQELARVLPV
FT                   VRAAVSLGAPVSVDTCKPEVMQAVLDVGADIVNDIRALRQPGAAAVVAAHPRCGVCLMH
FT                   MHRDPQTMQLAPMHGDVLSQVRSFLEMAAHDLLALGVANHRIVVDPGIGFGKTPEQNFA
FT                   LLAKQPALLAMGYPLLVGWSRKSSLGAATGLALEQRLVPSVTAAVLAVERGASVVRVHD
FT                   VRETVAALAVWAALQQAG"
FT   gene            complement(231217..233184)
FT                   /locus_tag="Veis_0211"
FT   CDS_pept        complement(231217..233184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0211"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="KEGG: rfr:Rfer_2011 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56003"
FT                   /db_xref="GOA:A1WEE6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEE6"
FT                   /protein_id="ABM56003.1"
FT                   /translation="MAARCPFLCPPQLEFRLNNQWFSKIAVWLVIALVLFTVFKQFDAR
FT                   GAAGAGAIGYSEFLEEVRNDRIRSATIPEGLSGGEIVATTTDGSKIRTNASVLDRGLVG
FT                   DLLNHNVKFDVKPREEGSLLLTLLINWAPILAVVGIWVYFMRQMQGGGKGGAFSFGKSK
FT                   ARMLDENNNQVTFADVAGCDEAKEEVKEVVDFLKDPQKFQKLGGRIPRGLLLVGPPGTG
FT                   KTLLAKSIAGEAKVPFFSISGSDFVEMFVGVGAARVRDMFDNAKKNAPCIIFIDEIDAV
FT                   GRQRGAGLGGGNDEREQTLNQMLVEMDGFETNLGVIVVAATNRPDILDAALLRPGRFDR
FT                   QVYVTLPDIRGREQILNVHMRKIPMGQDVAPGIIARGTPGMSGADLANLCNEAALMAAR
FT                   RNARTVEMQDFERAKDKILMGPERKSMVMPEEERRNTAYHESGHALIGKLLPKCDPVHK
FT                   VTIIPRGRALGVTMSLPAHDRYSYDREYMLNQISMLFGGRIAEEVFMHQMTTGASNDFE
FT                   RATHIARDMVTRYGMTEALGPMVYAENEGEIFLGRSVTKTTNMSEQTMEKVDGEVRRII
FT                   DEQYHQARRLIEDNSDKIHAMVKALLEWETIDAEQLDDIMAGKEPRPPKDWTPRTPPPG
FT                   GDSSSGGTPEVTTNTAPTAA"
FT   gene            complement(233243..233971)
FT                   /locus_tag="Veis_0212"
FT   CDS_pept        complement(233243..233971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0212"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ;
FT                   KEGG: pol:Bpro_2853 ribosomal RNA methyltransferase
FT                   RrmJ/FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56004"
FT                   /db_xref="GOA:A1WEE7"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WEE7"
FT                   /protein_id="ABM56004.1"
FT                   /translation="MKVKTRSKKVNKAWLDQHVNDPYVQRARKEGYRARAAYKLREIDE
FT                   QLGLIRPGYTVVDLGATPGAWSQYLRRRMAAEGAIIALDILPMEPLEGVTCLHGDFRAP
FT                   DVQQRLEQALAGRVVDVVVSDMAPNLSGIACADAARMADLVELAVAFSCRHLKPDGALL
FT                   VKLFHGSGYSDLAALFKQTFLRVVPLKPKASRDKSSETFLLGRGLKKASPNGLDSRSGT
FT                   AAEPAPLVPIGTNSMPANGD"
FT   gene            234004..234480
FT                   /locus_tag="Veis_0213"
FT   CDS_pept        234004..234480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0213"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   rfr:Rfer_2009 protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56005"
FT                   /db_xref="GOA:A1WEE8"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEE8"
FT                   /protein_id="ABM56005.1"
FT                   /translation="MPSIELTPAQCREQRAHAHRLAPVVLIGSDGLTPAVLREIDAALN
FT                   AHGLIKVRVFNDDRAARERMYQQLTADLNAAPVQHIGKLLVLWRPLPVKERVVDEDRGP
FT                   GPRDVRVLKYSKRGGQRPEIKQLRVLGNQRLTPGGRIKRARPLQKSVKKRQANG"
FT   gene            234477..235235
FT                   /locus_tag="Veis_0214"
FT   CDS_pept        234477..235235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: par:Psyc_1205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56006"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEE9"
FT                   /protein_id="ABM56006.1"
FT                   /translation="MSLLAEPASAARARHILCMKWGTKYGPEYVNRLYAMVRRHLRGEF
FT                   GFVCLTDDGAGIRSEVQCLPIPPLALPAGIPERGWNKLLTFSADLHGLQGTALFLDVDV
FT                   VITAGLDEFFTHPGEFLIIHDYKRPWRVTGNSSVYRFELGAHADVLEHFRGHCAQLRAQ
FT                   FRNEQAYLSDFLHRQGKLQYWPAAWCPSFKYHGIPPWPTNYWRPPVLPAGARIVIFHGE
FT                   CNPPDALAGRRNRRWRHIRPAAWVAEHWRE"
FT   gene            complement(235347..236324)
FT                   /locus_tag="Veis_0215"
FT   CDS_pept        complement(235347..236324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0215"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pau:PA14_32700 probable
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56007"
FT                   /db_xref="GOA:A1WEF0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEF0"
FT                   /protein_id="ABM56007.1"
FT                   /translation="MVKSSTSELRQFPSLLRGLRLPQLQLVRMAGAGANFRKMAEALHV
FT                   TQPAITKMARELERTLGAPLFEREATGVRLSRFGLAVLSQVQRSLAHLEQLVDDLPSHR
FT                   EGSGAALRIGSPSFTAAALLARPVAQWLGCTPAGRVIMSDGVSAQLLSMLHAGELDVVI
FT                   GSLDDGSCSDDELQQLRFESLYEDAITFVTGADTPGLEGPLDLADLCRLPWVLPPRNSL
FT                   VWMTLRRELTLHGHGLPHGVVEASSIPAIGTILHHAAGTVGALRADAGRYLIHHHGLRM
FT                   LEVVPSMSLPRVGIMRLRSAPPEASLDALLAMVRTEVLRMFRSH"
FT   gene            236508..237170
FT                   /locus_tag="Veis_0216"
FT   CDS_pept        236508..237170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4383 putative porin precursor
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56008"
FT                   /db_xref="GOA:A1WEF1"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEF1"
FT                   /protein_id="ABM56008.1"
FT                   /translation="MHQPLAFMPALPVSRHRSDVVGCAQPSERSARRIAQPIPSVLASD
FT                   ATPRCASMASADRQMIGDATLACACAAQAQSSVTVFGALDAALTHSKGSVASGTTLSNN
FT                   NWAASKLGFRGVEDLGGGLEAGFWIEGAILPDSGAGDATNTNNPPGGQGSVGGLTFGRR
FT                   STVSLFGPWGELRAGRDLQPHYLNIGLFDPFAHIGIGQARLPTSTVAGVAIGIEHTF"
FT   gene            237228..238391
FT                   /locus_tag="Veis_0217"
FT   CDS_pept        237228..238391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0217"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   reu:Reut_B4419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56009"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEF2"
FT                   /protein_id="ABM56009.1"
FT                   /translation="MPDRRRFQLQLMALAAAGTGLSRAAQAQAGDFPSRPVRLIVPFAA
FT                   GGGPDLLARAMAVRLAPALGTGAVVFVENIVGAGGIVAAQNVARMAPDGYNLLMGASSH
FT                   MVQKAMQPSVKFDPQKDFAPISRIGLAPSILVVAADAPYRSVADLIAAARKNPGTLNYA
FT                   SGGVGSAAHLCGAALAVHSQVDVVHVPYKGSVEIVPAILAGAVHFAFPIASTAAAHVQS
FT                   GKVRALAVTGAKRLAAFPLVSRHGSDVVGCAQPSERSARRIAQPIPSVLASDATPRCAS
FT                   MASADRQMIGDATLVPTLLELLGASDLVLDAWFGLWAPAGTPVAIVQTVFKALHRAFED
FT                   PALRKEIEDTGTVVGLSASPQEFTGFMQAEAAKFERLVKAAQAGMQR"
FT   sig_peptide     237228..237311
FT                   /locus_tag="Veis_0217"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.796 at
FT                   residue 28"
FT   gene            238388..239488
FT                   /locus_tag="Veis_0218"
FT   CDS_pept        238388..239488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0218"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: reh:H16_A2865 predicted acyl-CoA
FT                   transferase/carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56010"
FT                   /db_xref="GOA:A1WEF3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEF3"
FT                   /protein_id="ABM56010.1"
FT                   /translation="MSAAAWQAPPQALRGVRVLDFSHVIAGPFATFQLARMGAEVIKVE
FT                   RPGGGDVMRRSGSGAHAFTALNAGKQARAIDLATPPGRAEALDLARQADLMVDNYRPGV
FT                   LERHGLGYEQVKAINPRIVYCAISGYGRSDPALAARGAYDHVVQGLTGMAMLAGQECDP
FT                   PIKVGFPVIDAATGLVGALAMMAALRERDQTGHGSFLDVSMWASALQLMYPFACDVLST
FT                   GQEIARVGNKGFSGSPAADMFACRDGWLALGANTPQHIAALMQVLGVDPQRYAPLLDAG
FT                   SGKGPAFARARDPAAFRELLAEQLAGHPAAELEQRLNDAGVPAARVRSLREFTQQAVDT
FT                   GLLQPLVLGAGEERAVTPGLGWRVAR"
FT   gene            239527..240630
FT                   /locus_tag="Veis_0219"
FT   CDS_pept        239527..240630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0219"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: gvi:glr3508 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56011"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEF4"
FT                   /protein_id="ABM56011.1"
FT                   /translation="MTAGLDRNTMARAALLCLTAAMLGCASSPCFAPPPGRTAGAALQL
FT                   RADWDAAALQEVLAYARSQKTTGLLIIHDRQVVAEQHWPLPGDAAAFRAAFVHGQAPDG
FT                   ALLEDVASQQKSFIAILAGAAVDRGLLDVERPVSAYLGAGWSRAAPAAEARIRVRHLLE
FT                   MNSGLREDLRPEAEPGARFFYNTPAYAVTQRVLEQAARQPLDELTRRWLTEPLGMAQTD
FT                   WRARPAVLADSGNPTGLVTTPRDIARMGQLVLDRGLAPDGRRVISSAQFDLLLQRSATN
FT                   PAYGRLWWLNGGSHALLAGAGAPRREGPLIAAAPADLVAALGAHDRKLFVVPSRQLIVV
FT                   RTGQAAPARDFNQQLWLRLARALPGGA"
FT   sig_peptide     239527..239652
FT                   /locus_tag="Veis_0219"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.354 at
FT                   residue 42"
FT   gene            complement(241008..242807)
FT                   /locus_tag="Veis_0220"
FT   CDS_pept        complement(241008..242807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0220"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase;
FT                   KEGG: reu:Reut_B3890 helix-turn-helix, fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56012"
FT                   /db_xref="GOA:A1WEF5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEF5"
FT                   /protein_id="ABM56012.1"
FT                   /translation="MIIVPMSLPKTGVLESHQIMSAMETPKTGSSSTALHALRGVLVLG
FT                   ADGKAMATNGIALQPAVARCILAAWHEARRRQRKVFPAETPDGAPIVVVALPAADATVL
FT                   VAMERDSRDALFEFVGAVDFAADILAHFLTNPFEALSVVDRQGIVRYMSPVHERFFGLP
FT                   PGGGTGRHATEVIENSRLHHVVASGKAEIGLLHEMRAITRVVSRHPIRNRHGDIVGAIG
FT                   QIMFKGPEQLQALSAELSKLKSEVAYYRRELSDLRNRSYGLDQILGNSPAMQRLKQQIV
FT                   KLAPLDVPVLLTGESGTGKELAAHAIHKLSPRRDDTLVMVNAAALPATLVESELFGYEA
FT                   GSFTGAERKGRKGKIEQADGGSLFFDEVGDMPADVQVKLLRVLQDGNFQRVGGNELRHS
FT                   NFRLISASNRDFEAMIANGSFRLDLFYRIGGVTIRMPSLRERIEDIAQLAELALRQFAE
FT                   RHRQRPKKLSDAACEFLQNQRWPGNVRQLMHTVERAAIFCESEVVVPADFGIIDADPAE
FT                   LPPMLSDGAGHAALALTGAAPRASLRVSNAVEQVEEQLIRQAMARLQGNKKRVAAELGI
FT                   SRSYLYKRLAQIGLGAATGSALS"
FT   gene            242906..244150
FT                   /locus_tag="Veis_0221"
FT   CDS_pept        242906..244150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0221"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bxe:Bxe_C1036 putative acyl-CoA
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56013"
FT                   /db_xref="GOA:A1WEF6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEF6"
FT                   /protein_id="ABM56013.1"
FT                   /translation="MSTPETPLPLHGLPAKSAAALDLLAGLKVLDLTTSIAGPYAGQLL
FT                   ADLGATVVKVEKPGTGDDARAWGPPFLHGESLWFMSVNRGKQSLTLDMAAPAGRQVLRQ
FT                   LVAECDVILLNLVARAQCKLGLDADVLMGLNPRLIHVSITGFGVGSSRADLPCYDLIAE
FT                   GYSGVMDLTGEADAAPQKVGTPAADLLAGSDAAMAVLAALWRRQRNGKGCVIDVSMVES
FT                   MSRFMAPRLMPYLGSGELSRRTGGRDSVVAIYQVFDAADAPMTLGLGNDAIWKRFWDAV
FT                   GQPEVAVDPGFASNALRRARREDLVERIAALIGSRPRAHWLELLGAARVPCGPIQRLDE
FT                   LAQDPALHAAGFLYRIDGPDGPIPQVGLGIRFDGRTEGTALPPPKLGANTQEVLGQWLG
FT                   CAAAQIERLRAQRIV"
FT   gene            244163..244942
FT                   /locus_tag="Veis_0222"
FT   CDS_pept        244163..244942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0222"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bxe:Bxe_C1035 putative enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56014"
FT                   /db_xref="GOA:A1WEF7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEF7"
FT                   /protein_id="ABM56014.1"
FT                   /translation="MQFEEITYEEDGPIGTITLNRPHDGNMFTPRMCHEIRDCIDGIRR
FT                   ETRTRVIVVTGAGEKFFCIGGRKEGMQDTLLYAGVLPTLEMYEAIDKLQKPVIASVNGF
FT                   AVGGGNVLHVVCDITIAKDSAMFRQVGPMMGSFDGGYGTWYLEDLIGKKRAKEMWYRNP
FT                   KLTARQALEWGLVNHVVPDAELQDFTRKIALEIADRGAFALASIKASFNARHGGVSGLS
FT                   RMAHDLLLRGYLDSREHTELAAAFAGRRAPEASEFGH"
FT   gene            244961..246655
FT                   /locus_tag="Veis_0223"
FT   CDS_pept        244961..246655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0223"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mes:Meso_2952 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56015"
FT                   /db_xref="GOA:A1WEF8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEF8"
FT                   /protein_id="ABM56015.1"
FT                   /translation="MQEAPDMSHLLTLHDPAKAREHYLSGVWQTDTLYSLARRHAAERG
FT                   QAYAVRDCARRLSWNALVAWVDVLAADLHEAGLRRGDRVSVWLPNRIESVLVFLACSRN
FT                   GYVCNPSLHQNYTVAEIATLLSGIGCRALFAQPDYGADARSADIFARAATLPGMQRIYA
FT                   LPGLSHPGRAIPAPAHALPEPGRPLRLPLPAVSTNPDQVVYLAFTSGTTGQPKGVMHSD
FT                   NTLLANGRALVQDWRLGHGTALLTLSPMSHHIGTVALEQMLVAGCELVLYDPLAEVAAL
FT                   DWIATTGATYVMGVPTHAIDLLQESSRRGWQKLGAVKVFYMAGAPIPSETARRLLALGA
FT                   TPQNVYGMTENGSHQYTRPSDPVEVMTGTCGKSCSGYEVRLWNAQNPDLEAAPGEIGEI
FT                   GGRGGGLMLGYFSNQSSTEQSFNRSGWFLSGDLGRLDAEGNLQIVGRKKDLIIRGGHNI
FT                   HPAPIEERAHRHPAVRKAAAFGVADARLGEKVCLAVICDERAPMPQEMLQHLAQEGLSK
FT                   FDMPEFYAVAQEFPLTPSGKISKRELVQWVASGRLQPEPVRYRAAAQ"
FT   gene            246652..247416
FT                   /locus_tag="Veis_0224"
FT   CDS_pept        246652..247416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0224"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mes:Meso_2951 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56016"
FT                   /db_xref="GOA:A1WEF9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEF9"
FT                   /protein_id="ABM56016.1"
FT                   /translation="MIELARDEEFAVLTIRRPAALNALSFDLLGKIGPCIRQAGQSGAR
FT                   ALIVTGEGDKAFCAGADIKELQNRELRAQREGAEFGQAVFALLDRLPIPSVALVNGFAF
FT                   GGGCELALACTLRLALPNARFGLPEVKLGLIPGYGGTQRLPRLVGLGRALELVLTGRTV
FT                   DAPEALAIGLVNRVVQPPGLAAAKAYARQFSGHGLRALQFAREAVLRAADMPLHDGLRM
FT                   EADLSTLAYRTRDAQEGLQAFVDKRPPKPADC"
FT   gene            247416..248174
FT                   /locus_tag="Veis_0225"
FT   CDS_pept        247416..248174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0225"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   mes:Meso_2950 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56017"
FT                   /db_xref="GOA:A1WEG0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEG0"
FT                   /protein_id="ABM56017.1"
FT                   /translation="MEQPMDRSCIVVTGASRGIGAAIACALLQQGRDVIGVSRSGAVPA
FT                   CAGLAPELAARCTAMQADVTRPQAMTDVCRELRERGWRIQGLVNNAGMHADAASDRMPL
FT                   AQWHQLMDSNARSVVSACQAVYPHLVHAGGGVIVNIGSFFDKLGVKRNLAYCASKAAVG
FT                   AITRVLAVEWASQGIRVIDVAPGYIVTDLNAKALAAGAPLRAYLEQRIPGKKPGTAADV
FT                   AALVAALFTPAGAFLSGETIYLDGAQGIAH"
FT   gene            248189..249355
FT                   /locus_tag="Veis_0226"
FT   CDS_pept        248189..249355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0226"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mes:Meso_2949 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56018"
FT                   /db_xref="GOA:A1WEG1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEG1"
FT                   /protein_id="ABM56018.1"
FT                   /translation="MNILQRLDARLALSDEERMLLASVQQLAREQVAPRAGHFDRSGEF
FT                   PSENLRAINALGLNAMFIPAAYGGAELSYTAYLACVREISQACAATGIIWATNYHAIKP
FT                   LIDWGSEEQKTRLLPRIADGALAALAITEPDAGSDATGMRTSFRPVGDDVLVNGGKSFI
FT                   TNGDRAGLYLLFGKWEGIAGARQSISVLILEQGTPGLSVLRLEDKMGMRASGTATLAFD
FT                   GCRVPQANVLGQPGDGLKILFASLNKSRPSVAAHALGIARAAFEDAVAYINQRRQSGQR
FT                   ILEFQGIQFMVADLAAELALVESWLWQVAGWVDAGAQDFGMEASLLKLRATDLAMRVAT
FT                   DAVQLLGGYGYCKDYRVERLMRDAKITQIWEGTNQIHRQLIGRSFLQR"
FT   gene            249391..250935
FT                   /pseudo
FT                   /locus_tag="Veis_0227"
FT   gene            complement(250928..251767)
FT                   /locus_tag="Veis_0228"
FT   CDS_pept        complement(250928..251767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0228"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rpa:RPA1411 possible enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56019"
FT                   /db_xref="GOA:A1WEG2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEG2"
FT                   /protein_id="ABM56019.1"
FT                   /translation="MSAMQWVKTAQEGGVFVIRLNSPENRNSLTSALREQLGAAVDRAA
FT                   QDRSVRALYLTGEGPSFCAGGDFRMLQTHSDPWPVHRRFRDLIRWFTPLMALDKPVVVG
FT                   VRGHAVGGGMGLALTGDVVIAGTSAQFMSGFFRLGTIPDIGVMYQLPRLIGMARAKNFL
FT                   FGGATMRAKEALELGLVARVVPDEQLDAAGLQEAARLAAGPAEVMGLAKTLMARSFETT
FT                   LHDMLAFEGLGQALAMSHPEFREGLAAAIAGRPADFVGAAAHPVRQQTPGGQDRPIS"
FT   gene            252093..252872
FT                   /locus_tag="Veis_0229"
FT   CDS_pept        252093..252872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0229"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: dra:DR0113 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56020"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEG3"
FT                   /protein_id="ABM56020.1"
FT                   /translation="MFTNDTLKGRTALITGGGTGIGLEIASAYARLGASVMLVGRNQER
FT                   AQEAAEGLRRAGGQAAACRCDVRDYDQVTNAVAATLARFGALDILVNNAAGNFVCPSAE
FT                   LSPNGFRTVIDIDLNGTFHGCHAAHPHLKASRHGGSIISIITMRGVTGWPGAIHAACAK
FT                   GGILSLSRTLAVEWGGDGIRVNTISPGPIADTEGVRRMYIESGKGPSEVGKTALGRWGR
FT                   KADVANAAVFLASDLADYVTGANLIVDGGRWLKQAAD"
FT   gene            252942..253919
FT                   /locus_tag="Veis_0230"
FT   CDS_pept        252942..253919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0230"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   bbr:BB4717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56021"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEG4"
FT                   /protein_id="ABM56021.1"
FT                   /translation="MQAFKNTFRAATAALALIMAAPVSAQEYPSRPVRLICPYAAGGLT
FT                   DILARTVAQELSRRLGQPVIVENRAGGGGIAGTDFAAKAAPDGYTLTLAGQGLASVNTS
FT                   LYPHLPYDTLRDFKPLSQIAKFSLVLVGHPRRAPESVSDLIHLARKNPDALSYGSAGNA
FT                   STAHLAMEMFKEHNGLSLLHVPFKGESAALMELVAGRIDSMFATVGGSLALIRSGKLRA
FT                   IAIPDDARNPLLADVPTMREAGIEDFNVFGWFVVLAPANVPERVADRLGKEFMAIGSDP
FT                   GFRKAMLERGMQAVGSSAAEAAQMIEKETGRWAALVKKTGIALD"
FT   sig_peptide     252942..253019
FT                   /locus_tag="Veis_0230"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(254060..255049)
FT                   /locus_tag="Veis_0231"
FT   CDS_pept        complement(254060..255049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0231"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   reu:Reut_A0847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56022"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEG5"
FT                   /protein_id="ABM56022.1"
FT                   /translation="MNSRHAHARRLVSMLLGSCAWIAAASGLQAQDYPQKPIRMIVPFA
FT                   AGGPTDAQARELARRMADELGKPVFVENRSGSGGNIGAEVVARAPADGYTLLFSSNGPL
FT                   AGNLSLFKTMAHHPVKDFAPISNYSANANVLAVHPSFPANTLAEFVAVIKEHPGKYSFS
FT                   SGGNGTTQHLSGELLKTMAKIDMQHIPYKGESPAILETLSGLAPITFCNVSSCMGYVHG
FT                   GKLRAIAITAPRRLTIYPQLAAIAETYPGFDVRAWYGLVAPAGTPAAIVQRLSALVNKI
FT                   SQSDDMRAKFESQGIESMANSPEAFAAFIHSEIRKWAELIAISGARIE"
FT   sig_peptide     complement(254957..255049)
FT                   /locus_tag="Veis_0231"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 31"
FT   gene            complement(255149..255619)
FT                   /locus_tag="Veis_0232"
FT   CDS_pept        complement(255149..255619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0232"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   rme:Rmet_5537 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56023"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEG6"
FT                   /protein_id="ABM56023.1"
FT                   /translation="MTSIDAARGMYFEDFAIGQELRTPERTITSTDIVNFACLSGDFNE
FT                   IHANHEYCKRTPFGEPIAHGPLVYSIMGGLQYASGINDGTLLALLQIDAWRMLAPVRHG
FT                   DTLHMRSTVVGKKETSRPDRGVVTFARRCLKQDGSVVQEMRATLMYRRRPPA"
FT   gene            complement(255626..256792)
FT                   /locus_tag="Veis_0233"
FT   CDS_pept        complement(255626..256792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0233"
FT                   /product="putative thiolase"
FT                   /note="KEGG: bxe:Bxe_C0860 putative thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56024"
FT                   /db_xref="GOA:A1WEG7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEG7"
FT                   /protein_id="ABM56024.1"
FT                   /translation="MTLKNKVAVVGVGESDIGKMPHMSGLGLNAQAARRALDDAGLKVS
FT                   DIDGLLTAYSFTEPYFMLGSVLCEYLGLAPRYAASVVAGGASPGVMLGHAADAIAAGRC
FT                   HTVLVCAGENRATGQSRDQTLAALSAVGHPYFEAPYGASIPALYALIARRHMHEFGSTP
FT                   EQLAAVAVTSRRHASLHPNAQMRSPLTLADVAASKPIADPLRLLDCCLISDAGGAFIVT
FT                   ARERAKDCAQAPVYLAGIGEAHTHEHLICADSLTEFGVRQSGQIAYRMAGLGPRDIDLA
FT                   QLYDCFSIVPILELEALGFCGRGEGGAFYAAGHAALDGILPVNTHGGMLSHAHAGAAGG
FT                   LFGIVEAVRQLRGGLGERQVADARVALVHNEGGILSSHCTAIFSNTPD"
FT   gene            complement(256789..257949)
FT                   /locus_tag="Veis_0234"
FT   CDS_pept        complement(256789..257949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0234"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   reu:Reut_A1835 acyl-CoA dehydrogenase, C-terminal:acyl-CoA
FT                   dehydrogenase, central region:acyl-CoA dehydrogenase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56025"
FT                   /db_xref="GOA:A1WEG8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEG8"
FT                   /protein_id="ABM56025.1"
FT                   /translation="MRESSTMHFAPGTEQEILREAVVRFVERNCAPRDVRRWDRDGEFP
FT                   ETLHHEMVAAGFPAMMVPQAYGGSASSMQDCAIVYEEISRPSVDLGTRLALLAWGSMIL
FT                   SDFASEEIKQEFLPRVASGAVKLSFSLTEPGSGSDAASLQTRARADGDGWVLNGQKLFS
FT                   SGADALNNHIIVAARTDPDAPRHKGISLFLVPNTSPGLTIRRLDTVGRKIVGLCEIFFD
FT                   AVRIPRRYLIGEVNHGWHYITRHLERERITLAANYLGSARSALADAIAYACERRQFGRP
FT                   IGDFQVIAHMLADMATEVEAARWMVAMAAWRYDMQLPCAKQASMAKLFVSEMLVRATTQ
FT                   GMQILAGHGYTTDHDMQRYWRDARNCTVGGGTSQIQRGLIARELGL"
FT   gene            complement(257946..258356)
FT                   /locus_tag="Veis_0235"
FT   CDS_pept        complement(257946..258356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0235"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   sma:SAV3825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56026"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEG9"
FT                   /protein_id="ABM56026.1"
FT                   /translation="MNLLPAPPVNADNRPYRDGASAGRLMLPHCGACGHRFFMPRYQCP
FT                   RCWSNDLHWTPASGRATIHSYCIVRRAALPAFADRVPYVLALIDLAEGPRMMSQILGEN
FT                   ALQAHIGAAVELCFETCADGAQLPQFRLVHHG"
FT   gene            complement(258353..259135)
FT                   /locus_tag="Veis_0236"
FT   CDS_pept        complement(258353..259135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0236"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   ttj:TTHA0290 probable enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56027"
FT                   /db_xref="GOA:A1WEH0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEH0"
FT                   /protein_id="ABM56027.1"
FT                   /translation="MSSDDSLRLQIDGPIATLTLNRPDKLNAMGAQTRALFGAHLQRVA
FT                   DDAGVRVLLLNAEGRAFCAGADLGSLPTTALDWRERVIAAQRQHQLMATMNPVVIAAVQ
FT                   GAAAGGGAALALAADILLMADDACLRFPFVRLGLIPDGGTAFLLQAKAGTAMALDLLLS
FT                   GGVMAAAEAFACGLTRRVVPPDRLAPQARALAEELARLPAQSLLLTKSLMRQTWAARMP
FT                   GALAHEADAFALVTALPGHAQAMARMRPQTRASAKENG"
FT   gene            complement(259132..260391)
FT                   /locus_tag="Veis_0237"
FT   CDS_pept        complement(259132..260391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0237"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: reu:Reut_B4564 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56028"
FT                   /db_xref="GOA:A1WEH1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEH1"
FT                   /protein_id="ABM56028.1"
FT                   /translation="MPGALSGFKVVDLTSVVMGPYATQIFGDMGADVIKVESPQGDIMR
FT                   HMGATRGPAMGPIHLSVNRNKRSLVLDLRQPAAHAALLRVAGDADVFVHSMRPDAIERL
FT                   GLGYEAIAAVAPDIIYCGAYGYGKSGPYALEPAYDDMIQGMCGLADSNKYLAGEPRFTP
FT                   TIVADKVAGLSIAYAVLAALLHRQRTGEGQSIEVPMFESLASFMLVEHLWERAYDPRHG
FT                   AVGYPRVLSQLRKPHRTLDGFVCVLPYTDRNWRDFFALAERPELAVDPRYATTAERSKN
FT                   YETLYQALGDIIATRATATWIGQCRARSIPIAPVNSLQDLFEDPHLQAVGAFIRAPHPS
FT                   EGDITQVRPPVNFSKTACAITALAPGLGEHSHAILRQAGLSDAAIAALAATGATVGGAP
FT                   GAPGASIQRSRDIDRQEGPV"
FT   gene            complement(260471..261595)
FT                   /locus_tag="Veis_0238"
FT   CDS_pept        complement(260471..261595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0238"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: mes:Meso_2957 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56029"
FT                   /db_xref="GOA:A1WEH2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEH2"
FT                   /protein_id="ABM56029.1"
FT                   /translation="MEFEDIACPQAASVANATPGRARAQPLSGIRVLDFSSLVPGPLCT
FT                   LLLAEAGAEVTKIERPQAGDEMRGYAPKAGEDSANFVLLNRGKKSIAIDLKTRAQELHA
FT                   LIGESDLLIEQFRPGVMARLGLDYESVRAINPRIIYCAITGYGQSGPQALEAAHDLNYL
FT                   ASTGLLGLCRQPALPPALIADIAGGAYPAVINILLALRQRDQTGQGCMLDVSMADNLFT
FT                   FQYWGLGAGWAAQQWPQPGADLISGGTPRYQVYRAADGQYLAVAPLEEKFWRNFTRRLE
FT                   LPETASAEQVAQAIARHDAAHWQARFAGIDVCVNRVVALEQAVNDPHFVQRGLFAHQVC
FT                   GADGVPMPALPVPLSGQFRAAPGLAHAPKLASTV"
FT   gene            complement(261585..262289)
FT                   /locus_tag="Veis_0239"
FT   CDS_pept        complement(261585..262289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56030"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEH3"
FT                   /protein_id="ABM56030.1"
FT                   /translation="MFHCRYRSAALVPLGRVVGVGVFPRLAGPEPDRLRWGRPTWRVRH
FT                   RQAHRQRRRVAGAPTTSGSEMPVFLVSRHQGQAALAVHAVIGDPDPVAFRIDLDVDSLD
FT                   IDIGISIGISGARDRFGQSGGDVVAEVDSGVVGHVQVCCRQTRHLVHRPAHPPKRGWHI
FT                   GTMSLSRTLVHRCVFAGCTAGDTRGTATRFRRRASGRAASGMRRIFRRHGCCATGPCVH
FT                   MPLCKGKTRHGV"
FT   gene            262372..262641
FT                   /locus_tag="Veis_0240"
FT   CDS_pept        262372..262641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A0977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56031"
FT                   /db_xref="GOA:A1WEH4"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEH4"
FT                   /protein_id="ABM56031.1"
FT                   /translation="MSRTFSTARTAWQQRGQGMTEYIIIVALIGVAAIAVYQFFGETIR
FT                   AQTSGIANEVAGKSAKTAITAAGAAAAKADGERKTKGLDAYENK"
FT   gene            262653..264137
FT                   /locus_tag="Veis_0241"
FT   CDS_pept        262653..264137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A0978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56032"
FT                   /db_xref="GOA:A1WEH5"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEH5"
FT                   /protein_id="ABM56032.1"
FT                   /translation="MHCVGQRGGQMRTRHGQRGQALIYGMFVVIGGLASLFFLFNTGQL
FT                   SQEKTKLVNTADAVAYSAGVMHARALNFIAYGNRALVANEVLVAQMVSLSSWAQYARTH
FT                   AQNLPTQFVECADPYGYGETLGAAFHYGPKYAVMCYLTVQYAGDYIAQIAEQVPPLAQA
FT                   VVTGAETNKQAIKLAHGLLHTPGHLQSMRTAVMQDVAQANYAGDGSVRVEPAGLVGASG
FT                   APLTDDWGGFTRHYSGQDRARIAELAGLAAHTDPFTRERRWDATAAFPGPDPVCIDLGR
FT                   KSEVRRRGGTDLVNYDEWIAQDTESFWRAYQPRGFIPRCRYQEEPIAYGEQQAHPDGQD
FT                   QDDSGARLGGARSNGGAASQASSSHWTNYSGLPSYYELDSGQLGKDDPALRMSVRLVRA
FT                   RSDLRTSDGSSQIQRSAGSRIDAYESRVAKDEMAAVASSEVYFERPFAQRPNGYGAPQG
FT                   RPREVGSLFNPYWQVRLVHSGNDVRNQQQRQGALIQ"
FT   gene            264134..264955
FT                   /locus_tag="Veis_0242"
FT   CDS_pept        264134..264955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56033"
FT                   /db_xref="GOA:A1WEH6"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEH6"
FT                   /protein_id="ABM56033.1"
FT                   /translation="MNHAPGSRAPQHGQALLEFLVIAAAILGLFLLTPVVAKYQDIAHA
FT                   THMASRYAAFDATVHNDASGAFKPEGQLAGEVRKRYFGNPDAPIESAAVDDAAGAAQTR
FT                   RNPFWSTPHGAPLIRSLADVSVTFGAGQASSHHQAFSSSSDGKPFSQAPLVNHATLGLQ
FT                   ARGIYRANISVPLVDLPEGLQSYTPFDEIDLRITRHTSVLIDPWAARSVQQNMERFGKL
FT                   APLNSVFSSMETLLDVAIPAFELFGEVPAPRFGHLQPWQDAVPADRLKPEY"
FT   gene            264991..265767
FT                   /locus_tag="Veis_0243"
FT   CDS_pept        264991..265767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56034"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEH7"
FT                   /protein_id="ABM56034.1"
FT                   /translation="MQHCPPAPRPPRPPRLRGTRASLCLALALTLGAAASAQAPWPEVA
FT                   LPAQARSYGIGQQLDMNGLPMRLTGFATETGPEQTTAWFRRTLGQPLVENRLGQQRILG
FT                   RADGEHYITVQVEPGADGTGSRGMVALTQLRGVLQQQETIARWRRLLPAGTDITSHLRT
FT                   WDNGKLDNHLVALNRHSEQLNAQRLTAALSEQGYEIEREFSPDADTAARLPAALAGGVI
FT                   LLFRGPGKQAMATITRDAQGQTSIVLLTSVQMESVR"
FT   sig_peptide     264991..265104
FT                   /locus_tag="Veis_0243"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.877 at
FT                   residue 38"
FT   gene            265764..265949
FT                   /locus_tag="Veis_0244"
FT   CDS_pept        265764..265949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56035"
FT                   /db_xref="GOA:A1WEH8"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEH8"
FT                   /protein_id="ABM56035.1"
FT                   /translation="MTRVRRLRQCGQSSVEYGVVCAALAFALGVGMVDDGSVLHELLQA
FT                   LRSAYQKFSFAISLPL"
FT   gene            266010..266930
FT                   /locus_tag="Veis_0245"
FT   CDS_pept        266010..266930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0245"
FT                   /product="SAF domain"
FT                   /note="PFAM: SAF domain; KEGG: bbr:BB2096 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56036"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEH9"
FT                   /protein_id="ABM56036.1"
FT                   /translation="MKLPLSRLATLRPGKTWLALGAALLIGLAAAFSVRGYLSRQVAAI
FT                   EARSKKETIALLVAKRELKKGDLLATGNVAVREIPLDYAHSNAIAPEHFERIEGQGIEH
FT                   GLKAGEMLLWSLMQTRKAATFSARIEIGRRAITVHVDEINSISGLLEPGDAIDLMVTLD
FT                   RGGKKITFPLLQNVQVMATGQRSADDPKSGERRQYSTVTLDTTQAQAQSVIVAREAGKI
FT                   TALLRNPQDTQVQAGDSAAIAALLGQAGDAQSLADGAAGRAVPVLYGGRHIDFKPEELT
FT                   LGQAAQRSNDKPAPRTAPPPAGSAR"
FT   sig_peptide     266010..266120
FT                   /locus_tag="Veis_0245"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.550 at
FT                   residue 37"
FT   gene            266959..269103
FT                   /locus_tag="Veis_0246"
FT   CDS_pept        266959..269103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0246"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   KEGG: bbr:BB2097 putative secretory apparatus"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56037"
FT                   /db_xref="GOA:A1WEI0"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEI0"
FT                   /protein_id="ABM56037.1"
FT                   /translation="MSIRPPARPFLRCRPFFRAAAAGRALRRGLLLACCAAWPASAQTP
FT                   PETADLSRGGFAPQLQARKPAPTPSQPYLPIRKQDDQAQVPEIEMFVGESRVFPSPGVA
FT                   RIAVGNGKVLTAAALDEREVIVFANEVGTSSLFVWNEDGRYQRVKINVVPGDTSRYARE
FT                   IAAFLSTIANTKASIIGDKVIVEGDNLSDIDLRKIEDLRKHYPQIVNFTNQIGWEQMVL
FT                   MDVKVVEFPVNELRELGLRWAAKGGASIGGIWSPIRRVHQDGLRIDVESPPITAADGDL
FT                   IPLPKGLNILSALNMGLGAKLDLLASQGKASILAQPQLSARNGAKAEFLAGGEYPYVAS
FT                   SINGPTVMFKPYGIRLKITPRVDRNGVIRAEIDSEVSNIDPSISTAAGPALSVRRTFTE
FT                   FNVQNGETMVLSGLMSRKTSQNIDKVPFLGDLPVLGALFRSKRFQNDETELVVFVTPTV
FT                   INSQSPGLVQRIERITDDLRQRYGPAPWLDQPGPAPAHLPRLAPAPLASADASIASAPM
FT                   PAAAAIVRPERLATVPARRNPLEPPPIDHWRVVHDGLVLHAGPDAGSQALLQLGQGSFV
FT                   RAAPDRPPMSDAHQGWRAVAVGALQGWVRDASLRPVAHAPDASAPPDGPHAQQARQGQE
FT                   IAAHHTGGKHAHPAPGSYRVALGALALRVAPDINAPVLQRLAQGSLLEVLPQAPQAQFS
FT                   AVQVDGRRGWVETQWLFPAF"
FT   sig_peptide     266959..267087
FT                   /locus_tag="Veis_0246"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.949 at
FT                   residue 43"
FT   gene            269110..271029
FT                   /locus_tag="Veis_0247"
FT   CDS_pept        269110..271029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0247"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase; KEGG: reh:H16_A0983 flp pilus assembly ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56038"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEI1"
FT                   /protein_id="ABM56038.1"
FT                   /translation="MIHLELTHPDGQRQQMQVPGICSIGKGTQCELRLAGWRIAKEHAR
FT                   LLKSPAGVLLDAGDSFAGVQVNGRRIETQCGPLQASDIIGIGPFRLRVLDPQAPPGDEC
FT                   APAPAVRDSAEPDAPRPGAGPKTHPPGAGPKTPWPTPWPGAAPTIPRPGAPAMAPPQGA
FT                   ATAAMPAPATPARAATDAAPPPAAERLAARADAPMRALEFEWRKRLHAKLIEAMDLRRH
FT                   DVSRMSDEHLRAEADRLIVKIMQDMAADIPAALEHGALRKQILDEAVGLGPLEELLADD
FT                   SVTEVMVNRFDEIYIERAGRLQKHALSFTSDQAVMGVIERIVAPLGRRIDESSPMVDAR
FT                   LKDGSRVNAIIAPLALKGSTLTIRKFAKRKLDAGDLVQFGSLSPAMADFLRICVQARKN
FT                   IIVCGGTGSGKTTLLNILSNFIPPGERVITVEDAAELRLNHEHLISLESRPANVEGKGG
FT                   VAIRELVRNTLRMRPDRIVVGECRGAEALDMLQAMNTGHEGSLTTLHANSPRDGLARLE
FT                   TMVLMAGMELPLAAIREQIASAVDILVQQTRFSCGTRMVTHITEISGMESGKIQLQDLF
FT                   GFVNRGYAMQADGLSKVQGHFSGCDTVPHFYDELRASGARLDLDIFRPAPDSGSGGNAA
FT                   GQRP"
FT   gene            271026..271898
FT                   /locus_tag="Veis_0248"
FT   CDS_pept        271026..271898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0248"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   bpe:BP2525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56039"
FT                   /db_xref="GOA:A1WEI2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEI2"
FT                   /protein_id="ABM56039.1"
FT                   /translation="MNSLAPNDPLLAAIIAVVVLSVALLAWLLIDIGSATLERYRASFT
FT                   ERAGFQAAEFFLFIDARKLFLANLAVMALGGLLVWLISGSELLALPAFFALGLLPRLLY
FT                   RQMRKRRLRKFEEQLPDALMMLSGGLRAGLGLSSAMAQLVAESGPPLSQEFSLMLREQR
FT                   LGVTLEQALSNLNHRMPTQTTVLITSAMRIANETGGGLAETLERTSATIRSRLRMQAKI
FT                   GALTAQGKLQAWVVGALPIALMLILNEMEPQAMSMLWHTRVGWATLAVIALFEFLGVYV
FT                   IRKIIAIDV"
FT   sig_peptide     271026..271106
FT                   /locus_tag="Veis_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.848 at
FT                   residue 27"
FT   gene            271953..272894
FT                   /locus_tag="Veis_0249"
FT   CDS_pept        271953..272894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0249"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   bxe:Bxe_B2923 putative type II secretion system protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56040"
FT                   /db_xref="GOA:A1WEI3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEI3"
FT                   /protein_id="ABM56040.1"
FT                   /translation="MESNTLILTLIATAAGLSAALLAWLIGHSMASVRPEDRSYKDPPP
FT                   LAMRLLWWPIQWIGQHLGPRLGTGKSVRTLQLKLRQAGLDYTLDPAQFIASRIVSAFVA
FT                   TALLWWAVSSFDGLPIGAGGVDAARRYIATGTYLQAMAIGALLGWFYPAIWLKDRIALR
FT                   RRELLRMMPFFLDIITLCVEAGLNMHGAIAQAVAKGPQGTVREEFQRVLRDVRAGKART
FT                   ESLRDMAERLNEPGVTQFVMAVIQAERMGMNLGPVLRAQADQQRSERFLRAEKLAMEAP
FT                   VKMLLPLIAFIFPCTFIVLLFPIAMKFINTGL"
FT   sig_peptide     271953..272048
FT                   /locus_tag="Veis_0249"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.646 at
FT                   residue 32"
FT   gene            272894..273379
FT                   /locus_tag="Veis_0250"
FT   CDS_pept        272894..273379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0250"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   sth:STH1923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56041"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEI4"
FT                   /protein_id="ABM56041.1"
FT                   /translation="MGRQPTPPRPLPPLLPRLRIRQAQGFWARFIGLMGRPDPRAAAAR
FT                   DAGNAARTGGASALLIAHCTSVHTCFMRYALDIIYLDAQGRITRQALALAPWRCSRAGP
FT                   GAAHVLELPAGAITGLQPGMQLQPWPIDAATANARFVRVADPRGAASAPPAAPIATT"
FT   gene            273485..274666
FT                   /locus_tag="Veis_0251"
FT   CDS_pept        273485..274666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56042"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEI5"
FT                   /protein_id="ABM56042.1"
FT                   /translation="MQHRLSHLRLAMAHRRCAPLFSWFPACLFGLTLAACGGGGGGGAD
FT                   ISGADGGAAGAGGAGGTTSAGTFIAAAGPLCAKRAANNHCVQPTSSSTTPFALMKAITD
FT                   PNGQVIDFDSMGSTMNYAVTFKGTPPGPEYTYTSYGMARRNIQAGRNTFTVDDRYYGNA
FT                   RAFPAAGEIKYRHARDDATVTFNVGRQKDQNDENLSSLTLSEDQASGGGGRAWSSALRL
FT                   LTDQTDAPPTPTITYVGRVLPSAGSAALLDEHTRDFLITGVTYEAVLNTVTGTLTGVSI
FT                   DYTESKSQRHTRLELPELRFQNSQLDSASRQQRIHARMEGPGQDDRGDEPQPDTARTRH
FT                   EFTTDGLEGEITGRQAEIIELVGGGPKGILHVALVRKDLTEDDFVIDIPRPKP"
FT   sig_peptide     273485..273592
FT                   /locus_tag="Veis_0251"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.411 at
FT                   residue 36"
FT   gene            274733..276001
FT                   /locus_tag="Veis_0252"
FT   CDS_pept        274733..276001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56043"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEI6"
FT                   /protein_id="ABM56043.1"
FT                   /translation="MNHASTPASVAPRQRGSAMVEARLSKAAIAWMAAFIARQNTVDRL
FT                   FEAARARINIMKSTATTAIFILAAGLGSASAKLNIENISPQQTDRPYSQIILKDKKPYW
FT                   LSAGQTDVAGAQGDFLVLQEMDCRANGKAKNINMPADYMALAPLAEFMWQKALVIGVNF
FT                   SGEWSLTPLHDDLSGTQQSLPLSNVGAIWASTSSKAGYFIAGTSANKQPMLMYFSGDLK
FT                   SKKALGQANDHHGEVSSVFESRGRVFALFNRYPGAKDTGTSPGAELREYSATGAPVSRT
FT                   PLNGTAATGTALKDGGIAISYWIGKQLFMEKRAAHLATLWTAQLHQRSGIASMKGHLLE
FT                   AGSDIAWIGANDNQLLVHRVTQDGASVQTSVDTQSKMGIPTPRIYSASSSGNDISIRGT
FT                   AGRSTSPRPGQVTRFCFTEKPDS"
FT   gene            276035..277045
FT                   /locus_tag="Veis_0253"
FT   CDS_pept        276035..277045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0253"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: reh:H16_A0987 flp
FT                   pilus assembly protein TadG"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56044"
FT                   /db_xref="GOA:A1WEI7"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEI7"
FT                   /protein_id="ABM56044.1"
FT                   /translation="MNRPSTPASVAPRQRGSAMVEFVVVGPIITLFGLAILQYGLLFFS
FT                   RNQINHASFMAARAGTMAHAKLSDIRETYLRAMVPLYGGGRNSDELSQAKAKAVADLDG
FT                   NLRIDLLNPTSASFDDWSAPYLQKKYNARAIPNAGLAYRDKNDIGGQSGQSVQDANLLK
FT                   LKVTHGYELKVPLVNTIYKHYLQWLDDGHDPLHTELIKRGRLPIVTHVTLHMQSDAIEG
FT                   QTTSLNQGHGDNDSPWGQGGSGGSGSGSGSGAGAGAGGSGSGGSGGSGGPDDSDDADSL
FT                   SSRKPPPDCRTIGCTLLDPSDAKEPEPDDGAGNGAGNGAGGSAGQGGADGGSQCF"
FT   gene            277036..278763
FT                   /locus_tag="Veis_0254"
FT   CDS_pept        277036..278763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0254"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gll0213 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56045"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEI8"
FT                   /protein_id="ABM56045.1"
FT                   /translation="MLLRHTAPRSLRTALWRVLVLVLALAQLHPALAQLPTGTPQTSTP
FT                   AAPPSSAITWKTCNPPPMCFRSKQARQQWAKDNQCQFLEDVCEGTPAKPDNQGAKQEDK
FT                   GFWGALWDDVKGALVYGYEFVKGLMHGLKDQVTDLWQMLTNPAEVISGLVELGKAFFND
FT                   PDGTLKMLAGLLGQEAIDTIKRATQCGAYDLGKVIGKNVNPGAMFKLAVNLSKYGGKLA
FT                   DAVKGTRREFGCASFAADTLVHTPRGMVPIEQIRAGQQVQSRHDRLFADAPQTVTKTFA
FT                   RTAPSYRRLSTEFDQFKLTDEHPLWVQGKGWTQARHITDDDVIAGAQGDVRVLGNEPVQ
FT                   QPLPVYNFSVAKTANYFVGTGAIWAHNANCDAAVHIKPWKDCTPLEKGFRGEVITFMDM
FT                   IKAGAEPLGRTLGLNPKGRSPVQAFKAWHGRTGIDGIYKVRSKVRDKHGNVVKDKDGKD
FT                   VEEVTYVIIESKATGGMKNGILDDIVAKLTKNKNDERQMSEAWIERNLENMGLSAADKD
FT                   AIINNLGKPGKVKRIYAQTDAEGTTYHEIRGIDKAGNPDPFEARVSNVAFDPQSLKGT"
FT   sig_peptide     277036..277137
FT                   /locus_tag="Veis_0254"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 34"
FT   gene            278765..280093
FT                   /locus_tag="Veis_0255"
FT   CDS_pept        278765..280093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppu:PP_4047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56046"
FT                   /db_xref="InterPro:IPR015025"
FT                   /db_xref="InterPro:IPR028983"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEI9"
FT                   /protein_id="ABM56046.1"
FT                   /translation="MRDPDGKLETYEGKIEFCIRRLKQLSKNEDKEIFTRWHNTLSTFP
FT                   RVIEYMLFRYGRGDPLADIWSYFEKDGWPFYQRVVVHAKQLPPLSPDKDQERPSIGLFI
FT                   GARSARTVNFFLAFLLCMDESSERIINHRNWLFMDPPCPLVDVMLKSFIPNHRGVPNYK
FT                   YNKYRQWWTFPLVNALAQPPEQRPAALAAHMNNWYRLMRPLGWKPNRDPALEKDGLFCD
FT                   FAFEVALAVCAYDIDDSSFRDHPHYPRDLVDHYRQHIRHTRDAWRAEGLGAGIELPPPV
FT                   PPKRVDLAKSKRKNFARWVELACDGYDDAVESVLETTGKPRKIQDFFQLLEALQDVGHA
FT                   IHADGKDSDTLDSQAADLADARGIGPFEAPDSDPPQGGARCTAILRALHAWAAPRGYQL
FT                   IDLDDQDDAWHAVLVKTEYHDEFLALSQALGLRTRKPQQAYLD"
FT   gene            280268..282013
FT                   /locus_tag="Veis_0256"
FT   CDS_pept        280268..282013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gll0213 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56047"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEJ0"
FT                   /protein_id="ABM56047.1"
FT                   /translation="MLLMHTAPRNLRTALWRVLVLVLALAQLHPALAQLPTRTPQSTGT
FT                   PQTSTPAAPPSSAITWKTCNPPPMCFRSKQARQQWAKDNQCQFLEDVCEGAPAKPDNQG
FT                   AKQEDKGFWGALWDDVKGALVYGYEFVKGLIHGLKDQVTDLWQMLTNPAEVISGLVELG
FT                   KAFFNDPDGTLKMLAGLLGQEAIDTIKRATQCGAYDLGKVIGKNVNPGAMFKLAVNLSK
FT                   YGGKLADAVKGTRREFGCASFAADTLVHTPRGMVPIEQIRAGQQVQSRHDRLFGDAPQT
FT                   VTKTFARTAPSYRRLSTEFDQFKLTDEHPLWVQGKGWTQARHITDDDVIAGAQGDVRVL
FT                   GNEPVQQPLPVYNFSVAKTANYFVGTGAIWAHNANCDAAVHIKPWKDCTPLEKGFRGEV
FT                   ITFMDMIKAGAEPLGRTLGLNPKGRSPVQAFKAWHGRTGIDGIYKVRSKVRDKHGNVVK
FT                   DKDGKDVEEVTYVIIESKATGGMKNGVLDDIVAKLTKNKKNDRQMSEAWIERNLKNMGL
FT                   SAADKNAITAGLRDPKKVKRIYAQTDAEGTTYHEIRGIGKDGKPSVTEARVSNVVFDPQ
FT                   SLKGT"
FT   sig_peptide     280268..280369
FT                   /locus_tag="Veis_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            282015..283343
FT                   /locus_tag="Veis_0257"
FT   CDS_pept        282015..283343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppu:PP_4047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56048"
FT                   /db_xref="InterPro:IPR015025"
FT                   /db_xref="InterPro:IPR028983"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEJ1"
FT                   /protein_id="ABM56048.1"
FT                   /translation="MRDPDGKLETYKEEMEHYIYVLNHFSRNEHRDNTVRWNNSSGVLP
FT                   YVIKCMLFRYGRGDPLTDIWSYFEKDGWPSYQRAVALVKQLPPQSLDENQRGTPIGLST
FT                   EESTALEVHFFLALLIFMDQSPERLMNHRNWLRVDPPRRFIDVMLKSFIPNHQGSSNYK
FT                   SSTEQKWWTFPLMNALAHPPEQRSAALAAHMDNWHRLMRPLGWKPNRDPAGDKDGLFCY
FT                   FAFEVAMAVCAYDIDDSSFRDHPHYPRDLVDHYRQHIRHTRDAWRAEGLGAGIELPPPV
FT                   PPKRVDLAKSKRKNFARWVELACDGYDDALESVLETTGKPRKIQDFFQLLEALQDAGHA
FT                   IHADGKDSDTLDSQAADLADARGIGPFEAPDSDPPQGGARCTAILRALHAWAAPRGYQL
FT                   IDLDDQDDAWHAVLVKAEYHDEFLALSQALGLRTRKPQQAYLD"
FT   gene            283518..285242
FT                   /locus_tag="Veis_0258"
FT   CDS_pept        283518..285242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gll0213 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56049"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEJ2"
FT                   /protein_id="ABM56049.1"
FT                   /translation="MLLRHTAPRSLRTALWRVLVLVLALAQLHPALAQLPTGTPQTSTP
FT                   AAPPSSAITWKTCEPPPVCFRSKQARQQWAKDNQCQFLEDVCEGTPAKPDNQGAKQEDK
FT                   GFWGALWDDVKGALVYGYEFVKGLIHGLKDQVTDLWQMLTNPAEVISGLVELGKAFFND
FT                   PDGTLKMLAGLLGQEAIDTIKRATQCGAYDLGKVIGKNVNPGAMFKLAVNLSKYGGKLA
FT                   DAVKGTRREFGCASFAADTLVHTPRGMVPIEQIRAGQQVQSRHDRLFTDAPQTVTKTFA
FT                   RTAPSYRRLSTEFDQFKLTDEHPLWVQGKGWTQARHITDDDVIAGAQGDVRVLGNEPVQ
FT                   QPLPVYNFSVAKTANYFVGTGAIWAHNANCDIAVHTKPWKDCTPLEKGFRGEVITFMDM
FT                   IKAGAEPLGRTLGLNPKGRSPVQAFKAWHGRTGIDGIYKVRSKVRDKHGNVVKDKDGKD
FT                   VEEVTYVIIESKATGGMKNGILDDIVAKLTKNDKERQMSDDWIMKNIKNMGLSAADQNA
FT                   ITASLQNPKKVKRIYAQTDAEGTTYHEIRGVDKAGNLDPTEARVSNVVFDPQSLKGT"
FT   sig_peptide     283518..283619
FT                   /locus_tag="Veis_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 34"
FT   gene            285244..286572
FT                   /locus_tag="Veis_0259"
FT   CDS_pept        285244..286572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppu:PP_4047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56050"
FT                   /db_xref="InterPro:IPR015025"
FT                   /db_xref="InterPro:IPR028983"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEJ3"
FT                   /protein_id="ABM56050.1"
FT                   /translation="MRDPDGKLETYKEEMELYIYVLDHISKDESLDAIVRWNNGSRVLP
FT                   YVIKCMLFRYGRGDPLTDIWSYFEKDGWPFYQRAVAIVKQLPPQSLDESQRRAFFGLLT
FT                   GEFAALEVHFFLALLICMDQSPERLMNHRNWLRVNPPRRFIDVMLKSFIPNHQGSSNYK
FT                   SSTEQKWWTSPLMNALAHPPEQRSAALAAHMDNWHRLMRPLGWKPNRDPALEKDGLFCY
FT                   FAFEVAMAVCAYDIDDSSFRDHPHYPRDLVDHYRQHIRHTRDAWRAEGLGAGIELPPPV
FT                   PPKRVDLAKSKRKNFARWVELACDGYDDAVESVLETTGKPRKIQDFFQLLEALQDAGHA
FT                   IHADGKDSDTLDSQAADLADARGIGPFEAPDSDPPQGGARCTAILRALHAWAAPRGYQL
FT                   IDLDDQDDAWHAVLVKAEYHDEFLALSQTLGLRTRKPQQAYLD"
FT   gene            286608..287939
FT                   /locus_tag="Veis_0260"
FT   CDS_pept        286608..287939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppu:PP_4047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56051"
FT                   /db_xref="InterPro:IPR015025"
FT                   /db_xref="InterPro:IPR028983"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEJ4"
FT                   /protein_id="ABM56051.1"
FT                   /translation="MMRDPDGKLETYEEDIRLQIYVLNHFSRNEHRDNTVRWNNSSGVL
FT                   PYVIEYMLFRYGRGDPLADIWSYFEKDGWPSYQRAVALVKQLPPQSLDEGQRRTPIGLA
FT                   TRESAALEVHFFLALLICMDQSPERLMNHRNWLRVNPPRRFIDVMLKSFIPNHQGSSNY
FT                   KSSTERKWWTSPLMNALAHPPEQRSAALADHMNNWHRLMRPLGWKPNRDPALEKDGLFC
FT                   DFAFEVAMAVCAYDIDDSSFRDHPHYPRDLVDHYRQHIRHTRDAWRAEGLGAGIELPPP
FT                   VPPKRVDLAKSKRKNFARWVELACDGYDDALESVLETTGKPRKIQDFFQLLEALQDAGH
FT                   AIHADGKDSDTLDSQAADLADARGIGPFEAPDSDPPQGGARCTAILRALHAWAAPRGYQ
FT                   LIDLDDQDDAWHAVLVKAEYHDEFLALSQTLGLRTRKPQQAYLD"
FT   gene            288027..289067
FT                   /locus_tag="Veis_0261"
FT   CDS_pept        288027..289067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lin:lin1649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56052"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEJ5"
FT                   /protein_id="ABM56052.1"
FT                   /translation="MIASLFNFFIKKIIRTEPPKQTRQPELMVFKYEGRNYAVVKSKAV
FT                   GGSTNGVPDDTVQKLTMDKDGVRQMSSEWIENNLRIMVNDGEISKEAMQEIMAGLQDGA
FT                   TKRIYAQTDANGTTYHVIEDVMKEGKPDPKDACVSNVAWKPGDFDKPRSGPPEVEPPTL
FT                   ALRRKQLVPRIKHVNFRKALQERGLPEEHLPATTPLCGELLVSYAFDLPEQFVMVSPRQ
FT                   LKQAGIAVSEMPALALDNLARSMPEPQQSRLNGCIAINTGGDLEATLLLLDAFWEQMQA
FT                   SLGGEIVAVVPRRNRLLLCAGNDAQALEQLDRQARVFFAEEQDAHALSLQKMVRRNGRW
FT                   QLFGAH"
FT   gene            289311..289916
FT                   /locus_tag="Veis_0262"
FT   CDS_pept        289311..289916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56053"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEJ6"
FT                   /protein_id="ABM56053.1"
FT                   /translation="MTPAAGSGRRRVVGATVLALLGAPVSAQAQTAAQNPRALREMQIH
FT                   RVAQLGLEIWVENQPAWETRLSTTPHGHPCFEAQSPDSYFPPAVLTYASWPKERVPQEQ
FT                   LLPIATTAIRQASQNFGWNPGQSRGLHPVAATHGVLQGFEADFPGQADGQPLDVKVFVG
FT                   QTPGRFPVVAWVYTQRKRMEQLREVLRRSWGKLKYLDA"
FT   sig_peptide     289311..289400
FT                   /locus_tag="Veis_0262"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 30"
FT   gene            complement(289973..291883)
FT                   /locus_tag="Veis_0263"
FT   CDS_pept        complement(289973..291883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0263"
FT                   /product="propionate--CoA ligase"
FT                   /note="TIGRFAM: propionate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: rfr:Rfer_2322 propionate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56054"
FT                   /db_xref="GOA:A1WEJ7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEJ7"
FT                   /protein_id="ABM56054.1"
FT                   /translation="MPRYADFYRQSIDDRDAFWSEQSRLIEWQTPPRQICDYSNPPFAQ
FT                   WFVGGRTNLCHNALDRHLARRARQPALVAISTETGTERSYSFAELHAEVQHMAAVLRCL
FT                   GVKKGDRVLIYLPMIAEAVFAMLACVRIGALHSVVFGGFASGSLAARIEDAEPVLVVSA
FT                   DAGSRAGKVVPYKPLLDAAIAQSKHKPAAVLMVDRGLAEMPLQPGRDHEWALLREQQLG
FT                   AVVPCEWVESTHPSYTLYTSGTTGRPKGVQRDTGGYTVALAASMKHIFSVADDGAAPAG
FT                   VFFTTSDIGWVVGHGYIIYGPLIAGMTTILYEGLPMRPDAGVWWSIVEKYRVTHMFSAP
FT                   TALRVLKKHDPQWFGKYSVKSLKALWLAGEPLDAPTAQWISDALQVPVIDNYWQTETGW
FT                   PILTLANGVEPQVSRFGSPGKAMYGYQIKLIDDTSGQELTSPGHKGVIAIEGPLPPGCM
FT                   QTLWRDDARFVDTYWKSLAGRLIYNTFDWGLRDADGYHFILGRTDDVINVAGHRLGTRE
FT                   IEECIAAHPQIAEVAVVGVADALKGQQAMAFAVARDSAALDSDAARLKLEGEVMKQVDS
FT                   QLGAVARPSRVHFVSALPKTRSGKLLRRTLQAIAEHRDPGDLSTMEDPAALQQVRELAG
FT                   R"
FT   gene            complement(292003..292632)
FT                   /locus_tag="Veis_0264"
FT   CDS_pept        complement(292003..292632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0264"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: rfr:Rfer_2323
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56055"
FT                   /db_xref="GOA:A1WEJ8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEJ8"
FT                   /protein_id="ABM56055.1"
FT                   /translation="MLLDATDSQLVLIDYQERLMPAIFDGPAVLANARRLAGIARMIDI
FT                   PVWGTEQNPARLGANDAALRAQCRKTLAKMRFSAAQEGLGDWLRPPAKPQGSAPGETRG
FT                   GNVRSLPRQLQKPAVAACAERASIVIAGCEAHVCLLQTALDLIDDDFELWVVTDACGSR
FT                   TERNRDAAFDRLAAAGAELVTTEMVAFEWLGSCAHPAFKPVLGLIK"
FT   gene            complement(292688..293959)
FT                   /locus_tag="Veis_0265"
FT   CDS_pept        complement(292688..293959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0265"
FT                   /product="cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes; KEGG: bam:Bamb_6437
FT                   cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56056"
FT                   /db_xref="GOA:A1WEJ9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEJ9"
FT                   /protein_id="ABM56056.1"
FT                   /translation="MALRPSTMTTANTPRFTTRIVHADRWGGAEQGAVHYPIHSSVQYG
FT                   HDKVEDLIAVFQGSAKGGFNYARQGTPTTAALERKITQMEHGHGSIVFATGMAAICAVF
FT                   LTLLKAGDHLVASQFVFGNTHSVFGTLSDLGISVTTVDVTDAANVAAALRPQTRMVFVE
FT                   TIANPGTQIPDLAGIGALCRQHGALYVVDNTIASPYLFRAATVGAGLVLNALTKSIGGQ
FT                   GDALGGAITDTGLYDWSGYPNIFAAYRKGDPQGWGLQQLRKKGLRDMGGTLSSQAAHQL
FT                   ALGAETLALRMEHSSASALALAQWLEQHPAVARVLYPMLPSHPQHAQALRHLKAGAWLL
FT                   SFELRDPGQCLALCNRLQLPIKATGLGDARTLIIPVAHTIFWEAGPAVRAAMGIADSMI
FT                   RLSVGLEEVQDLQDDFERALSGHG"
FT   gene            complement(293959..295404)
FT                   /locus_tag="Veis_0266"
FT   CDS_pept        complement(293959..295404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0266"
FT                   /product="Exodeoxyribonuclease I subunit C"
FT                   /EC_number="3.1.11.1"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   Exonuclease C-terminal domain protein; KEGG: pol:Bpro_2939
FT                   exodeoxyribonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56057"
FT                   /db_xref="GOA:A1WEK0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR013620"
FT                   /db_xref="InterPro:IPR023607"
FT                   /db_xref="InterPro:IPR034747"
FT                   /db_xref="InterPro:IPR034748"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038649"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEK0"
FT                   /protein_id="ABM56057.1"
FT                   /translation="MPAHTFLWHDYETFGTDTRCDRPAQFAAIRTDAELHAIGEPLMLH
FT                   CQPANDYLPDPASCLLTGITPQHCCAHGLPEHQFAARIEAELARPGTIGVGYNTLRFDD
FT                   EITRFMFWRNLIDPYAREWKNQCGRWDLLDVVRMTYALRPDGIHWPRHEDGAAPSFRLE
FT                   DLCRANGLLHEAAHDALSDVRATIALARLIRQHNRPLFDFALGLHKKDRVAAELRLSGG
FT                   AGTARPFLHVSGMFPAERGCLAVMWPLAGHPVNKNELIAWDLAHDPAALATLGVDEMRL
FT                   RMFTRTDALPEGVTRLPVKTIHLNRSPMVVGNVNTLTPALARRWGIDLAQAAQHAQAAR
FT                   ALPDMGRVWAAVFARPSEPAPDVDQDLYCGFVGDRDRRLLDDLRASAAGMNGKARVHFD
FT                   DPRLVELFWRYRARNFPATLAPEEAGRWQAHCAARLFHGAGGARTVGQFHARIDELSET
FT                   ADERGQGILGALYDYAEQIAPEH"
FT   gene            complement(295604..296617)
FT                   /locus_tag="Veis_0267"
FT   CDS_pept        complement(295604..296617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0267"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   reh:H16_A1674 probable extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56058"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEK1"
FT                   /protein_id="ABM56058.1"
FT                   /translation="MSVTRSLRCIGLAAATLAGSVALARTGATGVTGAAGADVAYPSRP
FT                   ITMVVPQAPGGGVDLLARLVMHRLASALGQPVVIENRAGAGGLIGTRYVARAASDGYTL
FT                   LLTSPSHNINAVLHQKAGYDALGDFTPVALLARGPFVLVAHPDFEAKSTAELIALARKN
FT                   PGGIAYGSVGAGSFNHLLGEMFNAAAQVKLQHVPYKGSAQAASAVVGGQIPLSFNSLPG
FT                   ALPFIRAGRLRALGVTTPGVSRLAPDIPPLSSVLPGYEGTTWYGILAPAGLPQPIVDRL
FT                   SGQIARLLQEPGMEQSMVQLGAQMSYANPQDFGDLLAAQTILWRQVIEAANVRPAD"
FT   sig_peptide     complement(296543..296617)
FT                   /locus_tag="Veis_0267"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.927 at
FT                   residue 25"
FT   gene            complement(296771..297967)
FT                   /locus_tag="Veis_0268"
FT   CDS_pept        complement(296771..297967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0268"
FT                   /product="acetylornithine deacetylase ArgE. Metallo
FT                   peptidase. MEROPS family M20A / acetylornithine
FT                   deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   bte:BTH_I2086 acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56059"
FT                   /db_xref="GOA:A1WEK2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEK2"
FT                   /protein_id="ABM56059.1"
FT                   /translation="MTDVLAPTGADIAAMPWIERLLAFDTTSRNSNLGLIETVRDHLRS
FT                   AGVEPVLTHHASGAKANLFATLPAHDGSSTGGIVLSGHTDVVPVDGQAWSSDPFRASLR
FT                   DGKLYARGACDMKGFIGTALSLLPAMQATRLAKPLHLALSFDEEVGCVGAPLMIIDLQA
FT                   RGVLPEGCIVGEPTGMRPVVAHKGINLYRCRVHGHAAHSALTPQGVNAIEYAARMICFI
FT                   RDLADKHRAEGPYDPHFEVPFTTAQTGMVSGGIANNVVPALCEFSFQVRNLPTVNADQI
FT                   IRQIQSHAQDVLLPRMRAEHPDAGIEFSRIAVAPALDDAQEGAITQLVRALTQDHDKRK
FT                   ASYGTEAGLFKAAGIPTVICGPGHIEQAHKADEFVALEQLRECESFLRRVIRSMAVAD"
FT   gene            complement(298313..299470)
FT                   /locus_tag="Veis_0269"
FT   CDS_pept        complement(298313..299470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0269"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG: bpe:BP3682
FT                   putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56060"
FT                   /db_xref="GOA:A1WEK3"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEK3"
FT                   /protein_id="ABM56060.1"
FT                   /translation="MTDMTDITHIARPPCHPGDGTSHLRRPVSILGAGHIGFAIALLLQ
FT                   QTGDYDILVADRDPMRLAKVAALGIATRQTAADADWSAVIDGRFAVLDALPFHCAIALA
FT                   SACAQAGVHYFDLTEDVPSTQAIRALAAGARSVLMPQCGLAPGFIGIVGNDLARRFERL
FT                   DSLRLRVGALPRYPQGALRYNLTWSTEGLINEYCNPCEAIVDGLRTTVAPLEGLENFVL
FT                   DGVEYEAFNTSGGLGTLTETLAGRARQVDYQSIRYPGHCAIVKLLLNDLRLRERRELLR
FT                   DILESAIPSTDQDVIVVCATACGLRGGRLAQHAYCARIFGTEVAGHALSAIELTTAAGI
FT                   CTALDLLAQGRLPHRGFVGQEAVALADFLANRFGMAYAGQGALAL"
FT   gene            299572..300081
FT                   /locus_tag="Veis_0270"
FT   CDS_pept        299572..300081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0270"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   pol:Bpro_2154 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56061"
FT                   /db_xref="GOA:A1WEK4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEK4"
FT                   /protein_id="ABM56061.1"
FT                   /translation="MLVVTASVMAVITFSSTTPMTAPLDDTDRQLLSLLQANAREGTAT
FT                   LARRLGLARTTVVARIARLERSGVVAGYGVRLGARLDAGTVRAWCSISVLPKTAPAVLR
FT                   ALQAMAEVEEVSAVSGPFDYLVFLRCASHEQLDALLDRVGQLDGVHQTQTSIVLSRKID
FT                   RRSVGA"
FT   sig_peptide     299572..299637
FT                   /locus_tag="Veis_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.919 at
FT                   residue 22"
FT   gene            300285..301367
FT                   /locus_tag="Veis_0271"
FT   CDS_pept        300285..301367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0271"
FT                   /product="TIM-barrel protein, yjbN family"
FT                   /note="TIGRFAM: TIM-barrel protein, yjbN family; PFAM:
FT                   dihydrouridine synthase, DuS; KEGG: pol:Bpro_2153
FT                   TIM-barrel protein, YjbN family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56062"
FT                   /db_xref="GOA:A1WEK5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEK5"
FT                   /protein_id="ABM56062.1"
FT                   /translation="MRCATDTNAPAAPPPTPDLLLPVPSSPSPWRLSVAPMMDWTDRHC
FT                   RYFHRLLTRQTRLYTEMVNAGAVLHGGTERHLRLNAEEHPVALQLGGNEPADLARAARL
FT                   GAQWGYDEINLNCGCPSDRVQRGAFGARLMQTPQRVADCVKAMRDMVDRPVTVKHRIGI
FT                   DQGQSYGFVRDFVGVVADAGCSVFIVHARNAWLQGLSPKENREIPPLRYALVHQLKADF
FT                   PRLTVVINGGIATDAVVQQQLHLLDGVMVGRQAYHQPWWLARWDALYYANRSGPCAGAS
FT                   PLTREAVERAMVAYMEREAALHGTPWPHIARHMLGLRHSLPGARLWRQLWSDHRLKDRP
FT                   AREVHALALRSYAARAGDSG"
FT   gene            301434..303047
FT                   /locus_tag="Veis_0272"
FT   CDS_pept        301434..303047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0272"
FT                   /product="polyhydroxyalkanoate depolymerase, intracellular"
FT                   /note="TIGRFAM: polyhydroxyalkanoate depolymerase,
FT                   intracellular; PFAM: PHB de-polymerase domain protein;
FT                   KEGG: pol:Bpro_2173 polyhydroxyalkanoate depolymerase,
FT                   intracellular"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56063"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEK6"
FT                   /protein_id="ABM56063.1"
FT                   /translation="MLYHLYETQRSLMEPFTDFAQAASKLLSNPGSPLSQTGTAQRMAA
FT                   AYDLLYRLGKDYEKPAFGIHTVDVDGVGLAIHERVEIDKPFCALRRFKRFSDDPATLTG
FT                   LKGQPVVLIVAPLSGHYASLLRDTVRTMLREHKVYITDWKNARMVPLSEGPFHLDDYVN
FT                   YMQEFIRHLQAKYGHCHVVSVCQPTVPVLAAVSLMASRGEQTPLTMTMMGGPIDARKSP
FT                   TAVNNLAINRSFEWFENNVIYRVPEKFPGAGRRVYPGFLQYTGFVAMNPDRHASSHYDY
FT                   FKNLVKGDDASAEAHRNFYDEYNAVLDMDADYYLETIQTVFQDYKLVHGTWDVRSPEDR
FT                   IERVRPQDITSTALFTVEGELDDISGSGQTEAAHGLCSGIAHQAQRHLEVKGAGHYGIF
FT                   SGRRWRDMVYPQVRDFILAHPSPPKNALAPAVAAATAAAEAPVAVPVTPASKAGSEPAQ
FT                   QTAQTVEAVPPATSAPRAAAKTPAAPAIATRWVSPEPASAVAAVAAVAAVAAESAGPGT
FT                   ARRAAKAAATPAPRSKARKA"
FT   gene            303044..303706
FT                   /locus_tag="Veis_0273"
FT   CDS_pept        303044..303706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0273"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   B subunit; PFAM: 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domain protein; Fe-S cluster domain protein; KEGG:
FT                   pol:Bpro_2170 electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56064"
FT                   /db_xref="GOA:A1WEK7"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEK7"
FT                   /protein_id="ABM56064.1"
FT                   /translation="MSQPPAADALADLAARIDAALPQTQCTRCGYPDCRAYAQAIAEGA
FT                   AAINQCPPGGAEGVARLAAITGQTALALNARHGSEGPRSVAFIDEDWCIGCTLCLKVCP
FT                   TDAIVGASKMMHTIIERYCTGCELCLPVCPVDCIALDTASGATTGWAAWSAAQAQQARQ
FT                   RYRRHRQRMPGEDPLAQRSAAAGSATEQADQAADQARQARIAAALERARQRRQAGPH"
FT   gene            303808..305037
FT                   /locus_tag="Veis_0274"
FT   CDS_pept        303808..305037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0274"
FT                   /product="succinyldiaminopimelate aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   pol:Bpro_1997 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56065"
FT                   /db_xref="GOA:A1WEK8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019878"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEK8"
FT                   /protein_id="ABM56065.1"
FT                   /translation="MNPLLSRLQPYPFERLRQLFAGVTPAAAYSPISLGMGEPRHPAPQ
FT                   LVKDALIGHLAGLGHYPATAGEPQLRAACAAWLQRRYGLALDPGSQLLPVNGSREALFA
FT                   FAQTVIDPSQGPPFVVCPNPFYQIYEGAALLAGARPYYACSDPARNFAVDWDAVPANVW
FT                   QRTQLLFLCSPGNPTGAVMPLAEWQKLLALSERHGFVIASDECYSEIYAHDPPPLGGLQ
FT                   AAAASGRGDFKNLIAFTSLSKRSNVPGLRSGFVAGDAALIKSFLLYRTYHGSAMGPSVQ
FT                   AASIAAWGDEQHVQENRARYREKFARVTPLLARVMQVALPDAGFYLWARVPDAFGLDDT
FT                   GFAQALLAQYNVTVLPGSYLARAVQGHNPGAGRVRMALVAETEECMQAAERIVQFARSH
FT                   ADRPPSSIST"
FT   gene            305034..305867
FT                   /locus_tag="Veis_0275"
FT   CDS_pept        305034..305867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0275"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="KEGG: rfr:Rfer_2046
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase; TIGRFAM:
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase; PFAM: transferase hexapeptide repeat
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56066"
FT                   /db_xref="GOA:A1WEK9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEK9"
FT                   /protein_id="ABM56066.1"
FT                   /translation="MSSSLQTIIDQAWEQRASLSAGAAPKETLDAVAQVLSELNNGRLR
FT                   VATRASVGQWTVHQWIKKAVLLSFRLSDNAVIEAGALRFYDKVQPKFSHLDEQGMKAAG
FT                   VRVVPPAVARHGSFIAKGAVLMPCYVNVGAHVGAGTMVDTWATVGSCAQIGAHVHLSGG
FT                   VGIGGVLEPLQAGPTIIEDNCFIGARSEVVEGVVVEENSVLGMGVYLGQSTPLFDRASG
FT                   QISYGRVPSGSVVVSGSLPKTAANGAPYGMYAAIIVKRVDAQTRSKTSINDLLRE"
FT   gene            305907..307073
FT                   /locus_tag="Veis_0276"
FT   CDS_pept        305907..307073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0276"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: pol:Bpro_1995 twitching
FT                   motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56067"
FT                   /db_xref="GOA:A1WEL0"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEL0"
FT                   /protein_id="ABM56067.1"
FT                   /translation="MGTMERILRLMNEKGASDVFLSANAPALLKINGECMPINNQILPT
FT                   DAPRNLLSEILPPNRIEELEETGELNMGLPLDGVGRFRISAMRQSGSYAVVIRFITQQV
FT                   PDFDSLNLPPVLRDLIMEKRGLILLAGASGSGKSTTLASMIDSRNTYLRGHILTIEDPV
FT                   EYRFHNKKSIINQREVGADTQSLQIALKNALRQAPDVILIGEIRDRETMTAAIAYAQSG
FT                   HLCLSTLHASNSYHALNRILSFYPVEVRPTMLGDLAFALRAIVSQRLLRTLDTRRVPAV
FT                   EVLLNTSLIADLVEKGDFFGVKEAMEKSIAEGSQTFEAALAKLVMAGKIERKEGLAHAD
FT                   SPANLMWRLQNDFSLADKAARAQIQAREHVPDDQPTFTEIVLDDSPDA"
FT   gene            307102..308307
FT                   /locus_tag="Veis_0277"
FT   CDS_pept        307102..308307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0277"
FT                   /product="succinyldiaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="TIGRFAM: succinyl-diaminopimelate desuccinylase;
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein;
FT                   KEGG: rfr:Rfer_2044 succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56068"
FT                   /db_xref="GOA:A1WEL1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WEL1"
FT                   /protein_id="ABM56068.1"
FT                   /translation="MTRTLHLAEQLIARPSITPDDAGCLDLLAARLAPLGFVCERMDSG
FT                   PARQRVSNLWAKRPVAQVPDAHDASKTAVKTIVFAGHTDVVPTGPLEQWSSNPFLPTRR
FT                   DGRLYGRGASDMKTSIAAFIVALEEFLAATPEPRIALALLLTSDEEGPSVDGTRVVVEQ
FT                   LKARGDSIDYCIVGEPTAVEKTGDMVKNGRRGTLSGRLLVRGIQGHIAYPQLARNPIHQ
FT                   ALPALAELAATEWDQGNEFFPPTSWQISNLHAGTGATNVIPGEMVLDFNFRFSTQSCAE
FT                   GLQRHVQQLLERHGLSYELHWTLGGQPFLTTPGELLQAVEQAISAETGLSAALSTTGGT
FT                   SDGRFIAHICPQVIELGPPNASVHKIDEHVLLTDIEALKNIYRRTLENLQAQALAAATM
FT                   PA"
FT   gene            308304..309260
FT                   /locus_tag="Veis_0278"
FT   CDS_pept        308304..309260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0278"
FT                   /product="modification methylase, HemK family"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: pol:Bpro_1993 modification methylase, HemK
FT                   family; TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56069"
FT                   /db_xref="GOA:A1WEL2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017127"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEL2"
FT                   /protein_id="ABM56069.1"
FT                   /translation="MRGRQAATAGAIIGKIAGGAIGEMVDGTIGAVVETGARQLAAAGL
FT                   SFGHGTTNAHDEAAWLVLWRLGLPLDSDLSALKNQPVTQAQLAQLAALFEERMHSRKPA
FT                   AYLTREAWLQGVAFYIDERAIVPRSLIAELLADGSVDEFLGAHTRQVLDLCTGNGSLAV
FT                   LAALAWPEVQVTGADISPEALAVARINVERHGLQQRIALQLSDGLSALPGPWDLILCNP
FT                   PYVNAASMAALPAEYRAEPRLALAGGADGMDFIRPLLRTAAACMSDNAVLVLEIGNERP
FT                   GFEAAFAQHPVHWLATSAGPDQVLLLTRQALALFFCS"
FT   gene            309260..311281
FT                   /locus_tag="Veis_0279"
FT   CDS_pept        309260..311281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0279"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_1992 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56070"
FT                   /db_xref="GOA:A1WEL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEL3"
FT                   /protein_id="ABM56070.1"
FT                   /translation="MITLKNLSLRRGSKLLLDQVCVSINPGESIGLVGRNGAGKSTLLA
FT                   LLTRQLHEDAGDLFIPPQWRMAQVEQTMPETAEPATDFVLRGDSRLTELRAALEKAQAD
FT                   GDGMAIAHAYGDLTDAGEHDARPRAQALILGLGFKLAELDQPVNSFSGGWRMRLQLARA
FT                   LMSPSDLLLLDEPTNHLDLDALVWLETWLKRYTGTLIVISHDREFLDAITEVTLHIDNA
FT                   RITRYGGNYSRFEELRTQQLELQQASWAKQQDRIAHLQKFIDRFKAKASKARQAQSRVK
FT                   ALERMEKIAPMLASADFSFGFKEPGQLPNPMLAIADAAFGYTGQDRTANTVLRHVNRSV
FT                   LAGQRIGILGANGQGKSTLVKTIARAMQPLAGQITEGKGLVIGYFAQQELDLLRPADDP
FT                   LAHMLRLAKDIGPGSREPAREQDLRNHLGRFNFSGDMVRQTVGTMSGGEKARLVLAMIV
FT                   WQRPNLLLLDEPTNHLDLATREALTMALNEFEGTVLLVSHDRALLRAVCDEFWLVGRGV
FT                   VAPFDGDLDDYQRYLLDEAKRLREQARLAPETSVRAEATAAPIAAPATRHTDPAVTRHT
FT                   AAAATQRKLDAQARQQLADKTRPLNQQLQQIDQRLALLSTERSALEQKLNQALPATEIA
FT                   ACGRRLKAANAETARLEERWLEISAALEEISGATVNGP"
FT   gene            complement(311539..312384)
FT                   /locus_tag="Veis_0280"
FT   CDS_pept        complement(311539..312384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cch:Cag_1772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56071"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEL4"
FT                   /protein_id="ABM56071.1"
FT                   /translation="MDHKESKIQHSCGSQRICRADYVGGGTDVDMLRALAERMGHPVAS
FT                   IWDERINTFYVQNNYPQQDTQAELERVQGGFGVAPREHFNGLRNLLPDLKGLAILDNDG
FT                   QNRQDRNEGALETRYWRRYEVENYFITPDLLRTYARNEYPSDDSLADETHSSIEEALAE
FT                   VITEQVFDGARNDYQAWTNSPPDAMRLVWEAKTERRKLSTVAEEFFRKLAARMGGAMLL
FT                   TKGELHRLVPLAPTAGLSSEITQKLDCLAVLFAVGQMRDETVTSGGADVGTLATDPGNG
FT                   "
FT   gene            312438..313925
FT                   /locus_tag="Veis_0281"
FT   CDS_pept        312438..313925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0281"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   xom:XOO_1836 ISXoo5 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56072"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE41"
FT                   /protein_id="ABM56072.1"
FT                   /translation="MPEPTDTADFFRSRLAEMIDLRHPLAVLASRLPWTQIEAALAPYF
FT                   ARRVRAGRVLEHDDLFGPSLQVAGAGVAAAGRPRLPLRLMASLLYLKHVYKLSDEELVE
FT                   RWAENVQWQFFSGMTFYEPRLPCDATQIGRFRSILGEAGVEELLKATIDTAVASKAIKP
FT                   AEFERVIVDTTVQEKAIAHPVDSRLLEIARAKVVAAAKRAGIALKQTFAKEGKNLRRRA
FT                   GGYAHAKQFKRLKKVLKRQRTVLGIVLREVQRKLCKLPATSVPAVDRLRALMGRAERIR
FT                   TQRPKDKNKLYALHAPEVECIGKGKARRPYEFGVKVSVAVTHKQGLVVGARSFTGNPYD
FT                   GHTLAEQLEQVKILTEDTGASPKQAVVDLGFRGVDAANPGIQIIHRGRFKSLTDAQRRW
FT                   LKRRQAVEPTIGHLKHDNGMDRCWLQGATGDALHAVLCAAGYNIRWLLRAIMRLGLKGL
FT                   LLRLIALLRTLIGVPHFFASNEITPSRAAARFAAIAK"
FT   gene            complement(313879..315015)
FT                   /locus_tag="Veis_0282"
FT   CDS_pept        complement(313879..315015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0282"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: mhu:Mhun_2627 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56073"
FT                   /db_xref="GOA:A1WEL6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEL6"
FT                   /protein_id="ABM56073.1"
FT                   /translation="MRLLHYLDIENFKRFGKRQRIELNHPAVLIGPNNCGKTSAIQALA
FT                   LWSQGVKTWYDARRDSSAKQRTATSLNRLNIVAVPVQRTRFFWHDTQVRKGTKDIALVI
FT                   TVGVEFEGKVVALPMRFRNQGDDLVYCTPDTSVIANMELMAHAASLKVELLYPMSGLDT
FT                   EEPILQPGRVDVLLGQGRTADVLRNLCLSVVQSSKEDWQRVTDLMKRLFNVVLEVPRGT
FT                   TRGSIGMGYRQPGVKEVLDISSAGRGFLQMLLVFAYLFSHKRSVLLVDEPDAHLEILRQ
FT                   KQVYVLLRDIASENQSQVVLVTHSEVILDEALDNNLTLLLEGRADDLAKKPDIHDSLKH
FT                   FGAEHYIKARERGYALYVVGPAKFISLSQRTARRRVMA"
FT   gene            complement(315385..316293)
FT                   /locus_tag="Veis_0283"
FT   CDS_pept        complement(315385..316293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_A2750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56074"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEL7"
FT                   /protein_id="ABM56074.1"
FT                   /translation="MRKHLQGVDHAVIAVADLDRAQADFEHLGFTLTPRGRHTKGSENH
FT                   CAMFPDDYFELLAVPVDHPATRYYSDFLRQGDGLAAVALKTDDAAAFHAEMNEAGIGCE
FT                   APVDFSRPVVLPEGVRDAAFRIAQVDVAETPGGRLFVCQHFTRDVVWRPQYLRHANGAI
FT                   GLQSISIASDQARFAAVCGAYERFFDLAGQRCANLPTCLMATGNTNTPIRILAPSALAA
FT                   TYPCARAPARRLPCFAALHFRVTAIGPTQQFFDQTGIAYTAQPDGSLAVDAPVSHGLII
FT                   VFTPGPAIETGHHANAIAGLR"
FT   gene            316524..317474
FT                   /locus_tag="Veis_0284"
FT   CDS_pept        316524..317474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0284"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bch:Bcen2424_3472
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56075"
FT                   /db_xref="GOA:A1WEL8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEL8"
FT                   /protein_id="ABM56075.1"
FT                   /translation="MSEPVYVGIDVAKRTFEVATTGQAQTFSLGNDEAGHAQLCQLLAP
FT                   LSPRLVLLEATGGYEQDLALALSAAGLRVSVINPRQARDFARCMGKLAKTDRIDAQALR
FT                   GFAALLDAQGHEPRMLADEQQRELTALVVRRRQLVAMLVAERQRLALAHPKAKPSILRI
FT                   MATIAEQLNDLDGQLKEHVLAHHADLAALLTSVKGVGPTTASTLLAQLPELGQLNRKQI
FT                   TSLVGLAPINRDSGTLRGQRHIFGGRADVRRVLFVAALVGTRFNPVLKAFYARLLAAGK
FT                   PKKVALVACMHKLLVILNAIARTKSPWRNELAEAV"
FT   gene            complement(317548..320586)
FT                   /locus_tag="Veis_0285"
FT   CDS_pept        complement(317548..320586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0285"
FT                   /product="Excinuclease ABC subunit A"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: rfr:Rfer_3774 excinuclease ABC,
FT                   A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56076"
FT                   /db_xref="GOA:A1WEL9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEL9"
FT                   /protein_id="ABM56076.1"
FT                   /translation="MRPADGVRPADGAYLGHALREQQISIRGARTHNLKNIDLDIPRNQ
FT                   LVVITGLSGSGKSSLAFDTLYAEGQRRYVESLSAYARQFLGRLDKPDVDLIEGLSPAIA
FT                   IEQKASSHNPRSTVGTVTEIHDYLRLLYARTGTPFCPDHGLPLAAQTVSQMVDAVLALP
FT                   EDTRLMVLAPLAREKKGEFTELLAQMQALGYVRLRVDGQIYEYDDLPALKKTEKHSIDV
FT                   VIDRLKVRSGIQQRLAESLEAALRVGGADGNGRVLALEMDSGREHLFSAQFACPLCNYA
FT                   LAELEPRLFSFNSPLGACPACDGIGQREEFDPARVVAFPALSLAGGAIRGWDRRNAYYF
FT                   ALLESLARHYGFDLQAPFESLPARVQQAVLHGSGQEQIAFDYILDNGPGKGETIVKEHA
FT                   FEGILPNMARRYRETDSTLVREDLARYRSTQPCPECHGLRLRREARHVKVGEGAQARAI
FT                   HDISHTTLSDAQAWFKALRLTGAKAEIADKVVREIATRLQFLNDVGLGYLSLDRSAETL
FT                   SGGEAQRIRLASQIGSGLTGVMYVLDEPSIGLHQRDNARLIATLQHLRDIGNSVIVVEH
FT                   DQDMMRAADQIIDMGPGAGVHGGRVVAQGSYDAICRHAESLTGRYLAGSLSIAVPGRRT
FT                   PWRPALALAPAPVVGKGRPRFPETAAGQRRAERMAGHHARQGAVQALRVIGASGNNLRQ
FT                   VSVDFPVGLLTCVTGVSGSGKSTLVNDTLYAAVARQIYRAHDEPAPHEEIVGIEYFDKV
FT                   INVDQSPIGRTPRSNPATYTGLFTPIRELMAEVNAARERGYGPGRFSFNVAGGRCEACQ
FT                   GDGVVKVEMHFLPDVYVPCDICNGQRYNRETLQVLWKGKNIAQILELTVEDAHAFFKDQ
FT                   PAIARKLQTLLDVGLSYIRLGQAATTLSGGEAQRVKLAQELSKRDTGRTLYILDEPTTG
FT                   LHFADIALLLKVLHQLRDAGNTIVIIEHNLDVIKTADWLIDMGPEGGAGGGTVVGVGRP
FT                   EDLAANPASHTGQHLAQCLRAAP"
FT   gene            complement(320729..321544)
FT                   /locus_tag="Veis_0286"
FT   CDS_pept        complement(320729..321544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0286"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bxe:Bxe_A2733 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56077"
FT                   /db_xref="GOA:A1WEM0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEM0"
FT                   /protein_id="ABM56077.1"
FT                   /translation="MSIGAASKRIVDLESAVGVPLLERHSRGVKLTLAGRALQQHAQRI
FT                   LGDIEQMGADLSDYARGIIGVVRLWANTSATTQFLPPDLARFVQANNGIRIELEERNSS
FT                   EIVHAVLDGRADIGIFADRTPLLGIQTLNYRHDRLVLVLPKRHPLAGRRAIDFEQALEF
FT                   EFVSLSADTSLAQRLQGVAETLGRRMRLRIRVRSFDAMCQMVAAGLGVAVLPATAVQPY
FT                   LQSMGLEQVAIQGDWVHRQLLIGAKDFNAVARPVRVLVEHLLASPPAPG"
FT   gene            complement(321699..323342)
FT                   /locus_tag="Veis_0287"
FT   CDS_pept        complement(321699..323342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0287"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: bja:bll6695 GMC type oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56078"
FT                   /db_xref="GOA:A1WEM1"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEM1"
FT                   /protein_id="ABM56078.1"
FT                   /translation="MSAPPHDTPPPGAERFDYVIVGAGAAGAILANRLCADGKTTVCLL
FT                   EAGPPDWHPFLHIPAGFIKMLFNPGFTWPFQTEATAWTNGRRIPVPQGRTLGGSSAING
FT                   LVYNRGLAADYDHWASLGNTGWSYAEVLPYFKRTERRAGGDDAYRGRSGELPVTDNDWT
FT                   HRLCEAFIEGAVSLGIPRNADYNGATQAGVGYFQRTIDRGWRMSSASAFLRPVRGRANL
FT                   VIRTLAQATRILVEQQRSRGVEYIVKGQAGAPGRVDANREVIVCCGAINTPKLLQLSGI
FT                   GNAQHLQALGIPVVQHLPGVGENLSDHYSVRLVARVRGIRTMNEYATGPALALQIARWA
FT                   LKRPSIMALTPSLVHYFWTSRAGLHAPDLQGVFAPASYREGYVGMLDKFPGITAGVWQH
FT                   RPQSRGHVRLQSRDARADPLIQPNYLEHENDRLVLVDGIRLARRLLQTGALKPYVDSET
FT                   LPGPWLTSDDELLDFAKRYGVSSYHLNGTARMGPRSNPMAVVDPQLRVHGVARLRVADS
FT                   AVMPTIPSANICAATMMIGEYAADLLRRPN"
FT   gene            complement(323364..324089)
FT                   /locus_tag="Veis_0288"
FT   CDS_pept        complement(323364..324089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0288"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bte:BTH_II1835 ABC transporter domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56079"
FT                   /db_xref="GOA:A1WEM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEM2"
FT                   /protein_id="ABM56079.1"
FT                   /translation="MKSGPLLQLERVSVRYGAIEALREVSIEVGAGEIVTIIGANGAGK
FT                   SSLLKSIAGLEPIASGRILIDGRDIGAIPAHKRLQCGVTLAPEGRGIFPDQSVLDNLLL
FT                   GAYSLQATAAEINALVGHGFELFPRLAQRQAQWAGTLSGGEQQMLALARALMSKPRLLL
FT                   LDEPSLGLAPLVIRDILRSIRVLRDAGLTILLVEQMAHQALALADRGYVLETGRITLEG
FT                   SGSALLANPGIRAFYLGAH"
FT   gene            complement(324086..325924)
FT                   /locus_tag="Veis_0289"
FT   CDS_pept        complement(324086..325924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0289"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: inner-membrane translocator; ABC transporter
FT                   related; SMART: AAA ATPase; KEGG: bxe:Bxe_A3708 ABC
FT                   branched chain amino acid family transporter, fused ATPase
FT                   and inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56080"
FT                   /db_xref="GOA:A1WEM3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEM3"
FT                   /protein_id="ABM56080.1"
FT                   /translation="MSRARRPVPSAPAAGAPAAPPRLGGRHTLAVTGIALVAAAAASMA
FT                   GNDYHLRVLFMVTVHLMCALGMNVLVGYAGQKSLGQAGLFAAGAYTAALLTARHGWSPW
FT                   LALLAAGVVAGLCGALIALASLRAKGPYLAMVTLAFGTMIEKLVSEWDELFGGAAGIFG
FT                   IGPLAFGGRPLTHLQWVWFGIALCALTHLLLHNLLQGRIGRALLSLQADEIAAGSVGIG
FT                   VYRSKVLAFVIAAVTCGIAGAMVAQQNQYINSDFISFNLSIFILLLVLFGGAGSTLGPL
FT                   LGALLLTLVDAFLAQWPSAQHFVYGALLLFALYLMPQGMAGILARFRPRRPRRPQTVAP
FT                   TDMPAGMPAPRCGDAGPLLTVSRVCKAYGGVQPAQDLSLELRHGHIYALIGPNGAGKST
FT                   MLNMLTGVVTPDKGTITFCGQAIAGAQGHAICALGIGRTFQNLRLFGALSVLDNVMTGR
FT                   HSRMTNGFCASLLGLPGARRQEQTARARALAILQFVGLAAQAGLPAGSLPYGLQRRVEL
FT                   ARAIAGEPALLLLDEPAAGLNPQETVELGKLLVKVRALGITLLMVEHHMDLVMSISDHV
FT                   IVLDYGVKIAEGRPHDIQRNPRVIEAYLGTEEESAA"
FT   gene            complement(325989..326909)
FT                   /locus_tag="Veis_0290"
FT   CDS_pept        complement(325989..326909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0290"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: gsu:GSU1733
FT                   branched-chain amino acid ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56081"
FT                   /db_xref="GOA:A1WEM4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEM4"
FT                   /protein_id="ABM56081.1"
FT                   /translation="MMQALLQALVSGLASGGAYALVALGLGITFTTTKTLNFAHGDFVS
FT                   AGSFIGLSVMLLLTGAPLGAGMDALAVDGMAQLVALALAVLAMGLLGSVLYLTAVRPFA
FT                   GKPGMAWVMSTIGFGIIVQSIGLALWGPAPLKVPAPFGEEVIRIAGVGLRSQEILIIVT
FT                   ALAVMALFDFVLQRTMIGKALRAVAHDRRVASLMGIDVAAIMLGAFFVSAGLAGLCGYL
FT                   LAPIASASLFMGLGIALKGFCGAILGGLTNPRGCVLGGFVLGLLESLINLWQAQWREIV
FT                   LFALVILVLALRPNGLFGRAVTEKV"
FT   sig_peptide     complement(326847..326909)
FT                   /locus_tag="Veis_0290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.951 at
FT                   residue 21"
FT   gene            complement(326949..328154)
FT                   /locus_tag="Veis_0291"
FT   CDS_pept        complement(326949..328154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0291"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_A3706 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56082"
FT                   /db_xref="GOA:A1WEM5"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEM5"
FT                   /protein_id="ABM56082.1"
FT                   /translation="MLSTFVRRCRGLVPAFAAATFAAATPGLAQDIKIGYISDMSASGA
FT                   AEFGLGALWGAQQAAQDINAAGGVLGRPLAIVARDDMAQPPKAIQGVTELLDSEKVVAL
FT                   IGSANSGNVLAWLHLPQQKKIPVISPIATATDITKRFESSGENYIFRVSMVDRDQIALL
FT                   VAYAVKATKNKKIAFLADSTGYGQQGMKDLLAVLKLHALDPVAQEKFGGKDTDMTSQLS
FT                   KIKAAGADTLIIYGLADANAYVLRSMEKVNYFPVTLGAWGNINTPLLQLAGPALAAKLI
FT                   FTASSTATSTPKAAALNARLLDKHPKMTAFVTAAQAYDAVLLLATAMKAAGSTQGPQVQ
FT                   QALENLPQVEGIVKTYDKPFGKTNHEALSVADFHLAQWQAGRVVCYDDAITRTITPENL
FT                   KQ"
FT   sig_peptide     complement(328065..328154)
FT                   /locus_tag="Veis_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 30"
FT   gene            328385..329335
FT                   /locus_tag="Veis_0292"
FT   CDS_pept        328385..329335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0292"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bch:Bcen2424_3472
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56083"
FT                   /db_xref="GOA:A1WEL8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEL8"
FT                   /protein_id="ABM56083.1"
FT                   /translation="MSEPVYVGIDVAKRTFEVATTGQAQTFSLGNDEAGHAQLCQLLAP
FT                   LSPRLVLLEATGGYEQDLALALSAAGLRVSVINPRQARDFARCMGKLAKTDRIDAQALR
FT                   GFAALLDAQGHEPRMLADEQQRELTALVVRRRQLVAMLVAERQRLALAHPKAKPSILRI
FT                   MATIAEQLNDLDGQLKEHVLAHHADLAALLTSVKGVGPTTASTLLAQLPELGQLNRKQI
FT                   TSLVGLAPINRDSGTLRGQRHIFGGRADVRRVLFVAALVGTRFNPVLKAFYARLLAAGK
FT                   PKKVALVACMHKLLVILNAIARTKSPWRNELAEAV"
FT   gene            complement(329415..330413)
FT                   /locus_tag="Veis_0293"
FT   CDS_pept        complement(329415..330413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0293"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   bxe:Bxe_A2729 putative hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56084"
FT                   /db_xref="GOA:A1WEM7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEM7"
FT                   /protein_id="ABM56084.1"
FT                   /translation="MNTAGGVWQGGGRRIALHEVGMRDGLQAETAFVPTDEKIALIDAL
FT                   ADAGMRKIEATAFVSPQAIPALRDASAVLRAIGRRPGVIYSALVPNAGGAERAIDAGAD
FT                   ELNLVMSASESHNLANLKMTRAQSFEALSGVSRIARQARVRVNISLSCSFGCPMEGDMS
FT                   EATVLDGCARFIEQFGAQGVTLCDTTGMAYPGQVFALTCALRARWPGTELTLHFHDTRG
FT                   MGLANVMAAIDAGATHFDVSLGGLGGCPYAPGASGNVCSEGIAHALECMGYDTGIDLAL
FT                   LIAAAQRLPALVGHAIPSQIVQAGRRLDVHPPPSDLDAIRAHAHARPRPRA"
FT   gene            complement(330410..331630)
FT                   /locus_tag="Veis_0294"
FT   CDS_pept        complement(330410..331630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0294"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bxe:Bxe_A2730 predicted acyl-CoA
FT                   transferases/carnitine dehydratase, CaiB/BaiF family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56085"
FT                   /db_xref="GOA:A1WEM8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEM8"
FT                   /protein_id="ABM56085.1"
FT                   /translation="MPLNQPTRTLAANALSGLKVVEMGQLIAGPFAGKTLGEFGAEVIK
FT                   IEAPDCGDPLRNWRMLKDGTSVWWQVQSRNKRSIALDLRVPEGQDIARRLIARADVLIE
FT                   NFRPGTLEGWGMGYDTLAPLNPRLVMLRISGYGQTGPYRDRPGFGAIGEAMGGLRHLTG
FT                   EPGRMPVRCGISIGDTLAALHGTIGVLTALYHCKVHGGPGQVIDVALNEAVFNVMESLL
FT                   PEYSAFGAVREAAGSALPGIAPSNAYRCTDGYALVAGNGDSIFKRLMQCIGRPDLGNDP
FT                   ALASNAGRIERVAEIDMAIAAWSASRSVDEVLDRLARAGVPAGRVYTAKDIAEDPHYRA
FT                   REMILQQTTRAGYPLDVPGIVPKLLGTPGSVRSAAPGLGDDTDAVLGEIGLTARDIAAL
FT                   RDKKVVA"
FT   gene            331954..333144
FT                   /locus_tag="Veis_0295"
FT   CDS_pept        331954..333144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0295"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rfr:Rfer_3773 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56086"
FT                   /db_xref="GOA:A1WEM9"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEM9"
FT                   /protein_id="ABM56086.1"
FT                   /translation="MTALERRSSLSLALIFALRMLGLFLVLPVFALEAHKYPGGDNPAL
FT                   VGLAMGIYGLTQALLQLPLGMASDRFGRKRVILPGLLVFAAGSLLAAQADSLTGLLLGR
FT                   ALQGAGAVSAAVTALLADQTRDAVRTKAMAWVGGSIGLMFALALVAAPALAAHIGLSGL
FT                   FGLSCALALAGVAVLLWWVPPEPGRQGQALRGRMAAGLAEVWTHPDLLRLNLGVFVLHT
FT                   VQLSMWVAVPALLVQAGLGKEQHWRLYLPAVVLSFAALGGLFALERAGRLRAALLGAIA
FT                   LVLLVQAGLGALAVSGATPTLWLLGPLMWVFFCGFNALEASQPSLVSRMAPAHLRGAAL
FT                   GSYNTLQSLGLFAGGALGGALVKWSGTPGLFAVTSALTALWLVLTWPLRPVGRNGH"
FT   sig_peptide     331954..332049
FT                   /locus_tag="Veis_0295"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.968 at
FT                   residue 32"
FT   gene            333558..334079
FT                   /locus_tag="Veis_0296"
FT   CDS_pept        333558..334079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0296"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: pol:Bpro_4565 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56087"
FT                   /db_xref="GOA:A1WEN0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEN0"
FT                   /protein_id="ABM56087.1"
FT                   /translation="MASVNKVIIVGNLGRDPEMRTFPSGGQIANVTVATTDKWKDKQTG
FT                   EMKEATEWHRVVFRDRLAEIASQYLRKGSQVYLEGSLRTRKWTDQSGVEKFSTEIHAHT
FT                   MQMLGSRQGMSGPQGGHDDGGGYDSGGYEQAPRQAAAPARPAAPAAAAPAAPGPRAASG
FT                   FDDMDDDIPF"
FT   gene            complement(334157..335269)
FT                   /locus_tag="Veis_0297"
FT   CDS_pept        complement(334157..335269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0297"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="PFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   KEGG: pol:Bpro_4559 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56088"
FT                   /db_xref="GOA:A1WEN1"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WEN1"
FT                   /protein_id="ABM56088.1"
FT                   /translation="MTASPKQRVVVGLSGGVDSAVTAYLLRQQGHEVVGIFMKNWEDDD
FT                   DGGYCPSGTDFVDAAAVADVIGIEIEHVNFAADYKERVFAEFLREYQAGRTPNPDVLCN
FT                   AEIKFKAFLDHALRLGAEKIATGHYAGVRRNPASGRFELLKGADPAKDQSYFLHRLDQR
FT                   QLSRTLFPLGALRKTEVRRLAEDIGLPNARKKDSTGICFIGERPFREFLNRYIGPAPGP
FT                   IEDDRGRVLGQHSGLSFYTLGQRQGLGIGGLKEQGAQRGGGAHAPWFVARKELATNTLR
FT                   VVQGHDHPWLLSRALEAQDARWICGAAPAPGRYAAKTRYRQQDASCTMASAGQAGFRLH
FT                   FSEEQWAVTPGQSAVLYDGNVCLGGGVIAG"
FT   gene            complement(335266..336207)
FT                   /locus_tag="Veis_0298"
FT   CDS_pept        complement(335266..336207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0298"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: reh:H16_A2421 transcriptional
FT                   regulator, LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56089"
FT                   /db_xref="GOA:A1WEN2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEN2"
FT                   /protein_id="ABM56089.1"
FT                   /translation="MPHKFDLADIQAFAAVAELQSFRAAAESIHLSQPAFSRRIDKLEQ
FT                   ALGVRLLDRSTRRVTLTAVGRDFARKTRLWLDELDGMLMGLGDVAARRMGEVTIACVPS
FT                   AVYYFLPQVVKRYHERFPKIRVKVHDASANEVLVAVAQGEADFGLNFIGSQEAEIEFKP
FT                   VLVERFVAACRRDHVLARRKKVTWADLGQHDYMSVGKTSGNRLLMDLALANVPDRPQCL
FT                   YEAKHVTTLLGLVEAGLGVAAVPGLAMPGREHPTLVSIALVEPVVTRQMGLIKRRGRSL
FT                   SPAAQQLYELLAATRSARLRNGPARQKIQSAR"
FT   gene            336546..337673
FT                   /locus_tag="Veis_0299"
FT   CDS_pept        336546..337673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0299"
FT                   /product="protein of unknown function DUF453"
FT                   /note="PFAM: protein of unknown function DUF453; KEGG:
FT                   reh:H16_A2419 two domain protein: PF04304 and PF03401"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56090"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEN3"
FT                   /protein_id="ABM56090.1"
FT                   /translation="MSYHLPCVLMRGGTSRGPFFLADWLPQDPLQRDRTLIAALGSPHE
FT                   LQIDGLGGGHSLTSKVAIVSRSVHAGCDVDYLFAQVSVGEARVDTRPNCGNMLAGVGPF
FT                   AIEQGLVHAGRQADVTQVRVYNLNTGARIDLQVQTRDGRVRYEGDMRIDGVQGTAAPVL
FT                   MSFRDAWGAVTGQLFPTGQRIDTIAGLQVTCIDAAQVMVLVPAAALGLRGDESAAELDA
FT                   DTALLARLQALRCQAGLRMGLGGIPDSVLPKPVLVAPGPAPGSIVSRYFTPWRCHRSHA
FT                   VTGAIGVAAALLLPGTVATDARTPASAGTHRVQVLHPAGRTPVDVQLALVDGHCTLVQA
FT                   ALVRTARKIFEGTLFVAQSAMEPGCPGPWPADDRP"
FT   gene            337707..338720
FT                   /locus_tag="Veis_0300"
FT   CDS_pept        337707..338720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0300"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_4553 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56091"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEN4"
FT                   /protein_id="ABM56091.1"
FT                   /translation="MPPPNPNPNPSTRQRPARRRALCLALLAGALALPAGAQAAFPERP
FT                   ITLVVPTAAGGGNDGMARVVAQKMSALLGRTVIVENKAGANGAIAAEYVARAAPDGHTI
FT                   LFGYIATHGMNPALQKLRYDPITQFEPIGMVCYSPTLMVINPRVPATTVAEFVALTRAN
FT                   PGAYNYASAGNGTAPHFSAEMFKLESGAQMAHVPYRGSAPALNDTMANQTQVMFPSLFA
FT                   SSAHVKSGKLRALALAGPKRSPLLPGVPTLQEAGVEGVEITQWYALFAPAKTPRAVIGQ
FT                   LNSALNQALADKQVAQRIEAQGAVVDSSTPEALALTVRQEIAKWRGVVHRAQLSAD"
FT   sig_peptide     337707..337826
FT                   /locus_tag="Veis_0300"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.857 at
FT                   residue 40"
FT   gene            338790..339851
FT                   /locus_tag="Veis_0301"
FT   CDS_pept        338790..339851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0301"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG: pol:Bpro_4558
FT                   porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56092"
FT                   /db_xref="GOA:A1WEN5"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEN5"
FT                   /protein_id="ABM56092.1"
FT                   /translation="MKKTAALCALLASAPVIAQTSSLTLYGIVDLGLHCSRGITSAHAP
FT                   ATGSQTSLGSGIHTTSRWGLRGSEVLSGDTRVLFNLESGVRVDSGAPGMASKSFDRASW
FT                   VGLQGGWGSVQIGRQTSLLADAIAPVDPLGLRFGGANVNAGVVALSRHGLGADFGNAGS
FT                   NSSSYRLDNAFKYIGQFGGFTARAMLGLGEVAGQASALSSRGLGLAYAANGWTVSGAFQ
FT                   TFKDADRRSLNGSTLGLAYQWNSLRLAANAGRNEAQTAAGTHTGQRVLSSGVIWTAQPA
FT                   LNLGLTYYHAGRSRTGAHKDGYGRWVTFAEYKLSRRTQLYAELDSTRWRDGYQGAANPA
FT                   TATGIAAGVVHRF"
FT   sig_peptide     338790..338846
FT                   /locus_tag="Veis_0301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.944 at
FT                   residue 19"
FT   gene            340179..341384
FT                   /locus_tag="Veis_0302"
FT   CDS_pept        340179..341384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0302"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: rfr:Rfer_1034 beta-ketoadipyl CoA thiolase;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; beta-ketoadipyl CoA
FT                   thiolase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56093"
FT                   /db_xref="GOA:A1WEN6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEN6"
FT                   /protein_id="ABM56093.1"
FT                   /translation="MTTQAYICDAIRTPFGRYGGALSSVRTDDLGAIPIRALMERNPGV
FT                   DWAALSDVLYGCANQAGEDNRNVAHMSSLLAGLPVAVPGATINRLCGSGLDAVGTAARA
FT                   IKAGEADLLIAGGVESMSRAPFVMPKAESAFSRSNMVYDTTIGWRFVNRLMKDQYGVDS
FT                   MPETAENVAADFGIERQAQDRMALASQRNAVAAQQAGHLAREICPVTIAQKKGEAIVVR
FT                   QDEHPRETSLDALAKLRGVVRPDGTVTAGNASGVNDGACALLLANEASAAQYGLKPRAR
FT                   VVGMAVAGVAPRIMGFGPTPATLKVLAQTGLSLEQIDVIELNEAFAAQGLAVLRALGIR
FT                   DDDARVNAWGGAIALGHPLGASGARLATTAVNRLHKHAGRYALCTMCIGVGQGIAVVLE
FT                   RV"
FT   gene            complement(341513..343210)
FT                   /locus_tag="Veis_0303"
FT   CDS_pept        complement(341513..343210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0303"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   KEGG: rfr:Rfer_0733 threonine dehydratase, biosynthetic"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56094"
FT                   /db_xref="GOA:A1WEN7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEN7"
FT                   /protein_id="ABM56094.1"
FT                   /translation="MTAHLTPDDYLKKILTARVYDVALESALEPAHNLSRRLHNRVLFK
FT                   REDQQPVFSFKLRGAYNKMAQLAPEQLQRGVICASAGNHAQGVAMSARKLGARALVVMP
FT                   TTTPQLKIDAVKMLGGEVVLSGDSYSDAYGHSLQLEQELGLTFIHPFDDPDVIAGQGTI
FT                   AMELLRQLQSLGSDRLDAVFVAIGGGGLISGVANCIKALRPEIKIIGVQMNDSDAMIQS
FT                   VKAQQRVTLADVGLFSDGTAVKCVGRENLRIAQGLVDGFISVDTDAVCAAIKDVFLDTR
FT                   SIVEPAGALAVAAIKQYVATHQTRGETYAAILSGANMNFDRLRFVAERAEVGEEREALL
FT                   AVTIPEDRGSFRRFCELVGGLPGGPRNVTEFNYRISDAQLAHVFVGLTTQGRGESEEIA
FT                   RNFSQHGFETLDLTHDELAKEHLRHLVGGHSALAQDERLLRFTFPERPGALLKFLSLMQ
FT                   PTWNISLFHYRNQGADYGRTLVGMQVPSEDSATFDAFLVTLGYPWVEETHNPAYRLFLC
FT                   PKRGPARGQAIVVDEPMIEWPDGPIGPDGPEHGAHDPLVPAAAGKRSA"
FT   gene            343477..349494
FT                   /locus_tag="Veis_0304"
FT   CDS_pept        343477..349494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0304"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="KEGG: rfr:Rfer_3814 excinuclease ABC, A subunit;
FT                   TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56095"
FT                   /db_xref="GOA:A1WEN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEN8"
FT                   /protein_id="ABM56095.1"
FT                   /translation="MTQGLIRIRGARQHNLKNLDLDIRTGELTVVTGPSGSGKSSLVFD
FT                   TLYAEGQRRYVETFSAYARQFLERMDRPAVDKVEGVPPAIAIDQTNPVRSSRSTVGTMT
FT                   ELNDHLKLLFARAGQLFDRQTAQWVRHDSPETIYAALRRRCGFGAEPGEPTEPGVPDER
FT                   PGQPPADPRIALTFPVQLPADTSAEQLAQWLSASGFTQVQAERVLAPQAGAAPVKVLDV
FT                   VADRLRLGQAGKARVIEAIEVALKRGNGRLDVYRLDDEGTGTGTGTGTGTGTGTGTGVG
FT                   VGTGVGVGTGAPEPWRFSDGLHCPDSDLRYRDPIASMFSFNSAVGACDSCRGFGRVIGV
FT                   DYALVIPNDRLTLRAGAIKPLQTPAWQEAQDDLMRHAETAGIPRDTPWYRLTGEQQKWV
FT                   IGGAPGYKAGQWSTQWYGVGRFFEYLESKAYKMHIRVLLSKYRSYTPCPACAGARLKTE
FT                   SLQWRIGSRQDADAVIEPARRFMPQGLSWSRAQLESLPGLCLHDLMLLPIDRLRRFFAG
FT                   MQLPQGDAAKGGDAQALRLLHQEITTRLQYLCDVGIGYLTLDRQSRTLSGGEVQRINLT
FT                   TALGTSLVNTLFVLDEPSIGLHPRDMHRITEAMLRLRDAGNTLVVVEHDPAVMLAADRI
FT                   IDMGPGPGRLGGQIVFDGSTADLRTADTLTGAYLGGHKQVGLHFKRLVTDATPRLILEG
FT                   ARAHNLHNLSVEFPLQRLVTITGVSGSGKSSLIQNVLAPALLRHFGRATDSPMAHTRLL
FT                   GAEQLADVVFVDQAPIGKTARSNPVSYVGAWDSIRALYALTPLACQRSYSASKFSFNHG
FT                   DGRCPACGGSGFEHVEMQFLSDVYLRCPDCDGQRYRPEILEIRLERGGRALSVADVLAL
FT                   TVAEAAALFATDPGVLRALQPLVDVGLAYLALGQPVPTLSGGEAQRLKLAGYLAEAART
FT                   GASSRQALARKGSLFLFDEPTTGLHFDDIAKLMRALRKLIDAGHSLIIIEHNLDVIRAS
FT                   DWLIDLGPEGGDAGGLIVAEGRPEDLRQHPRSHTGQALRDYEQALGEGGHSVHEKAAAL
FT                   RKTERTAREKHAPAAQNVIRIVNAKEHNLKNLSVDIPRGKFSVVTGVSGSGKSTLAFDI
FT                   LFNEGQRRYLESLNAYARSIVQPAGRPEVDAVYGIPPTVAIEQRLSRGGRKSTVGTTTE
FT                   VWHFLRLLYVKLGTQHCVHDGAAVQPQTPESIAAQLLTRFRGQHIGLLSPLVTNRKGVY
FT                   TELADWARPRGYSHLRVDGQFLPTTGFPRLDRFKEHSIELPVASLDIAPANEALLRQAL
FT                   AEALTHGKGVVHVLSHIDALRAALTAGSPTTGIGQVQVFSTRRACPVCARSYAELDPRL
FT                   FSYNSKHGWCPDCVGTGLRLTQDQRLRLDGSLAQDKEKGREQSFAEPELADLADGAGSA
FT                   CPSCQGTRLNPGARAVKFAGLGITDIAAHTVTDLRRWIEALRTGGGMSQRETGIARDLL
FT                   PEIGSRLEFLEEVGLGYLTLDRAAPTLSGGEAQRIRLAAQLGSNLQGVCYVLDEPTIGL
FT                   HARDNQILLDALHKLGDKGNTLVVVEHDEGTIRRADHIIDIGPSAGKRGGRLVAQGSVG
FT                   DITAAADSQTGRYLLHAITHPLQTRRSVAPEAPAETQANAQAGTQTKAPAGAQAKAQAN
FT                   AQAGAQANAQAGSAVRWLTVHGAQLHNLQNLSVAVPLRRLVAVTGVSGSGKSTLARDVL
FT                   LTNVQAWVQQRASRAGRDAMDAGKAPPLVGCTGLSGFESIDRVLEVDQTPIGKTPRSCP
FT                   ATYIGFWDSIRKLYAQTLEAKARGYAAGRFSFNTGAGRCPGCEGAGVRTIEMSFLPDVK
FT                   VRCETCHGARFNPETLAVGWRGKSIGEVLQMEVDEAVDFFASMPGIAHPLQLLQDMGLG
FT                   YLTLGQPSPTLSGGEAQRIKLVTELSKVRDDIARRGQKAPHTLYVLDEPTVGLHMADVD
FT                   KLIRVLHRLVDAGHSVVVIEHDLDMIAEADWIIDLGPEGGQQGGRIVAATVPQELVRQR
FT                   SHTGRALAAVLAR"
FT   gene            complement(349561..350520)
FT                   /locus_tag="Veis_0305"
FT   CDS_pept        complement(349561..350520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0305"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: NHL repeat containing protein;
FT                   SMP-30/Gluconolaconase/LRE domain protein; KEGG:
FT                   rha:RHA1_ro06693 5-valerolactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56096"
FT                   /db_xref="GOA:A1WEN9"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEN9"
FT                   /protein_id="ABM56096.1"
FT                   /translation="MNDSAIPGSFSILISGLSFLESPRWRAGRLWLSDFYTHQVIACDM
FT                   AGRVEKIAELPHQPSGLGWLPDGRLLVVSMRDRKLMRREADGRLLVHADLSALAGGHAN
FT                   DMAVDRHGNAYVGNFGFDLMGGGPVRSAQLARVAPDGQVVAVAYDLRFPNGIVITPDGQ
FT                   TLIVAETLGNRLSAFAIADDGSLGARADWAKFGPLPEGSDLPAVKEQIEVAPDGVALDD
FT                   AGAVWLADAIGHRVLRVARGGRVLQEVSTGRAMRAYACALGGPDGRTLFLCVAPDPDEQ
FT                   ARKAAREAAVWYLPVNVPAAGWAATGAPAQAMAAGGAG"
FT   gene            350543..351115
FT                   /locus_tag="Veis_0306"
FT   CDS_pept        350543..351115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56097"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEP0"
FT                   /protein_id="ABM56097.1"
FT                   /translation="MLALPSPAWRSNEWGAGADKHLFTYGSRHLLSSHGQHLHRRHGLV
FT                   DDSLRSPMAGAKPGRPCCVGLAAGLNGRSPAPPGIGATAACVVDACLGPASPPCGRARQ
FT                   APPATSGRGCFTPRRHEGAVQTRRQCVWQPGLRHRACGQVICGKAGQNRCPLHEVQRRA
FT                   PYPARLRAVRHEDMLLHEELRATARHG"
FT   gene            complement(351214..352548)
FT                   /locus_tag="Veis_0307"
FT   CDS_pept        complement(351214..352548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0307"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   pol:Bpro_1420 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56098"
FT                   /db_xref="GOA:A1WEP1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEP1"
FT                   /protein_id="ABM56098.1"
FT                   /translation="MLIALLLGLLVGLFAPGLAVQLKPLGDGFIRLIKMIIPVLVFCVV
FT                   VHGIAGAGDLRRVGRVGVKALIYFELLTTIALVLGLVLGFWFEPGAGMNIDPGQLDASA
FT                   ISAYTSNADKLTSGGTVEFLMKLIPATAVSAFATGDVLQVLLFAVLFGCALALLGERGQ
FT                   PVATVVDALALVLFKVMGLIIHLAPLGVLGAIAFTVGKYGVGSLRQLGMLVALFYGAVL
FT                   VFVFVVLGLVMRMSGLSLYKLLRYLREELAIVLATTSSDSVLPQVMAKLRQMGIRDSTV
FT                   GLVIPTGYSFNLDAFSIYITLAALFIAQATNTPIAMADLLTILAIALLTSKGAHGVPGS
FT                   AIVVLAATLQAIPAIPSIGLVLVLSVDWFMGIARALGNLIGNCVATVAVAAWEGDIDRA
FT                   RAHAVLDAGHWPDDAPGAPGAPGAPDAPGDARATPAPAALPRTKR"
FT   sig_peptide     complement(352489..352548)
FT                   /locus_tag="Veis_0307"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.810 at
FT                   residue 20"
FT   gene            complement(352776..353051)
FT                   /locus_tag="Veis_0308"
FT   CDS_pept        complement(352776..353051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56099"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEP2"
FT                   /protein_id="ABM56099.1"
FT                   /translation="MTPMAGGRRGCHVLQAPASTRRRERSGRCWRMGVGAATGAWVGPR
FT                   RAGARDNERSTNAYGKDGFAAQGCAGPIDCVMANRCQTIQTMPGPT"
FT   gene            complement(353068..353832)
FT                   /locus_tag="Veis_0309"
FT   CDS_pept        complement(353068..353832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0309"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: bja:blr3335 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56100"
FT                   /db_xref="GOA:A1WEP3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEP3"
FT                   /protein_id="ABM56100.1"
FT                   /translation="MHARFAHKVAAVTGAASGLGRATALALAAEGARILLFDRDEAGLA
FT                   ETARACPGAVSAVGDASSAADIARAEAQALRELGPVELLVPAAGMLGPAKPAIELQEQE
FT                   WDRLFAVNVKGPWLAARAFVPHMRQIGHGAICMFSSTAGLAGSPFLSGYSASKGAVVLL
FT                   ARSLALNHAAEKIRVNCVCPGTIDGPMTEASFSLAGEGQARSAREAAIRSRIPAGRFGA
FT                   PQEVAAAVLYLLSDAAGFTTGVALPIDGGRLA"
FT   sig_peptide     complement(353746..353832)
FT                   /locus_tag="Veis_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.857 at
FT                   residue 29"
FT   gene            complement(353853..354317)
FT                   /locus_tag="Veis_0310"
FT   CDS_pept        complement(353853..354317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0310"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bbr:BB0221 acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56101"
FT                   /db_xref="GOA:A1WEP4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEP4"
FT                   /protein_id="ABM56101.1"
FT                   /translation="MTDSAQVRVLEEHDFEGWRSMWQGYQQFYGVSFDDAAVATTWSRL
FT                   RHRDEPMHGAVASMQGRVVGLVHYLFHRSTWTSGDYCYLQDLYVAPAARQLGCARQLIG
FT                   HVYEEARKKGASRVYWLTHESNTTAMRLYDQMAERPGFIQYRHVLPRTTG"
FT   gene            complement(354723..356192)
FT                   /locus_tag="Veis_0311"
FT   CDS_pept        complement(354723..356192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0311"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="PFAM: Amidase; KEGG: bbr:BB2488 putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56102"
FT                   /db_xref="GOA:A1WEP5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEP5"
FT                   /protein_id="ABM56102.1"
FT                   /translation="MTLRFPMQDDEYEALDGLALAALMKDGQVSASELMECAIRLATAR
FT                   APGLNALTYPRYEEALARAKDWAPRGAFGGIPFLLKDSGLASRRLPSSIGSRLFEDTRY
FT                   AQDATLVARFEAGGFIAFARTTVPELCMAPTTEALRNGGPARNPWDRGRSAGGSSGGAA
FT                   AAVAAGIVPIAHGSDGGGSIRIPAACCGLFGLKPSRGVVPMGPLRGEGWGGLAVDGVLS
FT                   RTVRDTAAAIDAVAGIERGAPYAAPALARSLRSAVGDAPRRLRIGVWRAAFAGIDIAPE
FT                   CVEAVDATADLCRALGHEVIDGAPPADFDYAGFVEAHTDVLGVNIVLSVDARLQMLGRS
FT                   LRPTDLEPSIMDGYAQGRSISAARYAAAIHRFHSIARFMDDCLGDFDILMTPALVQLPA
FT                   PLGELEMRDDFRSFRRRMARYSCHLAIVNASGQPAASLPTHWTAQMLPVGTQIIGRFGC
FT                   DDVVVQLAAQIEATGRWHPRQRKCIGPGDHR"
FT   gene            complement(356189..357199)
FT                   /locus_tag="Veis_0312"
FT   CDS_pept        complement(356189..357199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0312"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: bja:bll7202
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56103"
FT                   /db_xref="GOA:A1WEP6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR037950"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEP6"
FT                   /protein_id="ABM56103.1"
FT                   /translation="MHPNDPVAWPHGARCAVMLAFDFDAETLWLARDPANAKRLGVLSQ
FT                   GTYGAKVGVPRIIETLDEADVPATFFVPGWTAEHHTGRVESILRHGHEVGHHGYLHEWV
FT                   DPQDPAREEEIFLKGLQALQRTVGVKPLVSRHRSSVGLRWPSKRIAALHRLPIRSVLAA
FT                   RCALRCAPMAARSLRHLIRDATLGYRSPAWEASLNLMALIDKHGLRYDSSLMDQINPYH
FT                   HVLADGRRGPVELPVHWSLDDAPFALFSVKSPRTIVSNEQILAVWQDEFSEIYRWGGLF
FT                   SLTMHPQVMGRPSRIALLRAFIAWMRSFPGVWFARGAEIAQAWTDACLSNRGIAP"
FT   gene            complement(357214..357969)
FT                   /locus_tag="Veis_0313"
FT   CDS_pept        complement(357214..357969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0313"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   mmc:Mmcs_4411 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56104"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEP7"
FT                   /protein_id="ABM56104.1"
FT                   /translation="MRFSGRTVVVTGANSGIGRATAVRLAGEGARVLAVDLRTDALADI
FT                   GVEPLAIDLGTEQAPARTVAAARAFGAGRVDCLVNNAGIGGSKALTASDDASIDRILGV
FT                   NLRAVLRLTRDMLAIMSDGGSIVNLASVFGEIGYPNSAAYAVAKGGISQLTRQLVADLS
FT                   WRGIRVNAVAPGVIRTAMTAHWLDHDEQYRRNMTGSTPLGFVGTPEHVAAVIAFLCSPD
FT                   AAFVTGQVIAVDGGWLTCRAHGTAPSEVS"
FT   gene            complement(357966..358682)
FT                   /locus_tag="Veis_0314"
FT   CDS_pept        complement(357966..358682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0314"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gvi:glr2898 probable ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56105"
FT                   /db_xref="GOA:A1WEP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEP8"
FT                   /protein_id="ABM56105.1"
FT                   /translation="MLEVRNIESGYGRTKVLHGVSFSVSDGALVAVLGGNGSGKSTTLK
FT                   TLAGLVRPSAGEITLAGQRIDQVPACRMASSGLVLVPQGKEVFAAMSVEENILMGGYHR
FT                   RREKARLRDDLQQVYALFPRLALRRKALAGLLSGGERQMLAIGRALLARPRMLLLDEPS
FT                   SALAPKVVGEIAEVIRGLRGRGISILLVEQNVAMALELADELHILREGRVAHSCVNGPG
FT                   VDLASLQEFYLGKGTR"
FT   gene            complement(358675..359457)
FT                   /locus_tag="Veis_0315"
FT   CDS_pept        complement(358675..359457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0315"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tma:TM1138 branched-chain amino acid transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56106"
FT                   /db_xref="GOA:A1WEP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEP9"
FT                   /protein_id="ABM56106.1"
FT                   /translation="MTPPLLRFDAVSKHFGGLVAVNAISFQVRQGEILGLIGPNGSGKS
FT                   TLVNLATGECAPTAGAIHMGDICLTGMAPWRIARLGVARTFQMLRSFPSLTVGQNLALA
FT                   MQPGLGSGYCASVLRMASARRDDAQARGRAIEMLRLFGLERFVDEPATALSIGQQRMVE
FT                   LARGLCTRPRVFVLDEPAAGLSPPMVERLIEVIGRMRTDHGVTVLLAEHVMRVVQTVCD
FT                   RVVVLDYGEKIADAKPSEAVADPRVIEAYLGAGKAAHA"
FT   gene            complement(359454..361249)
FT                   /pseudo
FT                   /locus_tag="Veis_0316"
FT   gene            complement(361268..362416)
FT                   /locus_tag="Veis_0317"
FT   CDS_pept        complement(361268..362416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0317"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   gka:GK2980 branched chain amino acid ABC transporter
FT                   (substrate-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56107"
FT                   /db_xref="GOA:A1WEQ0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEQ0"
FT                   /protein_id="ABM56107.1"
FT                   /translation="MKTSFIPKALLALSAAAWMPSSALAQDTVRFGVLLPLTGPAALSG
FT                   TSIVEGMRLAAEEANAQGGVKGKKVQLFEEDDEGLTTKAVTGARRLVESNKVIGISGSY
FT                   ISAAAIAATKVAREFKVPVVSGGSTSVSATDANTPGDPWFFRAFPGSIEQGEQSARDIV
FT                   QKLKAKKVAVIYENSPYGMSLAEQMRKDIPRFGGQVVAEEIYNTDERDFYSVLTKVRAR
FT                   QPEAIYLAGLMDAGVQVIRQASEVGLKTQLVGSGSMMSDKLIQLTGHASEGFAVSSMFE
FT                   PSTPNEFGQKFTRMFRERYKKEPDVFTALGYDSMHLLIEAARRAAKLDGEQVRAELIKM
FT                   SDVPLVQGPANTMVKFDAKGGSTFRIGLAIVRNGKRVWLPFD"
FT   sig_peptide     complement(362339..362416)
FT                   /locus_tag="Veis_0317"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            362532..363395
FT                   /locus_tag="Veis_0318"
FT   CDS_pept        362532..363395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0318"
FT                   /product="regulatory proteins, IclR"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: bpe:BP0727
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56108"
FT                   /db_xref="GOA:A1WEQ1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEQ1"
FT                   /protein_id="ABM56108.1"
FT                   /translation="MSFFHWSSIKNQRHGVASDRRAQAPRHMKEQFLGSDNLFVQSLAK
FT                   GIGLLEALGARPGALSLTDLADLTGMDRSTTQRMTHTLVQLGYIEKGANGRGFVPGRKI
FT                   LDRTFDYLSHNLLIERASPILTDLQREAGERVDLSLFDDLSIIYAWRRQTKRQTFFATL
FT                   VGRRIPCYCSSGGRAIMSHLPQQRVDDILARSTLRPITPKTETDVAVIKRRIAQARESN
FT                   YALALEETLLGEIAVGCAILDHDRQPMAALHIAGSLSEWTVEAFVQRFTPLAIEAARAL
FT                   GGGIPR"
FT   gene            363718..364449
FT                   /locus_tag="Veis_0319"
FT   CDS_pept        363718..364449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0319"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rfr:Rfer_1406 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56109"
FT                   /db_xref="GOA:A1WEQ2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEQ2"
FT                   /protein_id="ABM56109.1"
FT                   /translation="MNPSPARGATPAASPVIAPLSSLAGFDPRLVPVRCVDAHLPVVPP
FT                   EAQTPQALRARFANPPPWEPEVVLERKFIERAPARASVLLAIVLREQPMVLLTERTAHL
FT                   STHSGQVAFPGGRADPQDASATDTALREAQEEVGLEPGFVEVLGTLSTYLTGSAFIITP
FT                   VVGLVQPGCVLRPNPCEVAQLFEVPLAFLLDPANHRRHVFDRDGVRREWFSMPYQDGDK
FT                   NHYIWGATAGMLRNFYRFMRA"
FT   sig_peptide     363718..363792
FT                   /locus_tag="Veis_0319"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.705) with cleavage site probability 0.681 at
FT                   residue 25"
FT   gene            364474..365490
FT                   /locus_tag="Veis_0320"
FT   CDS_pept        364474..365490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0320"
FT                   /product="cobalamin biosynthesis protein CbiB"
FT                   /note="PFAM: cobalamin biosynthesis protein CbiB; KEGG:
FT                   pol:Bpro_1695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56110"
FT                   /db_xref="GOA:A1WEQ3"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEQ3"
FT                   /protein_id="ABM56110.1"
FT                   /translation="MDHPSVSLPPMSFFAILFALLIEQARPLARSNPIHAGLRAWALSV
FT                   SRNFDTGKPQHGWLAWCLAVLVPACATLAMHWLLLWGPGWPFAMLWSVAVLYVTLGFRQ
FT                   FSHHFTGIRDALEGGDEDDARARLAHWQQVDVGLLPRREIVRHVIEYSVLAAHRHVFGV
FT                   LAWFSVLAALGLGPTGAVLYRLSEFVARHWHPRPRMGPALASASLQQASARAWTVIDWL
FT                   PARLTALSFAVVGSFEEAIEGWRFHAQRFPNDNDGVVLAATAGAIDVRLGGEALKAHAG
FT                   MRTSQGLEIDSDMDDSDATPGREPEVGHLRSVVGLVWRSVVVWMLLLALLTLARLLG"
FT   gene            complement(365510..366454)
FT                   /locus_tag="Veis_0321"
FT   CDS_pept        complement(365510..366454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0321"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: rfr:Rfer_1409 GTPase EngC"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56111"
FT                   /db_xref="GOA:A1WEQ4"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEQ4"
FT                   /protein_id="ABM56111.1"
FT                   /translation="MAERSALIEGTVVASHGRHCMVETPDGERRICHPRGKKSQAVVGD
FT                   HVLWQAAPPGQGAAGSIEKVLQRRNLFYRQDTIRTKSFAANLDQVLILIAAEPVFSESQ
FT                   LARALIAAEAAGIRPLIALNKSDLAESFARAWERLLPYRRMGAGQHYGVLPLSLALSSA
FT                   VDRAALMQQLTAKTTLVLGPSGSGKSTLINLLVPGAAVLTGALSQALNSGRHTTTSTHW
FT                   YWIDQARTSALIDSPGFQEFGLQHIAPMQLAACMPDIAAHAGHCKFYNCTHLHEPGCGV
FT                   LEAVKKGAGADGASAIRHKIYSDLFAELSHTRY"
FT   gene            complement(366495..366830)
FT                   /locus_tag="Veis_0322"
FT   CDS_pept        complement(366495..366830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0322"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: rfr:Rfer_1410 transcriptional
FT                   coactivator/pterin dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56112"
FT                   /db_xref="GOA:A1WEQ5"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEQ5"
FT                   /protein_id="ABM56112.1"
FT                   /translation="MSAMPKTQDEAAPARRALTATEVVARLAQLQGWRLSGDGADVALQ
FT                   KTYHFASYYETIAFVNALAFIVHAQDHHPDLSVHYDRCVVRLNTHDVRGISATDFDCAA
FT                   RFDALLA"
FT   gene            complement(366830..368134)
FT                   /locus_tag="Veis_0323"
FT   CDS_pept        complement(366830..368134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0323"
FT                   /product="Ste24 endopeptidase"
FT                   /EC_number="3.4.24.84"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: rfr:Rfer_1411
FT                   STE24 endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56113"
FT                   /db_xref="GOA:A1WEQ6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEQ6"
FT                   /protein_id="ABM56113.1"
FT                   /translation="MFALEDLSPAIGLTLAFAVALVLGLALKFWLVTRQIRYVARHRAE
FT                   VPARFAGRIALATHQKAADYTIAKARLGVLEMALGAVAVLGWTLLGGLDALNQALLAVS
FT                   GAGLLQQLALLLAFAAIGGLIDLPLSLYRIFALEQRFGFNRMTLRLWLVDALKGLLLGV
FT                   LIGLPIAALILWLMAAAGPLWWLWAWGLWMGLQLLLMLVYPTFIAPLFNEFRPLQDPAL
FT                   QAGVSALMQRCGFSAKGLFVMDGSRRSAHANAYFTGFGAARRVVFHDTLLQQLTPGEVQ
FT                   AVLAHELGHFKHRHITWRIALMSALSLAGFALLGWLSGQMWFYIGLGVRPGIALDPALA
FT                   AAPNDALALLLFLLVVPVFTFFMAPLLAQLSRRHEFQADAYAVAQASGADLSSALLKLY
FT                   EGSAATLTPDPVYVRFHYSHPPAAERLARIPAGNG"
FT   gene            368416..369003
FT                   /locus_tag="Veis_0324"
FT   CDS_pept        368416..369003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0324"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: pol:Bpro_1700 exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56114"
FT                   /db_xref="GOA:A1WEQ7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEQ7"
FT                   /protein_id="ABM56114.1"
FT                   /translation="MRAMPETTPPSPCTLAKSDQNLVWLDCEMTGLTPDTDRLLEIAVV
FT                   VTGPNLEPRIAGPVLVIHQSQEWLDKMDAWNKGTHGRSGLIDKVKASGITEAQAEQQII
FT                   AFLSQYVPKGQVPMCGNSIGQDRRFLARYMPELERFFHYRNVDVSTLKELAKRWKPQVC
FT                   AGFKKAQKHTALADVNESIDELAHYRKHLLAV"
FT   gene            369287..371116
FT                   /locus_tag="Veis_0325"
FT   CDS_pept        369287..371116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0325"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like;
FT                   KEGG: rfr:Rfer_1413 DEAD/DEAH box helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56115"
FT                   /db_xref="GOA:A1WEQ8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEQ8"
FT                   /protein_id="ABM56115.1"
FT                   /translation="MPATMKEIMSDTSLVQRDFAPVQTTPSPAQTTPSPVQTASSPAPT
FT                   TSAPVQIACAPAPMTPAPAPTPSAADDAAPNGFIEMGLAPELVRAVADLGYTGPTIVQR
FT                   KAIPLAMGAGHGATRFIDLMVSSQTGSGKTAAYLLPLLHTLIGQQAQVQAQERAALERA
FT                   AADAATRDAPAPKRPKRKDPMHTRHFKAATPGALILCPTRELAQQVAHDAIDLARHCRG
FT                   LRVANVVGGMPYQMQIAKLQNASLVVATPGRLLDLQRSMQIKLDKVQFLVVDEADRMLD
FT                   LGFSDDLAEINQLTSQRQQTMMFSATFAPRIQQLALRVMHDGGSSVQKLTIDSPQEKHA
FT                   NIRQMLYWADNAQHKRKLLDHWLRDTQINQAIVFASTQVECDALAGELQQAGFSAVALH
FT                   GALNQGLRNRRLTALRDGQVQILVATDVAARGIDVPTITHVFNFGLPMKAEDYTHRIGR
FT                   TGRAGRDGLAISFAEFRDRRKIHDIESFSRQSFKAEVIPGLEPAQRPPQAPRSADFGGR
FT                   GRPGGYERDGRERRFGGPARGDDRGFAPRREAQGHGRKPGFGDAGRSGFAPRGAVGAAA
FT                   GAARKPGFARPAGGGGKPFVAHEARRRTARPER"
FT   gene            complement(371174..372253)
FT                   /locus_tag="Veis_0326"
FT   CDS_pept        complement(371174..372253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0326"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   reh:H16_A2253 ABC-type transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56116"
FT                   /db_xref="GOA:A1WEQ9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEQ9"
FT                   /protein_id="ABM56116.1"
FT                   /translation="MLDRLVSNDYPRSKPLAVILIAVLLGLALAPFLLPGVKALSVAAK
FT                   VLVFVVLVASFDLLLGYTGIVSFAHTMFFGIGAYGIAVASTRLGPTWPALALGLGGALL
FT                   LSLLLSLAMGLFSLRVRAIFFAMITLAVASAFQTLASQLPDITGGEDGLTFNLPALLSP
FT                   DFEFFGQPFPGVALDGRLLCYYLLFASALVLVLALLRIVNSPFGRVLQAIRENEFRAEA
FT                   IGYRVVLYRTLSSVLSALFATMAGAMLALWLRYNGPDVSLSFEIMIDCLLIVVIGGMGT
FT                   IYGPVIGSVLFLAAQSYLQDLLRLGSEAASRLPWLSALLSPDRWLLWLGLLFVVSVYYF
FT                   PSGVVGRLRAAAQPQQQGR"
FT   gene            complement(372246..372587)
FT                   /locus_tag="Veis_0327"
FT   CDS_pept        complement(372246..372587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56117"
FT                   /db_xref="UniProtKB/TrEMBL:A1WER0"
FT                   /protein_id="ABM56117.1"
FT                   /translation="MPSGKWLHKMKSMRFVSGQGENPRAACRMSRGLATPAWRARRRVV
FT                   RSHWRGGAPMSRHRSDVAGCAQPSERSARRSAQPISSVLASDATPRCVSMASADRQMIG
FT                   DATPGATRA"
FT   gene            complement(372589..373572)
FT                   /locus_tag="Veis_0328"
FT   CDS_pept        complement(372589..373572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0328"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   reh:H16_A2254 ABC-type transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56118"
FT                   /db_xref="GOA:A1WER1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1WER1"
FT                   /protein_id="ABM56118.1"
FT                   /translation="MALRDRDWAPLALVPALALLVLPLIGSPGTWLTLTVAGLAMGMII
FT                   FIIASGLTLVFGLMDVLNFGHGLFITLGAFIASTVLGAMGDWTGSEQLWRNLVAVLSAM
FT                   LVAMAVAAAVGLAFERCIVRPVYGQHLKQILITMGGMIIGEELIKLIWGPAQIPLPLPE
FT                   GLRGALLMGDAAIEKYRLVAVAVGLLVFGALAWMLARTKLGLLIRAGVQDREMVEALGY
FT                   RIRRLFVAVFVLGSALAGLGGVMWGLYQQYLVPQMGTQVNVLIFIVIIIGGLGATGGAL
FT                   IGALLVGLVANYTGFLAPKVALFSNIALMAAILLWRPQGLYPVVNR"
FT   gene            complement(373678..374409)
FT                   /locus_tag="Veis_0329"
FT   CDS_pept        complement(373678..374409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0329"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rpa:RPA4399 possible branched-chain amino acid
FT                   transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56119"
FT                   /db_xref="GOA:A1WER2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WER2"
FT                   /protein_id="ABM56119.1"
FT                   /translation="MNPQTPLLELRAVHTHIGAYHILHGVDLAVPPGQITLLLGRNGAG
FT                   KTTTLRTIMGLWQASRGSIHCAGQDITALATAQIARLGIAYVPENMGIFADLSVKENML
FT                   LAARQARRAAQIDAQRLQWIFGLFPALEKFWNHPAGKLSGGQKQMLAVGRAIVEPRALL
FT                   LLDEPGKGLAPAIIDRMIEALVQLRSSGVAILLVEQNLHFAQRLGDSVAVMDNGRVVHA
FT                   GSMAALAQDAALQRALLGLAL"
FT   gene            complement(374406..375284)
FT                   /locus_tag="Veis_0330"
FT   CDS_pept        complement(374406..375284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0330"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: reu:Reut_A1985 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56120"
FT                   /db_xref="GOA:A1WER3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1WER3"
FT                   /protein_id="ABM56120.1"
FT                   /translation="MSAARPPAGADTAAEGAPVSRLVTKDLSIRFGGHVAVDGLSCSFE
FT                   PGQLTAIVGPNGAGKTTYFNLICGQLRASSGSVMLGGQDLTRLSVAARTHAGLGRAFQL
FT                   TQLFPRLSVLENLRLAVQARQAGRHRRGLNLWSIWSDHQALTERARLILQTLAMTERAD
FT                   SPAASLPHADQRKLEVALLMALEPQVYLFDEPTAGMGQDEAPVILNLIRALKQDRSKII
FT                   LLVEHKMEVVRELADRVIVLTNGRLVADGAPAEVMASPVVQQAYLGTAQAPSTLQTLQT
FT                   PWPLRTGMAAP"
FT   gene            complement(375303..376514)
FT                   /locus_tag="Veis_0331"
FT   CDS_pept        complement(375303..376514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0331"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   reu:Reut_A1986 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56121"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WER4"
FT                   /protein_id="ABM56121.1"
FT                   /translation="MRHHHLPARAALAALALALAISAAAAAFAQTGEIRIAHIHSKTGP
FT                   QQSLSMQTRAGLLLGLDYATGGSMMVHGKKLVLIEKDDQGKPDLGRSLLAAAYADDKAD
FT                   IAIGPALSSVALAMLPVAQEYKKILLVEPAVADSITGDKWNPYIFRTGRNSSQDAIANA
FT                   AAIDKPGVSVATLAPDYAFGRDGIKAFKDVLRHARLVHEEYLPTNTTDFTAGAQRLIDK
FT                   LKDLPGRKLIFILWANPNSNPFKIADMDLKRYGIEITSGGSTLPGLVTYKNFPGMEGAT
FT                   YYYFGIPKNPVNQALVAAHYKAYKTPPDFFTAGGFSAAMALVTALEATKGDTDSRLLIK
FT                   TMEGMEFDTPKGRMYFRKEDHQAMQSMYHFRIEVDPAFPWGVPVLVREIGAQEMNVPIR
FT                   NRRQ"
FT   sig_peptide     complement(376425..376514)
FT                   /locus_tag="Veis_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.903 at
FT                   residue 30"
FT   gene            complement(376715..377914)
FT                   /locus_tag="Veis_0332"
FT   CDS_pept        complement(376715..377914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0332"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   reu:Reut_A1986 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56122"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WER5"
FT                   /protein_id="ABM56122.1"
FT                   /translation="MHRRHLPARAALAVLALAISAAAVFAQTGEIRIAHVYSKTGPLQA
FT                   YGMQTQTGLSMGLNYATGGSMMVDGKKLVLIEKDDQGKPDLGRSLLAAAYADDKADIAV
FT                   GPSSSGVALAMLPVAQEYKKILLVEPAVADSITGDKWSPYIFRTGRNSSQDAIANAAAI
FT                   DKPGVSVATLAQDYAFGRDGVKAFKDALQHARLVHEEYLPTNTTDFTAGAQRLIDKLKG
FT                   LPGRKLIFILWAGAGNPFKIADMDLKRYGIEITTGGNTLSGMAAYKNFPGMEGATYYYF
FT                   GIPKNPVNQALVAAHYKAYKTPPDFFTAGGFSAAMALVTALEATKGDTDSRLLIKTMEG
FT                   MEFDTPKGRMHFRKEDHQAMQSMYHFRIEVDPALPWGVPALVREIGAQEMNVPIRNRRQ
FT                   "
FT   sig_peptide     complement(377834..377914)
FT                   /locus_tag="Veis_0332"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 27"
FT   gene            complement(378017..378271)
FT                   /locus_tag="Veis_0333"
FT   CDS_pept        complement(378017..378271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56123"
FT                   /db_xref="UniProtKB/TrEMBL:A1WER6"
FT                   /protein_id="ABM56123.1"
FT                   /translation="MDGHHAAPLRLQQAMQAQVAVGGANGRKRARTGENGRYSAAGRVR
FT                   RVAGVSGIDVVTGWLIGRGAVCPAGIAAQAGRQQPGPSN"
FT   gene            378523..379443
FT                   /locus_tag="Veis_0334"
FT   CDS_pept        378523..379443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0334"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="TIGRFAM: putative agmatinase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   bte:BTH_II0784 agmatinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56124"
FT                   /db_xref="GOA:A1WER7"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A1WER7"
FT                   /protein_id="ABM56124.1"
FT                   /translation="MPRFGGLATMMRLPSVDDPAALDVGFVGVPLDLGTSHRSGTRFGP
FT                   RQIRAESVLLRPYQMATRAAPFDALRVADLGDVAINPYNLIDSIARIERAFDAIVAAGC
FT                   RPITLGGDHTITLPILRALHRRHGPIGLIHIDAHADVNDTMFGEKLAHGTTFRRAQEEG
FT                   LLDPLRVAQIGLRGTGYTAQDFDWCRDQGFRVVQVEECWGRSLMPLMQELRARVGGGPV
FT                   YFTLDIDGIDPAYAPGTGTPEIAGLTVPQTLELIRGAWGLNLVGADVVEVSPPYDPLGN
FT                   TALLAANLAFELLCVMPGVPRRTCA"
FT   gene            379796..380533
FT                   /locus_tag="Veis_0335"
FT   CDS_pept        379796..380533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0335"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: ppr:PBPRB1128 hypothetical amino acid ABC
FT                   transporter, periplasmic amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56125"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1WER8"
FT                   /protein_id="ABM56125.1"
FT                   /translation="MALSVDAKSYKEITIATDATYPPFESVAADGQLVGFEIDLSHALC
FT                   EELKLKCRLINASFDTLIPGLVTRKSDALITSMNINDERKRVIDFTDPYYRMESRFVAR
FT                   KGAGIVISAAGLTGKTIAVQAGTLQASYVRKVYGDVARIKYYQGGSEPFLELLSGRADL
FT                   HFGFIVQVNDSFLSKDGKDFEFIGPTLSGKDDKTLGEGVAIAIRKEDKELKALLNQGLQ
FT                   TLRKNGTMKKINDKYFPFTLVMD"
FT   gene            380573..381277
FT                   /locus_tag="Veis_0336"
FT   CDS_pept        380573..381277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0336"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pfl:PFL_4520
FT                   arginine/ornithine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56126"
FT                   /db_xref="GOA:A1WER9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WER9"
FT                   /protein_id="ABM56126.1"
FT                   /translation="MEYFWNVLAAASVTLEMAAGSLLAAIALGLSGAWAKLCGGRWLAA
FT                   VAGAYTTLVRGVPDLVLMLLFFYGVPALVQLALDKSGSDAGFDVSPLGAGLATLGLIFG
FT                   GYLTETFRGAILAIPKGQIEAACAFGLGRLRIAWRIVLPQMARLALPGFTNTWLVLVKS
FT                   TALVSVLGLEDIMFRAKNAAQATRQPFTFFLLTAAVYLSITTVSMLALRWLERRGAHDT
FT                   RRAPSDRAGRAA"
FT   sig_peptide     380573..380647
FT                   /locus_tag="Veis_0336"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.833 at
FT                   residue 25"
FT   gene            381274..381984
FT                   /locus_tag="Veis_0337"
FT   CDS_pept        381274..381984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0337"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pau:PA14_52770
FT                   arginine/ornithine transport protein AotM"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56127"
FT                   /db_xref="GOA:A1WES0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WES0"
FT                   /protein_id="ABM56127.1"
FT                   /translation="MNWDLIAAHWLLFAHGVALSLALTAGTAVLGLLMSVPLAFARHST
FT                   RRLCSQPVAAFTFVVRGTPCLVQLYLVYYGLSQFEAVRNSWLWPWLTNASFCALLTFAI
FT                   NTTAYTTEILSGALARLPPGEIEAGQSFGMSRWTLVRRIQVPAMLRRALPQYANEIIML
FT                   LHMTSLAGLVTLLDITGAARFINAEFYLAFEPFITAGALYLAITLVLVRCFGAAENRWL
FT                   AHLRPRHSPIQMRS"
FT   sig_peptide     381274..381399
FT                   /locus_tag="Veis_0337"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.758) with cleavage site probability 0.622 at
FT                   residue 42"
FT   gene            382006..382863
FT                   /locus_tag="Veis_0338"
FT   CDS_pept        382006..382863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0338"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rfr:Rfer_1521 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56128"
FT                   /db_xref="GOA:A1WES1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1WES1"
FT                   /protein_id="ABM56128.1"
FT                   /translation="MNIPTDASARPAQAGPVPAGRDGAAAIEATATCPLQLRNLHKRYG
FT                   SHEVLQGVSLTARKGQVLSIIGSSGSGKSTLLRCINLLEQPTQGEIVVNGERLRLKRAA
FT                   HGDLECVDRKQLQRVRTKLAMVFQGFNLWSHMTVLENIIEAPVHVLGMSKARALQAAEA
FT                   YLHKVGLYERRDYYPAHLSGGQQQRAAIARALAVEPDVLLFDEPTSALDPELVTEVLRV
FT                   MQSLAQEGRTMVVVTHEMGFARSVSNHVIFLHRGLIEEEGDPAQVLRQPRSERLRQFLS
FT                   GSLK"
FT   gene            382877..384607
FT                   /locus_tag="Veis_0339"
FT   CDS_pept        382877..384607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0339"
FT                   /product="thiamine pyrophosphate enzyme TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: bur:Bcep18194_C6721 acetolactate synthase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56129"
FT                   /db_xref="GOA:A1WES2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1WES2"
FT                   /protein_id="ABM56129.1"
FT                   /translation="MTITLGQVLIRILEDYGVEHVFGIPGIHTVELYRGLAASSIRHIT
FT                   PRHEQGAGFMADGYARASGKPGVCFIITGPGMTNVATALGQAYSDSVPMLVLSSVHARN
FT                   HLGAGNAGSGRLHELRSQQALVAGLTAFSHTLMQPDDLPVALARAFAVFDSARPRPVHI
FT                   EIPLDLIGADASHLSPKSLVRSRKPLAGQPSIDDAAAWLAGAARPLILAGGGAVHAASA
FT                   LRALAEHLQAPTALTVHAKGLLPAAHPLLLGSTQSTEPTRQLVREADVVLAVGTELGET
FT                   DYDTVFDGGFGISGALIRVDIDADQLARNFAPTCTVLGDSADALERLCRALQQAPARPP
FT                   GTPPSHAPAGEASAWGACRVHAVRAQLESAWDLPFKAQRHYLETVLAELPDALFAGDST
FT                   QPVYQGNLAIDMPGPRRWFNSSTGYGTLGYGLPAAIGAQLAAPDRPVVCLIGDGGLQFT
FT                   LPELASAVEAGLAPIILLWNNGGYEEIRRCMRQRDIRPIGVDLYTPDFQLLARGFGCDA
FT                   CRADDASALRRALRQARSGTRDRPVLIETSQAHWHAHAYAADRQTATTPPGPLHGDTDA
FT                   "
FT   gene            384600..385313
FT                   /locus_tag="Veis_0340"
FT   CDS_pept        384600..385313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0340"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: pfo:Pfl_3900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56130"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A1WES3"
FT                   /protein_id="ABM56130.1"
FT                   /translation="MLETENALRTRLASLYRLLAFFRMTDLIDTHISARIPGTANQFLI
FT                   NRYGVLFHQMQPQDLIRIDPEGQPIDAPDAAQRVNAAGFTIHSAIHMARHDLACVIHTH
FT                   TADGIAVSCQQQGLLAISQHALKFYRRHGYHDYEGIALDLDERSRLVASLGKHQVLILR
FT                   NHGLLAAGRSIAEAFLNIWFLERACQAQVKALSGGAKIVIPPESVCERTALQFEQEDNL
FT                   EHAELVWNAALGLIE"
FT   gene            385361..385675
FT                   /locus_tag="Veis_0341"
FT   CDS_pept        385361..385675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eli:ELI_12510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56131"
FT                   /db_xref="UniProtKB/TrEMBL:A1WES4"
FT                   /protein_id="ABM56131.1"
FT                   /translation="MWAAASTVGNVLTSEYKLNLMAPGTGDQLRAEDRVPKASGRNLVC
FT                   MADVYAIHQVPSVASPIICRSALAIEAHRGVASLANTARYGLRDAPCAALRWLRAAYDI
FT                   "
FT   gene            complement(385729..386061)
FT                   /locus_tag="Veis_0342"
FT   CDS_pept        complement(385729..386061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0342"
FT                   /product="protein of unknown function UPF0060"
FT                   /note="PFAM: protein of unknown function UPF0060; KEGG:
FT                   hch:HCH_03337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56132"
FT                   /db_xref="GOA:A1WES5"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WES5"
FT                   /protein_id="ABM56132.1"
FT                   /translation="MELLKATVLFTITAVVEIVGCYLPWLVIKQNKPLWLLLPAALSLA
FT                   LFAWLLTLHPSAAGRTYAAYGGIYIAVALAWLHWVDGVSLTRWDVAGATVAMVGMLIIM
FT                   LQPASA"
FT   gene            complement(386365..387741)
FT                   /locus_tag="Veis_0343"
FT   CDS_pept        complement(386365..387741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0343"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: pfl:PFL_5051
FT                   heavy metal sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56133"
FT                   /db_xref="GOA:A1WES6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1WES6"
FT                   /protein_id="ABM56133.1"
FT                   /translation="MKNSIIARLVIMFAAAALIIFSLIGSVLYAVVDNELLHHERNSLV
FT                   TTFKDIEYMVSRAGTTERWAHVQVKLDTLTPADGKVRFWIFSDDPRFGYGKDLAELHEF
FT                   ANHPNNLGRMSIKGKKYPLHTLTRILPAYLDRPAIRLTVGVDAASYFETLRTFVAAMTG
FT                   LSLAGVLLVILCGYWIARTGLQPLKKMSDKAQTLSPKTLSERLTLSALPDELSDLAQAF
FT                   NGALDRMENAYKQLEAFNADVAHELRTPLANLIGETQVALSRERSAPEFESVLQSNLEE
FT                   MDRLRSIINDMLFLARCDQGEAATGLVHALIADEVQKTMDFFEFVLDETGMRVEISGDT
FT                   HATALIETSLFRRALTNLLQNAIQHSPAGACIEVAIDAKNHGVQIAVSNPGEPVEQGHL
FT                   PRLFDRFYRVDTARRDINGIHGHGLGLAIVKAIALMHGGSVFAASTGGVTTIGFTTARF
FT                   "
FT   sig_peptide     complement(387649..387741)
FT                   /locus_tag="Veis_0343"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 31"
FT   gene            complement(387738..388433)
FT                   /locus_tag="Veis_0344"
FT   CDS_pept        complement(387738..388433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0344"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: pau:PA14_45880 putative two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56134"
FT                   /db_xref="GOA:A1WES7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1WES7"
FT                   /protein_id="ABM56134.1"
FT                   /translation="MKILIVEDEHKMAEYLRKGLSEQGCTVDLAANGIDGQHLAIWHDY
FT                   DVIVLDAMLPGLDGFSVLRSLRILKQTPVIMLTARDRVEDRIKGLHDGADDYLIKPFSF
FT                   LELLARLQALTRRGRAQEPAQLRIGDLQIDLLSRKALRNNTRIDLTAKEFALLAIMARR
FT                   QGEILSKTAIAELVWDMNFDSNTNVVEVAIKRLRAKIDAPFSQKLLHTIRGMGYVLEPR
FT                   ATAHDGEGG"
FT   gene            complement(388453..391608)
FT                   /locus_tag="Veis_0345"
FT   CDS_pept        complement(388453..391608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0345"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   rme:Rmet_0600 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56135"
FT                   /db_xref="GOA:A1WES8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1WES8"
FT                   /protein_id="ABM56135.1"
FT                   /translation="MSVSARFIQRPIGTTLLAIAILLVGIAVWPLLPVAPLPQVDFPTI
FT                   QVSASLPGGSPETMASNVAQPLERQFSLIAGLSQMTSQSALGSTQITLQFDLNRNIDAA
FT                   ALDVQAAINASTGQLPTSLPNPPTFRKVNPADSPIMIMSVQSDALPLTQVNDYADNILA
FT                   QQISQISGVGLVSVHGQQKPAVRIQVDPARLATLGLSLEDIRGAIATTSVNQPKGTVDG
FT                   AHQSFTVYTNDQLLSAEPWNDMVLAYRHGAPVRVRDIGVAIDAPENNKIAAWAYAGAMA
FT                   PSDDTLANGRAIVLAITKQPGANVIETVGRIKAAMPRLRAAIPASVRVDTLIDRTQTIR
FT                   ASVGDVEFTLVLSIALVVMVIFVFLRNVAATLIPGITVPLALMGTAGVMYLAGYSLDNL
FT                   SLMALTIAVGFVVDDAIVMLENIYRHVEAGMTPMQAALKGASEIGFTIISISVSLVAVF
FT                   IPLLLMGGIVGRLFREFAVTVTLTIAVSVIISLTLTPMLCSRFLKNSHAARHGKPYQLF
FT                   ERFFDILQKGYQRSLDVVMRHQFVTLLTFIGTMAMTVMLFVAIPKGFFPQQDNGVIVGF
FT                   AESAQDISSQAMQRHLLQVAEIVRKDPDVAGFAMSAGSTTFNTGNFFIALKPTDAGRTA
FT                   SASEIITRLRPQIAGIQGVNLFMQASQDINVGGRLARTQYQYTLTDSNLDELDTWAPKM
FT                   VERLRRMKQLTDVVSDQQNNAATATITIDRARASSFGISPALIDASIYDAIGQRQVAQY
FT                   FTQINSYHVVLEVTPALQRDPALFNKLYLTSPLTGQQVPLSTFIEVDTSKTAYLSISHQ
FT                   GQFPAVTISFNLAAGVSLGEAVDAINRAQAEMGVPTTLTGAFQGTAKAFGDSLSSQPYL
FT                   IAAALIAVYIVLGLLYESYIHPLTILSTLPSAGVGALLILMAGGYDLSVIALIGIILLI
FT                   GIVKKNGIMMIDFALTAERQQGMKPQAAIYQACLLRFRPIMMTTMCALLSGLPLMLGHG
FT                   AGSELRRPLGYAMVGGLVLSQALTLFTTPVIYLYLDRAHYWYMGRKKSKHAGMIPAIES
FT                   DAY"
FT   gene            complement(391605..392687)
FT                   /locus_tag="Veis_0346"
FT   CDS_pept        complement(391605..392687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0346"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rme:Rmet_0601 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56136"
FT                   /db_xref="GOA:A1WES9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1WES9"
FT                   /protein_id="ABM56136.1"
FT                   /translation="MRRSDAVAQAPQVAHAPAISVTTVRAQERDIPLYLAGVGTATANA
FT                   SVTVKARIDGQLDKVGFSEGQDVREGQLLAQIDPRALQAQLAQAQAQQARDQAQLGNAQ
FT                   ADLQRYMTLRRQDAATQQQLDTQKALVAQLDAAVKTDEAQIKYAKVQLGYTTIKAPISG
FT                   RAGARLVDPGNIVHAADANGLVVINQIDPMTVQFTLPEEAVPAINRAQRASRQPLKVTA
FT                   YARSNNDAPLATGQLILLNNQIDTSSGTVQLKARFANPQHALWPGQYVNVNLQMSERGM
FT                   ALTLPAAAVQRNQDGTYVYIVKADDTVAIQPIEVVRIQDGMAVIGKGLASAQRVVLDGQ
FT                   YKLKPGSRITEASAAKGYAK"
FT   gene            complement(392931..394367)
FT                   /locus_tag="Veis_0347"
FT   CDS_pept        complement(392931..394367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0347"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: rso:RS03144 putative outer membrane channel
FT                   lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56137"
FT                   /db_xref="GOA:A1WET0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A1WET0"
FT                   /protein_id="ABM56137.1"
FT                   /translation="MPATMTATAPLARIFSLLGVLACALFLGACAVGPDYVRPAMDLPV
FT                   VYKEQGPWKIATPGRIDSRQRWWEAYQDAVLNDLIDQANRANQNIRFAEAQYRQAQAAA
FT                   AIAHAGLWPEVSGNASRARSSNGAENTYAAGLNASWEVDIWGRVRRLAEAGDAGSEAGA
FT                   ASLAAARLSIQAALAQNYLQLRVTDLQKDLYARTVADYTRSLQLIRHQYDAGVALRSDV
FT                   AQAETQLRSAQAQWIDLDATRTQLEHAIAILIGKAPAAFTLAAQTTLQASMPSIPAGVP
FT                   SDLLERRPDIANAERLAAAANANIGVARAAWFPALTLSAAGGYSGSAFSQLFDTPGRVW
FT                   SLGSALAALLFDGGARHARNDQARAAFDAAVATYKQTVLSGLQEVEDNLSTLRVLAQES
FT                   QVQDQAVKAAQLSERLAMSQYQAGTSTYLSVLTTQAASLANQRGAVQLLGRQLLASVSL
FT                   IKAVGGGWHASDMNQAAANH"
FT   sig_peptide     complement(394272..394367)
FT                   /locus_tag="Veis_0347"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.971 at
FT                   residue 32"
FT   gene            394935..396563
FT                   /locus_tag="Veis_0348"
FT   CDS_pept        394935..396563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0348"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: jan:Jann_1794 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56138"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A1WET1"
FT                   /protein_id="ABM56138.1"
FT                   /translation="MAILAWIVLAIVAVAAGVAFLQRFYRKSSRDTAILRTGAGGQRVA
FT                   LDGGFFALPILHRLDEINMRAQRVLIARSGASSVLTKDCLRADVSLEFRVRVAASGEAV
FT                   ATAAQTFGARTLRSDELGRMLEGRFTDVIQASAAERTLDELHGQRAAFVASVRETLLPE
FT                   LTRNGLLLESVALTHFDQTPFSALNENNVFNAVGMRKLAEIVASNKKRRAETEADAEIS
FT                   IAQTQLQANKRRIEMALQQDAAQLHQRQETESRRTKVDADLAKARESAQLTAESAKLER
FT                   ERALSVLQIQRDHGLEQTKLETRLAVELQRVQQAMALSREQEQEALAAISGEKARTQLL
FT                   LAQELGHTEREKAIQLREHELALARTRQEAETENLRTKAQAGTLLELASAEAQAMQVRA
FT                   QGKEAGMRAEAQGTAAGIAADNAQSPDLMRLRLELARLEALPLLAEKMSKPLEKIESIR
FT                   VHHVSGIGGGGGDGGKGGPLDSIYDMAMNLPMLKKLGETLGADLEMGIPQLARAESDHA
FT                   RAANDHQRAQNSLTPPAQPRPGDSK"
FT   sig_peptide     394935..395000
FT                   /locus_tag="Veis_0348"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.783) with cleavage site probability 0.635 at
FT                   residue 22"
FT   gene            396560..397783
FT                   /locus_tag="Veis_0349"
FT   CDS_pept        396560..397783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0349"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rpc:RPC_3020 putative UreA/short-chain amide transport
FT                   system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56139"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WET2"
FT                   /protein_id="ABM56139.1"
FT                   /translation="MKATRRSVSIRFAGLAAALALPRWAHAADPIKFGSLLDTSGNFDA
FT                   YGKPMNMATDLAIDEINRSGGLIGRQIKKSAYDTQSNMAMYTKFAQQLARQDKVDVVIG
FT                   GILSASREAIRPLLNREKILYVYTPLYEGGVCDGNTFLTGTTPAQQAEVLVPYAVKKWG
FT                   RKAYILAADYNYGQYMAKWFQKFLAESGAADVGLEFFPLDVSDFNSTIAKIQAAKPDFV
FT                   ISALVGGAHLSFYRQWAAAGMKGKIPLVSTTLGVGNEHQVLTAAEGDGILVAYNYSPEL
FT                   QTPANKVFLQAWGKMHGGNTKAINELAVLHYQGIKLWAEGVRKAGSLERAKVIGAMASG
FT                   ISIDGPSGKVSIDGPTHHVTLDVHVMEIRGQQLKVLQSFAQRPPRETQAVCNLVKTPAS
FT                   STQFEIKL"
FT   sig_peptide     396560..396643
FT                   /locus_tag="Veis_0349"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 28"
FT   gene            397890..398762
FT                   /locus_tag="Veis_0350"
FT   CDS_pept        397890..398762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0350"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rpd:RPD_4291 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56140"
FT                   /db_xref="GOA:A1WET3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1WET3"
FT                   /protein_id="ABM56140.1"
FT                   /translation="MSIDIVFVSVFDLAYTVATLALVSAGLALIFGLMRVINLAHGEFI
FT                   VLGGYTTIVALRMGCNIWLAMLIVAPIVVGCFGFLVERLVIRHLYGRTVDTMLATWGLS
FT                   LALSGALSMIFGTTTTGVPNPVGSLSIGQYQVGGYSLFIIAVSTLLLASLYFVLRSMRV
FT                   GMIVRGAMQSAEIAAALGHSPQRIYMATFVAGSMVSGLAGGVLSPLVGLTPSAGGQFIA
FT                   KAFITVIAGGASVVAGTVSASALLGTVAKVFELLSSPVVGEMALLICAVILLRVLPQGI
FT                   TSRWFKGAA"
FT   gene            398759..399820
FT                   /locus_tag="Veis_0351"
FT   CDS_pept        398759..399820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0351"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: hwa:HQ3617A
FT                   ABC-type UreA transport system, permease protein II"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56141"
FT                   /db_xref="GOA:A1WET4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1WET4"
FT                   /protein_id="ABM56141.1"
FT                   /translation="MTNPDAQLGPTQRRLQRTVRADRIPASWWSGFAATLLVLAAAPVA
FT                   VSEYNLTLLLTYALLALSLAFVWGVAGILCFGQAAFYGLGAYTYAVVAINMGGSTLAVV
FT                   LAITVAGCAALALGAMMFYSRMADVYLGVITLVATLLLFKYANSTAGQAYAIGTARLGG
FT                   FNGIPGFPVLGVPGWPDTLVTGMALYFVGMVALLLCWLMFRWLAVRPFGRLLAGIRENE
FT                   LRAELSGHDVRLAKTLAFGLGGAVAGLAGVLYACWAEIVTPEVFSLGVSAEIIIWVLVG
FT                   GLGTLWGPMFGAVLLGALKGLLGSQQWMDNGVVMGLLLVVVVLFLPSGLLPSVLRGVQY
FT                   CSRRAALKARHEA"
FT   gene            399810..400541
FT                   /locus_tag="Veis_0352"
FT   CDS_pept        399810..400541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0352"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rpd:RPD_4289 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56142"
FT                   /db_xref="GOA:A1WET5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1WET5"
FT                   /protein_id="ABM56142.1"
FT                   /translation="MKHDTVLEAQDVVMRFGGVTAVDGASMKLKRNELRCLIGPNGAGK
FT                   STFFKCLSGQLVPTEGDIILNGEHVAGRLVHEIARMGVALKTQVPSLMNGLSVHENLWL
FT                   AALARHSRADANAQVERLIGELGLAAHARSLAGALAHGQRQMVELGVVLATEPWLVLLD
FT                   EPAGGLTRDEVERMAEIVKNLAMRATVVVVEHDMNFVRAIAETVTVFHHGRILAQGNAE
FT                   TVLSDERVRAVYLGKQHGTPA"
FT   gene            400538..402919
FT                   /locus_tag="Veis_0353"
FT   CDS_pept        400538..402919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0353"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; ABC transporter related; SMART: AAA
FT                   ATPase; KEGG: bch:Bcen2424_4287 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56143"
FT                   /db_xref="GOA:A1WET6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1WET6"
FT                   /protein_id="ABM56143.1"
FT                   /translation="MNAAAQKTAPALQVDGIEAGYGAMPVLRGLTLNVQHGEIVGVLGA
FT                   NGMGKSTLMKTLAGVLPLHAGAIRADGVLLNPLPIHARARLGLSYVQQGRGILGGLSAR
FT                   ENLRMAWSPGLGESEDAALERVLGLFPRLQRLLERKGAALSGGEQQLLALARALVSQPW
FT                   LLLLDEPTEGIQPNIISEMAHTLAQLRAQQGLTILLTEQNLDFVLDCADRILMLEKGAI
FT                   VKSFGAAELKSSPALDGLMGWGAARSTRTPDISAPIEAPAAPPAQAPSQAPARAPITAT
FT                   TPVHKENTMALRRPNMEQLRTLTRSLHMNLSDAELAQYLEQMEASFQAYDRVDALPDFV
FT                   PEVKYARTPGRRPSADENKLNAWYVKTDIRGAETGPLKGRQVVLKDNIALAGVPMMNGA
FT                   STLEGYVPAFDATVAQRVLDAGGTIIGKAHCEYFCLSGGSHTNATGPVHNPWRMGTIAG
FT                   GSSSGCGALVGSGEVSLAIGGDQGGSIRIPSAFSGCCGMKPTHGLVPYTGAMPIESTID
FT                   HLGPITGNVADNALLLEVLAGEDGLDPRQYSPKLAQYTDALSMGVEGLRIGILREGFGM
FT                   PGETPGLGAKVRAAADQLARLGARVREVSVPMHLDGAAIWTPIALEGLQAQMMNGNGMG
FT                   FNWRGLYDVGLMDRHAAWRTRADALSPSLKVSMFVGEWFIRNHGGRFNAKAQNLSRQLR
FT                   ATYDRSFDEVDLLLMPTLPMIARQIPKPGSPIAEIIARAFEMLANTASFDATGHPAMSL
FT                   PCGLLDGLPVGVQLVGKHWDEFTIYRAAASLERAADWRTL"
FT   gene            402916..404646
FT                   /locus_tag="Veis_0354"
FT   CDS_pept        402916..404646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0354"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   reh:H16_A3514 long-chain-fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56144"
FT                   /db_xref="GOA:A1WET7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A1WET7"
FT                   /protein_id="ABM56144.1"
FT                   /translation="MSRNPFSSIEVDISAQRPLRGLSHVRGATVPDLVTETIGGLLDRA
FT                   VETHGAQPAFVFVEHGIRWSWRQFSEAVDRVAAGLLCLGAQRGERLGIWSPNRPEWVLT
FT                   QFATARLGVILVNINPAYRTSELEYALNEAGVHILISAVGLKSSDYLGMLRDLAPELAD
FT                   CAPGKLQAKRLPELRSVVQMGRCAQPGMFSFEQLQSLAGPAQINRLSLIESQLDAHDAI
FT                   NIQFTSGTTGQPKGATLTHHNVVNNARFVAHAMRLGPSDRLCVPVPLYHCFGMVLAVLA
FT                   ATSTASCLVFPGESFDAAATLAAVATERCTALHGVPTMFVAMLGLAHFAQFDLSSLRTG
FT                   IMAGAPCPIETMRQVLSDMHMPEVTIAYGMTETSPVSFQSAVDDSIEQRVGTVGRIMPH
FT                   LEVKIIGEDGKTRPIGQVGELCTKGYAVMQGYWADPQRTREAVIDGWMHTGDLATIDAF
FT                   GYCRIAGRLKDMLIRGGENIYPREIEEFLYRHPAVSQAQVFGIPSAKYGEEVCAWIVLK
FT                   PQAQASPESIREHCRAHLAHFKVPQHIKLVASLPMTVTGKAQKYLMREAMMKELGLATG
FT                   "
FT   gene            complement(404799..405902)
FT                   /locus_tag="Veis_0355"
FT   CDS_pept        complement(404799..405902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0355"
FT                   /product="recA protein"
FT                   /note="KEGG: rfr:Rfer_3948 RecA protein; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56145"
FT                   /db_xref="GOA:A1WET8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WET8"
FT                   /protein_id="ABM56145.1"
FT                   /translation="MDVAVKGSHPAFPVNAEKAKALAAALAQIEKQFGKGTIMRLGEGE
FT                   VIEDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLALQVIAEMQKQGGTCA
FT                   FVDAEHALDVQYAQKLGVQLSDLLISQPDTGEQALEIVDSLVRSGAVDLIVVDSVAALT
FT                   PKAEIEGDMGDALPGLQARLMSQALRKLTATIKKTNCMVVFINQIRMKIGVMFGSPETT
FT                   TGGNALKFYASVRLDIRRTGTIKKGDEAIGNETKVKVVKNKVSPPFKTAEFDILFGEGI
FT                   SREGEIIDMGVNAKIVEKSGAWYAYNGEKIGQGRDNAREFLRENPDLAHEIENKVRHSL
FT                   GIALLPDAQPAPVLPGAQPAPAAAANG"
FT   gene            406012..406593
FT                   /locus_tag="Veis_0356"
FT   CDS_pept        406012..406593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0356"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: pol:Bpro_4686 transcriptional regulator, MarR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56146"
FT                   /db_xref="GOA:A1WET9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WET9"
FT                   /protein_id="ABM56146.1"
FT                   /translation="MADPTPTAPAAAPCATPPAAPLAAPSTTPSTTPSTAPPAAPDERW
FT                   RQTHLGRLMGSALRRFDARVLQLMARNVEVPLALSNLAARAQVMAAHVHITRHLALSGD
FT                   RLTDLARRAGMTKQAMAPLVDQCAAWGLVTRAVDPLDARARRVQFTAVGLAWLQAFRDA
FT                   VAQAEAEFREEVGQEVATVVAIGLEAYAGA"
FT   sig_peptide     406012..406083
FT                   /locus_tag="Veis_0356"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.892 at
FT                   residue 24"
FT   gene            406675..407355
FT                   /locus_tag="Veis_0357"
FT   CDS_pept        406675..407355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0357"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: pol:Bpro_4687 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56147"
FT                   /db_xref="GOA:A1WEU0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEU0"
FT                   /protein_id="ABM56147.1"
FT                   /translation="MRILIVEDDQVLADGLLRTLRASGAVVDHVASGSEADAALLTNNE
FT                   FDLLILDLGLPRMHGLEVLKKLRGRGMALPVLILTAADSVDERVKGLDLGADDYMAKPF
FT                   SLQELEARVRALTRRGMGGTSSAIRHGPLVYDQAGRVATIDGKMIELSARELGLLGVLL
FT                   QRVGRLVSKEQLVERLCEWSEEVSNNAIEVYIHRLRKKIEGGPIRIATVRGLGYCLEKI
FT                   PVSY"
FT   gene            407459..408907
FT                   /locus_tag="Veis_0358"
FT   CDS_pept        407459..408907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0358"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   Two-component sensor kinase N-terminal domain protein;
FT                   KEGG: rfr:Rfer_3951 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56148"
FT                   /db_xref="GOA:A1WEU1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEU1"
FT                   /protein_id="ABM56148.1"
FT                   /translation="MKIFQREQRSLFGEILDWMLTPLLLLWPVSLALTWLVAQGLANKP
FT                   FDRALEYNAQALAQLVGVVGDKAQFHLPLPASELLRADDSDTVYYQVIGPGGYFLSGER
FT                   ELPGPPDDELPLPGEVHLRDAEMRGIDIRVAHLWVRLPLPGNPLALVQVAETRAKRSVL
FT                   ATEIIKGVMLPQFVILPLAVLLVWLALARGIQPLHQLEQRIRARNPDDLSPLDERAVPL
FT                   EVAPLVLSVNDLLKRLNDSVATQKRFLADAAHQLKTPLAGLRMQADLAQREGTSTEEIR
FT                   RSLQQIGRSSIRATHTVNQLLALAHAEGSGVGIARQPCDLARLVIEVVRDSVPRALDKH
FT                   IDLGYDGAQPGTPGLLLDGNPTLLKELVRNLLDNAINYTPSGPDKPGVVTARVLADRFG
FT                   QVLLLQVEDSGPGVPEAERELVFQPFYRVLGSEADGSGLGLSIVQKIARKHGAEVTLED
FT                   ARAGQHPPGARFGVRFTALKVQPG"
FT   gene            409191..409682
FT                   /locus_tag="Veis_0359"
FT   CDS_pept        409191..409682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56149"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEU2"
FT                   /protein_id="ABM56149.1"
FT                   /translation="MCACCVEPAAQALGMAAQRPLPDARRQGFCQSGGNAPSPGWSLTL
FT                   WNIPRINTVASIGHRLRPALRSICRQPGAARGRVTPAGIGAGRMAAFMHKKPRFLRACT
FT                   NACASNGLWAADHGRRADPVLLRAPDPLSPFGTCLLLRSWSWAVAAFIFSATGFLSPKR
FT                   "
FT   gene            complement(409642..410331)
FT                   /locus_tag="Veis_0360"
FT   CDS_pept        complement(409642..410331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0360"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="PFAM: peptidase S14, ClpP; KEGG: pau:PA14_21030
FT                   putative ATP-dependent Clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56150"
FT                   /db_xref="GOA:A1WEU3"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEU3"
FT                   /protein_id="ABM56150.1"
FT                   /translation="MNDEQKESTEPPGTMSAKLMEYAINARKVFIIGTIDHKMAKEAVQ
FT                   QLHILASINDDPIYVFISSPGGHVESGDLIFDAIRFITPKVIVVSSGWVASAGALIYVA
FT                   ADKENRYSLPNTHFLLHMKEIIPAGEMTYTETADDRAARERFAQFVSSSYRKKPPEPVN
FT                   KSLHEYRTNVMRARLNRIFAEATGQTLEKITADTGHDFWMSAEQAVEYGLVHEIIVSEK
FT                   EIRSQKK"
FT   gene            410936..411505
FT                   /locus_tag="Veis_0361"
FT   CDS_pept        410936..411505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56151"
FT                   /db_xref="GOA:A1WEU4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEU4"
FT                   /protein_id="ABM56151.1"
FT                   /translation="MSFSPGPNTTMSTALAANLGLKPALRFCLAVPVGWALVMLGSGLG
FT                   LGALIAGRPALRWSVTLLGAAYMFWLACKLGRTGRMTEFDARRLSLGFWQGVGLQFVNI
FT                   KVWMLALTLSAGWVVNAAGRPASNPGERLAIICGVTMVFAFGCNFVYALLGSLLRQWLA
FT                   RGARLLWFNRTLALVLVATAVWMLML"
FT   gene            411542..412822
FT                   /locus_tag="Veis_0362"
FT   CDS_pept        411542..412822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0362"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   pol:Bpro_4240 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56152"
FT                   /db_xref="GOA:A1WEU5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEU5"
FT                   /protein_id="ABM56152.1"
FT                   /translation="MPTSSPSPSPTTTFNTPYLRAARRATVKLNDLPPAIDWTLARRTT
FT                   RMNPSVIREILKITERPGIISLAGGLPSARTFPVSAFAAASAAVLARDGAAALQYAASE
FT                   GFAPLREAVAAFLPWKVAPEQVLITTGSQQALDLVAKVLIDTDSRVLVETPTYLGALQA
FT                   FAPMEPRVVSVAGDDQGVLIDDLRARMGTGADKARFLYVLPNFQNPTGRTMSAARRAAL
FT                   VAAAAELRLVLVEDNPYGDLWYDTPPPAPLTAGNPEGCIYIGSFSKVLAPGLRLGYIVA
FT                   PAAAYPKLLQAKQASDLHSPGYNQRLVAEVIRDGFLERHVPTIRALYKQQCAAMLAALD
FT                   EQMKGLSVQWNRPDGGMFLWLRLPEGMSAQALLPKAVARNVAFVPGAAFYADNADPRTL
FT                   RLSFVTSTVEQIATGIAALAGAIRELA"
FT   gene            412851..413144
FT                   /locus_tag="Veis_0363"
FT   CDS_pept        412851..413144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56153"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEU6"
FT                   /protein_id="ABM56153.1"
FT                   /translation="MSSAASAPRKDEAGGIAPSMQRPWCRVTDHLSVCAGHRSASRRCL
FT                   ACQYSSVWAARCALRCAPMAARSLRHLIGDATLARAVPAAWVGDTQRHGKRR"
FT   gene            413141..413893
FT                   /locus_tag="Veis_0364"
FT   CDS_pept        413141..413893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56154"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEU7"
FT                   /protein_id="ABM56154.1"
FT                   /translation="MTTRAFAAIEPPEPPPCIDHLIVLAADLASGVQWCERQLGVTPAA
FT                   GGEHPLMGTHNRLLNISSPAHPRAYLELIAIQQGATKTIPGGAKRWFDMDDSRLQRQVA
FT                   QHGPQLIHWVAAVPDMVARCAALAAQGLDRGAIISASRATPEGLLQWQVTLRTDGQRLM
FT                   DGCLPTLIQWGATHPCANLPASGLQLHRLTLRHPQMAALQAACAALGLLPQVVLEAAPA
FT                   PELLAQLGTARGPVCLTSRPDMDARRAV"
FT   gene            413958..414632
FT                   /locus_tag="Veis_0365"
FT   CDS_pept        413958..414632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0365"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: rfr:Rfer_3732
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56155"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEU8"
FT                   /protein_id="ABM56155.1"
FT                   /translation="MGILYLVRHGQASLGAADYDQLSPRGQAQALRLGEYWRAQGQTFD
FT                   AVITGTLRRHRQTLAGIAQGLQTRTPEVLQLPGLNEYDSHALIAAVHPQPLGPPDSPER
FT                   YHQHFRLLCAALAQWMAGTISPPGMPRWSAFSAGVHAALTHVRQQHAGQNVLLVSSGGP
FT                   ISTAVGQVLGTQAQVTIALNMRIRNSAVTELSVSPKRLMLQTFNTLPHLAAPEYAHWVT
FT                   HA"
FT   gene            complement(414634..414882)
FT                   /locus_tag="Veis_0366"
FT   CDS_pept        complement(414634..414882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56156"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEU9"
FT                   /protein_id="ABM56156.1"
FT                   /translation="MSAAGSRARQRMVIARPVKPPVWRVPAGTRWHVDLAQGGVLVDLG
FT                   IPVVGHPVKSAGRSLPSRRCCAPSTPGRGMRASMSIN"
FT   gene            complement(414879..415637)
FT                   /locus_tag="Veis_0367"
FT   CDS_pept        complement(414879..415637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0367"
FT                   /product="Ala-tRNA(Pro) hydrolase"
FT                   /EC_number="3.1.1.-"
FT                   /note="PFAM: Threonyl/alanyl tRNA synthetase, SAD; KEGG:
FT                   bam:Bamb_2316 threonyl/alanyl tRNA synthetase, SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56157"
FT                   /db_xref="GOA:A1WEV0"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEV0"
FT                   /protein_id="ABM56157.1"
FT                   /translation="MTQDLFRQDAYLRECSAQITAVTADGAIVLDRTVFYPQGGGQAGD
FT                   SGLLLRADGSSITIADTRKGKDAQGHATADIVHIPAPGQQDRMAQWTPGTAVTARIAWE
FT                   RRHRMMRLHTTTHLLCHLVPHLVNGCSITPDYARLDFAITDPLDKQALNTGIAALVAAA
FT                   HPLTVASISDAELDANPALVKSMSVQPPRGTGRIRTIRIGGQSASAALIDLQPCGGTHV
FT                   ANTAEIGAIVVTKIEKKSATTRRVVLGFAQ"
FT   gene            415692..416540
FT                   /locus_tag="Veis_0368"
FT   CDS_pept        415692..416540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0368"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: rfr:Rfer_3746
FT                   creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56158"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEV1"
FT                   /protein_id="ABM56158.1"
FT                   /translation="MTAAAFHLPSRFWAELSTRAFAQLKASGQAAQTVAVLPVAAIEQH
FT                   GPHLPLSVDATLLQGVIDAALPQLPAGLPVLFLPPQNLGLSPEHLRFSGTLTLSPATVI
FT                   ALWTEIGECVARAGVRKLLLFNGHGGQVSVMDIVARELRTRCDLIVYGASWFSLPLPDA
FT                   VAGQFSAQEHRFGIHAGEIETSMMLHLSPATVQMEQARDFRSSAQHRAGQYAILGNGRT
FT                   AKLGWQMQDYHPAGAVGNAAAATAEKGRSVVTAAAAQLVALLQELHALPLSTLVGETEV
FT                   F"
FT   gene            complement(416849..417706)
FT                   /locus_tag="Veis_0369"
FT   CDS_pept        complement(416849..417706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0369"
FT                   /product="ornithine-acyl[acyl carrier protein]
FT                   N-acyltransferase"
FT                   /note="KEGG: rfr:Rfer_2028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56159"
FT                   /db_xref="GOA:A1WEV2"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEV2"
FT                   /protein_id="ABM56159.1"
FT                   /translation="MMNASHPSPAAVTAAIAPAIAGDLGQRPGLAPKTTNPGQERAAIR
FT                   VAWARHLDEVRQAQRLRFRVFATEMGARLSTTLAGHDVDRFDDYCEHLLVRDAQSQQVI
FT                   GTYRVLTPAQARRIGGIYSDTEFDLGRLHALRPRMVELGRSCVHPEHRHGAVIMALWTA
FT                   LADFMLRNQLDTMVGCASIPMLHNGVVSGAAAASIWQRLRQTHLAPAEYQVQARLPLPV
FT                   EQFDGSMAAEPPALIKGYLRLGAQVLGAPAWDPDFNTADLPMLMRLAQLHPRYRRHFLG
FT                   PDAR"
FT   sig_peptide     complement(417641..417706)
FT                   /locus_tag="Veis_0369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.957 at
FT                   residue 22"
FT   gene            417926..420871
FT                   /locus_tag="Veis_0370"
FT   CDS_pept        417926..420871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0370"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and Chase sensor(s)"
FT                   /note="KEGG: rfr:Rfer_0458 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56160"
FT                   /db_xref="GOA:A1WEV3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEV3"
FT                   /protein_id="ABM56160.1"
FT                   /translation="MPVSTPSLRPLTAFVGVFALAAACAGVLIWTLESQDRAEQRSQAA
FT                   DMAGDHVQALQRAIELALSANNALVALVRQGRGSVPQFEEIGTQMLPFYPGIAAMGLSP
FT                   SGVVRQVVPRQGNEGAMDFDMLHDPQQGTESAHARASGRLTLAGPMELAQGGLGVVGRQ
FT                   PVYLDDEQGQRSFWGFTYVAIRLPDVLAAARLDQLTARGYRYRLWRVRPDNGQEQTIAA
FT                   SAPPAGAGAMSRSLALPNGQWTLGLTPAQGWGAAGVLALRCALGLLFALLMAYLARLLF
FT                   ALKAHERGLADQVAQRISEIQATQQQLRATIDAIPDPLFEIDQDGRYCSVHSQRAELLM
FT                   GPAEQLIGRNVTEVLPTLAALSVLDVLHEAQAQGWSVGRQIMLDLPDLGPTWFELSAAR
FT                   KPQAAGAKPRIILLSRDITERKRSQEQLQLTAQVFDQSSEAIVIADASHRIVRINRAFS
FT                   RITGYQESEAVGQSVRLLTMAEAGPDCNADAVYARLARQERWEGESWGRRKDGSGYPQW
FT                   LSVSSVRDGDANGPITHSITLFRDISLQREAQERIQRLAHFDPLTDLPNRVLLAERTQR
FT                   QIAQEQARGGQLALLFLDLDHFKNVNDSLGHRIGDILLVAVARRLQSLIGPQDTVSRLG
FT                   GDEFLLLLPATSAAHAAKVASALLTAVAQPFQIDPYELSTTLSVGIAMCPADGESFDTL
FT                   YQRADAAMYSAKQSGRNRYGFFTADLQARTARALQIENALRRALERQQFELHYQPQVSL
FT                   GTGQVVGAEALLRWHHPELGVVAPAEFIPVAENSGQIVALGEWVLHTAARDAKRWLDMQ
FT                   LPLRAVSVNLSAVQFRHPQLPEMVTRCLQQAGLPARRLELELTEGAAVDDPVAALAMMD
FT                   QLHDRGVRLSMDDFGTGYSSLSCLKRFQIYKLKIDQSFVRDLDDDANDRAIVSAIIRMA
FT                   QALGMQTTAEGVETDGQLQFLRAQGCDEGQGYLFSRPLPADAFEAYLRAMK"
FT   sig_peptide     417926..418003
FT                   /locus_tag="Veis_0370"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.747 at
FT                   residue 26"
FT   gene            complement(421084..421524)
FT                   /locus_tag="Veis_0371"
FT   CDS_pept        complement(421084..421524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0371"
FT                   /product="putative lipoprotein signal peptide"
FT                   /note="KEGG: rso:RS03192 probable lipoprotein signal
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56161"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEV4"
FT                   /protein_id="ABM56161.1"
FT                   /translation="MQEWPTAFLLSGPHAMRAPLRAGDDYRDERVRAAFVMAPALAQAF
FT                   DRGSLARIVIPVSMLVGDNDDQAPAKTNAAWMAAQMQHAKLREIRNGTHYMFIAQCTPS
FT                   GQAQQRQICTDPSGLSRAQVHRDTVAQAVAFSVAFFDAALSP"
FT   gene            421683..422432
FT                   /locus_tag="Veis_0372"
FT   CDS_pept        421683..422432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0372"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   bpe:BP0152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56162"
FT                   /db_xref="GOA:A1WEV5"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEV5"
FT                   /protein_id="ABM56162.1"
FT                   /translation="MSLATQKIDWRIVASGDSCLVVEIRTAPAAGRIDPVLASQWAGAA
FT                   ATALRQAGLPGVTDVVPAMVTVGVHYRPQALQSLALPGESSYQAAARVVAALLEPLEWQ
FT                   EAQAARVVEVPVCYGGEHGPDLASVAAACGLSPQGLIDLHAGAQVRVLMMGFAPGLPYI
FT                   GSFDTRLAVPRRPQPRMAVPGGSIGLANRQSVIYPFTLPGGWSLIGRTPMQLFDPNRDP
FT                   ACLLQAGDGLRFVPISAATFGALAGAR"
FT   gene            422432..423385
FT                   /locus_tag="Veis_0373"
FT   CDS_pept        422432..423385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0373"
FT                   /product="urea amidolyase related protein"
FT                   /EC_number="6.3.4.6"
FT                   /note="KEGG: bbr:BB4478 hypothetical protein; TIGRFAM: urea
FT                   amidolyase related protein; PFAM: Allophanate hydrolase
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56163"
FT                   /db_xref="GOA:A1WEV6"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEV6"
FT                   /protein_id="ABM56163.1"
FT                   /translation="MIEVLKPGALSSFQDLGRSGYQHQGIPVCGVMDERAHRLACMLVG
FT                   NGAGEATLEVTLIGPALQFHCPAIIAVCGADLGATLGARALPLARPVAVAAGEQLCFGK
FT                   RVSGLRAYLAVAGGYALQPVLGSTSTYLRGGFGGAQGRALQKGDWIALRQTQRTATPAP
FT                   RARLPLFPGDIQRPPGAPLRIVPGREWAAFAPRARQAMSAQTFRVSPRSDRMGYRLEGP
FT                   ALHLSQPLELASEAVSFGSIQVPPDGLPIVLMADRQTTGGYPRIANLATVDLPLLAQTM
FT                   AGESLRFEWVTLGQAQRLASAQSAVFNQMEAGHGQH"
FT   gene            423372..424196
FT                   /locus_tag="Veis_0374"
FT   CDS_pept        423372..424196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0374"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: bbr:BB4479
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56164"
FT                   /db_xref="GOA:A1WEV7"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEV7"
FT                   /protein_id="ABM56164.1"
FT                   /translation="MASIDLNSDVGESYGRYQLGDDAAVLDHVSSANVACGMHAGDPST
FT                   IATTVGLALARGVAIGAHPGFADLQGFGRRPMQLAPDALYHLVLYQIGALQAFCTAAGT
FT                   RLAHVKAHGALYNMAVRDSAMAHAICCAVRAVDARLIFYGLAGSELVRTARAAGLTVAE
FT                   EVFADRSYQDDGSLTPRTDPRAMITDIQQSVEQVLRMVRSGLVRSVHGVDVPVRPDTLC
FT                   IHGDQPGAAQFAQAIRAALEAEGIAIAPITRPNGSPNSGPIADPHRRAAATP"
FT   gene            complement(424249..424407)
FT                   /pseudo
FT                   /locus_tag="Veis_0375"
FT   gene            complement(424413..425057)
FT                   /locus_tag="Veis_0376"
FT   CDS_pept        complement(424413..425057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0376"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: pol:Bpro_0249 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56165"
FT                   /db_xref="GOA:A1WEV8"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEV8"
FT                   /protein_id="ABM56165.1"
FT                   /translation="MNSRSERLLLSGAAGAIEAVRDGVEAPRGVAIIAHPHPLFGGTMD
FT                   NKVVQTLARAFVQCGWTALRFNFRGVGASAGLHDAGRGELQDLLAVAEQVAPHSAGQRI
FT                   ALAGFSFGASVASHALAALWPQGRVEHLVLVGLAASRCAAAPLPPEAHLRTLVVHGEHD
FT                   DTVPLSAVLDWARPQVLPVTVIPAGGHFFHGQLPLLKSLVLRHLRSVAAPP"
FT   gene            complement(425121..425480)
FT                   /locus_tag="Veis_0377"
FT   CDS_pept        complement(425121..425480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0377"
FT                   /product="ferredoxin-like protein"
FT                   /note="KEGG: pol:Bpro_0248 ferredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56166"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEV9"
FT                   /protein_id="ABM56166.1"
FT                   /translation="MNTPPCAPAAAPGYYRRHIFFCLNERSNGENCCARHHAQAGFERC
FT                   KAQVAAAGLAGAGQVRVNKAGCLDRCAGGPVAVVYPEGIWYSYVDAADIDDIVEAHLKN
FT                   GQVVERLRMPAEIGR"
FT   gene            complement(425896..428478)
FT                   /locus_tag="Veis_0378"
FT   CDS_pept        complement(425896..428478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0378"
FT                   /product="outer membrane protein"
FT                   /note="TIGRFAM: outer membrane protein; KEGG: pfo:Pfl_0160
FT                   glycosyl hydrolase, BNR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56167"
FT                   /db_xref="InterPro:IPR011801"
FT                   /db_xref="InterPro:IPR028059"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEW0"
FT                   /protein_id="ABM56167.1"
FT                   /translation="MASTITIDKTIVKAGETAWISLTFPNNETMYRANGLVRFLTVTGG
FT                   SLNHGTLIRIGAGTNTYRVQFIPTEGLEKSDAKVRYDSPNDESDGELTFAIDTLRPTVA
FT                   SASIAKSDLRLGEKTTITITFSERVTRSSFTLEDLQVDAGKGTLSNLRVAPSDTTATTA
FT                   AATTWLVDLEAPATRPATGLHGNQIRINLDGITDVPGNAGASRGVSVPARYNIDDGVPP
FT                   TGTIALSATSLKAGETMIVTFTFSENVPNFGLDAIQYDTSKGTLSALTQSSTDSKVWTA
FT                   TYTPRSDTENANNTIRVNLASIRDAQGNAGSGTPSSGNFSIDTLRPTVDVTISDNRLTV
FT                   GETATITFTFRESVTGFDLGDVQYDTSKGTLGALTAVGTDGKVWSATYTPRPDIESTEN
FT                   TIRVNLSGVRDARDNAGEGTATSGNFSIDTRPPVNVTISDNRLTAGETATITFTFNERV
FT                   TGFTKEAIDLSQANGTLGDLTAVGTDGKVWTATFTPTANLARTTNHRLTLNLANVRNAA
FT                   GNTVANNTYAFNQYTVDTMVFALSSATANRDQLVLSYSDATALDGNADHAPTNESFTVL
FT                   VDGTRIDVSRVTVDAAARTVTLTLARAVTTGQTVTVAYQDTDTSDNKALQEAGTGDDAA
FT                   SFAARAVTNLTQPPVAPATPEAPGAGAPDDDRDGVPNSLEDLAPGLLRPDGSAGLAGDG
FT                   NGDGVKDSQQAAVASTRDQTLVAGSQNGKLLPDSNARITELVRSDAPANLPKGMEMPIG
FT                   LTSFKASLAEGRSTESFSLYVDPALGANGYWLKNSAGIWVNLASEPYGGKVASEGGRTR
FT                   LDFQIQDGGQYDADGQVNGSISAPGAVAKMPLSIVGQASDAHSFGFWY"
FT   gene            complement(428499..428735)
FT                   /pseudo
FT                   /locus_tag="Veis_0379"
FT   gene            complement(428922..430046)
FT                   /locus_tag="Veis_0380"
FT   CDS_pept        complement(428922..430046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0380"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: rfr:Rfer_3803 VanZ
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56168"
FT                   /db_xref="GOA:A1WEW1"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEW1"
FT                   /protein_id="ABM56168.1"
FT                   /translation="MHQSSAGPLALSYAALIVFASLFPFEGWRAQGIDPLVFLLAALPP
FT                   PYWTWFDVLTNAAGYAPLGFLLALGLLRTGSGRRAVLLATLAGALLSLAMEFLQIYLPR
FT                   RVPSNLDLALNAAGALAGASIAALLARLGVLGRWHDWRERWLLPDASGAMVLLALWPPA
FT                   LLFPAAVPFGLGQVQQRLETALIGWLAHTPSMPSMPLPDGLPLRQTALAPLSPGGELLC
FT                   VALGLLAPCLLGYCVIRQARHRVLLALALAALGIALTALSAALSWGPVHAWQWLNRPAR
FT                   AGLWAALALALLLLALPRRACAAMLLLALVWQLALLNQAPTSAYFAQTLQLWEQGRFIR
FT                   FYGLGQWLGWLWPYATLLYVLLRVSGRQRHEPLS"
FT   sig_peptide     complement(429984..430046)
FT                   /locus_tag="Veis_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.948 at
FT                   residue 21"
FT   gene            complement(430058..430453)
FT                   /locus_tag="Veis_0381"
FT   CDS_pept        complement(430058..430453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0381"
FT                   /product="conserved hypothetical protein 701"
FT                   /note="PFAM: conserved hypothetical protein 701; KEGG:
FT                   pol:Bpro_0246 conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56169"
FT                   /db_xref="GOA:A1WEW2"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEW2"
FT                   /protein_id="ABM56169.1"
FT                   /translation="MTCWFAGLFYLPRIFVNLALLAPGAAAERERLLLMARKLLRFTTL
FT                   LSAPALALGVWLWLGYGIGRGPGSGWMHAKLAVVLLVIGYHHGCGRLLRQLADGRCRRS
FT                   PVWLRWFNELPLLLLTAAVLLVVLKPF"
FT   gene            430610..431338
FT                   /locus_tag="Veis_0382"
FT   CDS_pept        430610..431338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0382"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: reu:Reut_A1792
FT                   regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56170"
FT                   /db_xref="GOA:A1WEW3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEW3"
FT                   /protein_id="ABM56170.1"
FT                   /translation="MQARTPIVKRSARRTAAITEAGRPDRRQAILLAAEKLFAQHGYHA
FT                   VTIRQIAEQAGVPLALVGYYFGPKHALFHAIFEHWSHTIDERLAGLAALDNDPDDPRTL
FT                   VRIIEVFTGPVLALRAGAEGEYYALLVSRELGHATAEVDRVLRGYFDPLAQAYIDALHL
FT                   ALPHATRSQVAWGYQFTLGALLHHLSDTRIERLSHGQNKRSDPAVAPMLVNFIVGGLRA
FT                   ALPRPQPGRAQETIPGSEPT"
FT   gene            431335..432273
FT                   /locus_tag="Veis_0383"
FT   CDS_pept        431335..432273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0383"
FT                   /product="NlpA lipoprotein"
FT                   /note="KEGG: mes:Meso_3542 NlpA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56171"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEW4"
FT                   /protein_id="ABM56171.1"
FT                   /translation="MTPKRRTLLWALAAATAPAVRAQSNPKIVFGYTAVTDFASVFVAA
FT                   EEGGFKRRNLDVELKFIALNSIIPAALQSDSLQIGGPTPSVFLQAVDGGLDLVLVAGGA
FT                   VTSKTITSFGLVARAGSGIKSAQDCVGKKIGVPGLGAFLHVTFRAWLKNSGVDYRKVHF
FT                   VEVAFPQHGDLLRGGSVDAVVSADPFMSRITDSGAGYVASYYSTFLPENNQTIVHAAKR
FT                   EWVASNPAAVHAFRQALLESANFMQQPKNDAKVRAAIGKYIKLPPEVLVKLQISPPGPM
FT                   VSDRQLAYWSALMKEQDMLKTDIDVARLIVK"
FT   sig_peptide     431335..431403
FT                   /locus_tag="Veis_0383"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            432270..433136
FT                   /locus_tag="Veis_0384"
FT   CDS_pept        432270..433136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0384"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mes:Meso_3541 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56172"
FT                   /db_xref="GOA:A1WEW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEW5"
FT                   /protein_id="ABM56172.1"
FT                   /translation="MICAPASITASAASTAGAPGALRAPAGSAAPPAPFLRLDGVAIRF
FT                   GGREILTPTSFDVAHGEFVCIVGPSGCGKTTLLRAASGLVRASAGEVRRNGVKMTGPVR
FT                   EVAFVFQDYGRALLPWRTVAGNVSLAFEAAGVPAAERGPRIADVLGKVGLVKHAQKFPV
FT                   QLSGGMQQRVQIARCLAQKPELMMMDEPFGALDALTRQSLQDELARLVRDDGLTVLFVT
FT                   HDLEEAIYLADRVIALRANPGPGRPSLARMIDVGLERPRDHLTTKEHPDYLRLRRELFA
FT                   FIEHSHD"
FT   sig_peptide     432270..432359
FT                   /locus_tag="Veis_0384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.455 at
FT                   residue 30"
FT   gene            433129..433908
FT                   /locus_tag="Veis_0385"
FT   CDS_pept        433129..433908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0385"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mes:Meso_3540
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56173"
FT                   /db_xref="GOA:A1WEW6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEW6"
FT                   /protein_id="ABM56173.1"
FT                   /translation="MTEMAQGRLLRWLRPWVFPALLAAAFEWYARRAAALGSDALAPPS
FT                   AATRALVGAALDGSLWHATGFTLGTAALGLLLGTALGLALGLVLGISRRAAQLGFLSIE
FT                   VLRPVPCVALIPLSMLTFGFGVRMELGIVAFATFWPLLVLVQSAVQQIEPRLLEVSRVL
FT                   GLSARERTFKIVLPAIVPRLFVALRLGVALALVVAVTVEIAANPYGMGYAMMIAQQSFE
FT                   PALMLAWLGWIGVVGFAVNAGMVLLQRLVARRMGALS"
FT   gene            433905..434705
FT                   /locus_tag="Veis_0386"
FT   CDS_pept        433905..434705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0386"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mes:Meso_3540
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56174"
FT                   /db_xref="GOA:A1WEW7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEW7"
FT                   /protein_id="ABM56174.1"
FT                   /translation="MNGNGHPRLGADGLGALGALAVLGALVALWWGASNAGWVSRVFLP
FT                   TPQAVFASLLEGLDLSRDAGNGELIAFTQATVGHMLQGWLLASLFGVLLGTAIGVSPVA
FT                   RAWVQPTLEFIRPLPASALLPLALSIFGLNRGTVLFVVAFGAMWPVLLATVHGLATLEP
FT                   RLSEVARCLQMSRGAQVWKMGLPNAMPDILAGMRLALTVALIVAVVGEMIAAQSGLGQA
FT                   ILLAARAFRASDLFAGIALLGGIGFVSNALLAGAEKRWLRWQHP"
FT   sig_peptide     433905..434015
FT                   /locus_tag="Veis_0386"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.650) with cleavage site probability 0.614 at
FT                   residue 37"
FT   gene            434764..435570
FT                   /locus_tag="Veis_0387"
FT   CDS_pept        434764..435570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0387"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG:
FT                   bur:Bcep18194_C7460 putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56175"
FT                   /db_xref="GOA:A1WEW8"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEW8"
FT                   /protein_id="ABM56175.1"
FT                   /translation="MPRKFVDLSIFLENDVLSDPPAFAPKIEYFTHDQTYEQIASFFPG
FT                   LQRADLPDGEGWAVERVQMSTHNGTHLDAPYHFHSTMDKALGKRRPAIAIDEVPLDWCF
FT                   QPGVKLDFRHFADGYVVTVDDVQAELQRIGHTLSALEIVLVNTRAGSRYGHGDYVSAGA
FT                   GMGYKATMYLLERGVRLTGTDAWSWDAPFVHTAKKYGQTQDASLIWEGHKAGREIGYCH
FT                   LEKLHNLEVLPPTGFFISCFPHKIRGASAGWTRAVAIFDDALMASA"
FT   gene            435656..436732
FT                   /locus_tag="Veis_0388"
FT   CDS_pept        435656..436732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0388"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   pol:Bpro_0245 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56176"
FT                   /db_xref="GOA:A1WEW9"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEW9"
FT                   /protein_id="ABM56176.1"
FT                   /translation="MPEHEGQAAPALRAGDFRQNFPMPVQSPAPFPQSRPRRLRRDAFT
FT                   RALVREHALAPQDLIYPVFVHEGQNQRQAVASMPGVDRLSLDLLLPVAEDCLRLGIVVL
FT                   ALFPVIAPALKTPDAREALNPEGLIARVVRALKKELPELGLMTDVALDPYTSHGQDGVL
FT                   GPAGDIINDDTVALLTRQALTHAEAGVDIIAPSDMMDGRIGAIREALEVQGHIHTRIMA
FT                   YSAKYASAFYGPFRDAVGSRSALGQADKNTYQMDPGNSDEALREVAIDIAEGADMVMVK
FT                   PGMPYLDIVRRVKDEFRMPTFVYQVSGEYAMIKAAAANGWLDHDAVMMECLLACKRAGA
FT                   DGVLSYFARDAARLLLKR"
FT   gene            436832..437959
FT                   /locus_tag="Veis_0389"
FT   CDS_pept        436832..437959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0389"
FT                   /product="Mg2+ transporter protein, CorA family protein"
FT                   /note="PFAM: Mg2+ transporter protein, CorA family protein;
FT                   KEGG: pol:Bpro_0244 Mg2+ transporter protein, CorA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56177"
FT                   /db_xref="GOA:A1WEX0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEX0"
FT                   /protein_id="ABM56177.1"
FT                   /translation="MRIFHIHGGGVQELAALPARMPAQGFVWIACSRPVFQARLADIQG
FT                   SLQALAGLQLVDLHVSDLLNAQLPSHFDYTSQYDLLVFRRLASAQGHAAAAPQDGPAPA
FT                   GKRRGPPVLRRIDTSPVGFALFDQLLLTVHPDDCAVRNAYAARLLAALPGASPAEGRSS
FT                   PLPGARLPGSPADLMLRVIHLMVDGYLDLRRELTRQLDHWQTELLKPRARGVNWASLLQ
FT                   ARLALHALDEICEGQRAALQDWIETLETWALPDSPAGLRELDLLKVRSRDVLEHIERVV
FT                   RHVRRLEQSTETAVQIHFSVQSQRTNDTMRTLTALTAVFLPLNLMAGIFGMNFEFLPLT
FT                   DKANGFWWALAAMLFIALALLLLFWRKRYLARSGR"
FT   gene            complement(437972..438511)
FT                   /locus_tag="Veis_0390"
FT   CDS_pept        complement(437972..438511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0390"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: rfr:Rfer_4040 molybdenum cofactor biosynthesis
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56178"
FT                   /db_xref="GOA:A1WEX1"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEX1"
FT                   /protein_id="ABM56178.1"
FT                   /translation="MSDDGSGKACPALFFHCMSALTHFDAQGHAHMVDVAAKPATHRMA
FT                   IACGRIEMLPETLALIKTGTARKGDVLGVARIAGIQAAKKTSELIPLCHPLALTRVAIE
FT                   FDAAAPAPTDASGISCTATVETVGPTGVEMEALTAVQIALLTIYDMCKAVDRGMVIHGV
FT                   RVLQKHGGASGSFVSR"
FT   gene            438534..439340
FT                   /locus_tag="Veis_0391"
FT   CDS_pept        438534..439340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0391"
FT                   /product="FimB"
FT                   /note="KEGG: pol:Bpro_4670 FimB"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56179"
FT                   /db_xref="GOA:A1WEX2"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEX2"
FT                   /protein_id="ABM56179.1"
FT                   /translation="MRNWLKRLCAREKERLHAGWAGRLRASGIHLGISLGIAALAALLV
FT                   FGLWYPYPYRDVSGGRTLFLLVVSVDVIMGPLITLAIFNRTKRRRELVLDLSVVGMLQL
FT                   AALGYGLWTVFVARPVHLVFEYSRMSVVHAIDVDDQLLAKAPPALQKLPITGPTLIALR
FT                   PFKDANEQYDATMAALDGAALPARCDLWQPYASSTADILAVAKPITDLRQRFAQQTARI
FT                   DRAVADSGQPAAQLRYLPLIDRGTAWTMLLDAATAEPRGFLALDPF"
FT   gene            439340..440917
FT                   /locus_tag="Veis_0392"
FT   CDS_pept        439340..440917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0392"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: rfr:Rfer_4041
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56180"
FT                   /db_xref="GOA:A1WEX3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEX3"
FT                   /protein_id="ABM56180.1"
FT                   /translation="MPPFLCRKAKAVVQRALLALTVGACALAWAPPASAQTGLPTLGDG
FT                   SELGSSAERRLGDRIIRELYRDPDYIDDPVLEDYVQGLWQSLLAAARARGELSAELDER
FT                   FAWEVLLGRDRSVNAFALPGGYLGLHLGLVGVTSTRDELASVLAHELSHVLQRHVSRLL
FT                   TAQKKQTPLLLGALVLGALAASKNPDAAQALVVGGRALLLQNQLNFSRDMEREADRIGY
FT                   GLMAPAGFAPQGFVGMFDKLQQANRLNDNGSWPYLRSHPLTTERSADMHARIPPGTAIG
FT                   ATAAAPATLEHALVAARARVLANPGVDSLRQWIAEPHSSGWASQPLPHRAAALYVAALG
FT                   SSQLRDAAGARAAAQKLDDLVRNAPDARQASDPATRRLLGLLNAEIELAAGAADAALQA
FT                   LQALPAGSDTGRPELLLRTRALLQARRAGEGAQALQTWVANHPKDATAWQLLAAVAQAQ
FT                   GQTLRAVRAEAEAHAARYDYAAAADRFKAGQDLARRSGAAVDHIDASIIDTRLRAMESL
FT                   LREQAAER"
FT   sig_peptide     439340..439447
FT                   /locus_tag="Veis_0392"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 36"
FT   gene            complement(440885..441289)
FT                   /locus_tag="Veis_0393"
FT   CDS_pept        complement(440885..441289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0393"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   rfr:Rfer_4042 membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56181"
FT                   /db_xref="GOA:A1WEX4"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEX4"
FT                   /protein_id="ABM56181.1"
FT                   /translation="MPAARCRQALRRCYRVAMRVLLKWLLSAVALLFVAYVYSGVEVRS
FT                   FGAALIAAFVIGLFNVVLRPVLVLLTLPVTIVTLGLFLFVINALMFWAAASLLDGFQVT
FT                   GFAAALLGSLIYSLLGVLIESALGGLFAQQ"
FT   gene            441385..441981
FT                   /locus_tag="Veis_0394"
FT   CDS_pept        441385..441981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0394"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bpm:BURPS1710b_3192 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56182"
FT                   /db_xref="GOA:A1WEX5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEX5"
FT                   /protein_id="ABM56182.1"
FT                   /translation="MTTPTPAAGQAMTATPATVRRLDADEAAASVAALADVLIDCVQGG
FT                   ASVSFMWPLPRDKALAFWRTVAEGVARNERVLLVAQDPHGGIVGTVQLVTAMPDNQPHR
FT                   ADVAKMLVHRKARRQGLARRLLAAVEDAARAEGRTVLVLDTVTGGDAERLYRRAGWQQV
FT                   GMVPDYALMPDGAFCSTTFFYKRLRGPDRCDAGPV"
FT   gene            442290..443249
FT                   /locus_tag="Veis_0395"
FT   CDS_pept        442290..443249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0395"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_2009 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56183"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEX6"
FT                   /protein_id="ABM56183.1"
FT                   /translation="MRRAIFLKSLAAMAAAGVLPVSAQKAAALKMMIPANPGGGWDSTG
FT                   RALGKAMQDAGAAASVSYDNRGGAAGIIGLAQFVNASKGDPNALMVMGAVMLGGIIAGR
FT                   PPVGLDKVTPLARLTSEYNVFVLPVDSPHKTMKDLLEQLKKDPGSVKWGGGSRGSTEHI
FT                   AAAMIARAVGVDPAKINFVAFRGGGEAIAAVLGGNVTVGGSGYSEFAEYIAAGKMRAVG
FT                   VTSGTRLKGVNVPTLKEQGIDVEIGNWRGVYGAPGITDGQRKVLIDALHRTFKHPAWQD
FT                   QMDKNRWTPAWLAGDEFANFVDAEFASLRATMAKSGMV"
FT   sig_peptide     442290..442367
FT                   /locus_tag="Veis_0395"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.473 at
FT                   residue 26"
FT   gene            443251..443802
FT                   /locus_tag="Veis_0396"
FT   CDS_pept        443251..443802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_2010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56184"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEX7"
FT                   /protein_id="ABM56184.1"
FT                   /translation="MAPAHSSHHPARHSSHSSHSRPLQTLLGAGLALLALLLAWGASAV
FT                   SSEAGYGGVGPNFLPWLVSAALLVCALLCVLHALTGGLRDLQAGSGAERAHWQGFLWVS
FT                   AALLLNALLITTLGFILSCALCFVLSVRGFKSAEGQLDLRLRAWVKDGLIGVAVAAPVF
FT                   WMFTQLLAINLPGLTRTGWL"
FT   sig_peptide     443251..443385
FT                   /locus_tag="Veis_0396"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.407 at
FT                   residue 45"
FT   gene            443815..445308
FT                   /locus_tag="Veis_0397"
FT   CDS_pept        443815..445308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0397"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112,
FT                   transmembrane; KEGG: pol:Bpro_2011 protein of unknown
FT                   function DUF112, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56185"
FT                   /db_xref="GOA:A1WEX8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEX8"
FT                   /protein_id="ABM56185.1"
FT                   /translation="METLDLLMHGFATAATPVNLLWAFVGCMIGTAVGVLPGIGPAVAV
FT                   AMLLPITVKVEATASMIFFAGIYYGAMYGGSTTAILLNTPGEAGSMVTAMEGNKMARNG
FT                   RAGAALATAAIGSFVAGSIATVLVTFFAPLVARHAVRLGPPEYFMLMVLAFTTVSAVLG
FT                   KSLLRGMVALLVGLALGLIGIDQITGQARYTAGMPELMDGIEVVLIAVGLFAVGEALYS
FT                   VMYEGQTEETQNRLTSTHMTRQEWRRSWPAWLRATAIGFPFGTVPAGGSEIPTFLSYAT
FT                   EKKLSRNPQEFGTTGAIEGVAGPEAANNAAVTATLIPLLTLGIPTSNTTAILLGAFQNY
FT                   GIQPGPQLFDSNAALVWALIASMYIGNVMLLILNLPLVGLWVKLLNIPKPYLYAGILVF
FT                   STLGVYGMRQSAFDLLLLYAIGLLGVLMRRFDFPAAPVVVGMILGPLAETQMRNAVAIG
FT                   EGKWTIFLERPGSLGLIVVVLAVLLLPRLLRRRAARTAG"
FT   gene            complement(445325..448087)
FT                   /locus_tag="Veis_0398"
FT   CDS_pept        complement(445325..448087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0398"
FT                   /product="magnesium-translocating P-type ATPase"
FT                   /EC_number="3.6.3.2"
FT                   /note="KEGG: pfl:PFL_4078 magnesium-translocating P-type
FT                   ATPase; TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; magnesium-translocating P-type
FT                   ATPase; PFAM: cation transporting ATPase domain protein
FT                   domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56186"
FT                   /db_xref="GOA:A1WEX9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEX9"
FT                   /protein_id="ABM56186.1"
FT                   /translation="MNLDLLKAAFVGFIRARGIEHHFRRLGRDMFRSAALAREVPQTIA
FT                   QSLVCASQTKPDALLRQLGTRPGGLTGQEADTIRAAVGPHAVGHEKRLTWRVHLWHCYK
FT                   NPFNLLLTALAAVSYFTEDMKAAMVIGAMVLSSTLMRFIQESRSNGAADKLKEMVSNTA
FT                   TVSRCGAAQDSAEPAPRHADASPHSRGSRRIELPIEELVPGDIVQLSAGDMIPADLRLL
FT                   SAKDLFVSQAAMTGESLPVEKFAEHRGSAAGNPLELDNVCFMGTNVISGAAAAVVLTTG
FT                   NRTYFGALAERVTATDRTPTAFQCGVNQVSWLLIRFMLVMTPIVFFINGFTKGDWIEAF
FT                   LFGLSIAVGLTPEMLPMIVTSTLAKGAVALSRKKVIVKRLDAIQNLGAMDMLCTDKTGT
FT                   LTQDKIFLERHTGILGAPNDEVLQYAYLNSYYQSGLKNLLDTAVLEHAELQREMALASA
FT                   YRKVDEIPFDFQRRRMSVVLSEREDHHELICKGAVEEIVSVCTHARNGGAIVPFTPQLL
FT                   AEIGATTASLNAEGLRVVAVAAKDLPPTKETYGVADESGLVLIGYIAFLDPPKESTAPA
FT                   LAALRAHGVTVKILTGDNELVSAKICREVGLEIQGMLLGAQLEKMSDAELALALEKTTV
FT                   FAKLSPAHKERIVRVLHDEGHVVGFMGDGINDAPALRAADVGISVDTAVDIAKEAADLI
FT                   LLEKSLMVLEAGVLEGRKTFANMLKYIKMTASSNFGNVLSVLVASAFLPFLPMLPLHLL
FT                   VQNLLYDASQIPIPFDHVDKEFIEKPQRWNPGDIGRFMVFFGPVSSVFDISTFALMWYV
FT                   FGANSPDRQTLFQSGWFIEGLLSQTLIVHMIRTRRIAFLQSRASWPLMGMTLVIMAIGI
FT                   IVPMSPLASYFKLQALPPGYFAWLLAILIAYGALIQAMKNCYTRRYGWQ"
FT   gene            448400..450757
FT                   /locus_tag="Veis_0399"
FT   CDS_pept        448400..450757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0399"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA topoisomerase IV, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: pol:Bpro_3163 DNA
FT                   topoisomerase IV, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56187"
FT                   /db_xref="GOA:A1WEY0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEY0"
FT                   /protein_id="ABM56187.1"
FT                   /translation="MSDPSISDFSTAGNDEGETLGLADYAQRAYLEYALSVVKGRALPD
FT                   VCDGLKPVQRRILYAMGRMGLGYGGAAGNTAAKPVKSARVVGDVLGRFHPHGDQSAYDA
FT                   LVRMAQDFAQRYPLIDGQGNFGSRDGDSAAAMRYTEARLSRIARLLLDEIDEGTVDFMP
FT                   NYDGSTEEPRQLPARLPFALLNGASGIAVGLATEIPSHNLGEIAAACIALIKTPALTQE
FT                   ELLALVPGPDYPGGGQIISSAAEIAGAYQTGRGSLKLRSRWKIEELARGQWQLVVNELP
FT                   PGVSTQRVLEEIEELTNPKIKVGKKALSQEQTQLKASLLAVLDLVRDESGKDAPVRLVF
FT                   EPKTGKTPQQELITALLAHTSLETSAPINLTLVGLDGRPVQKSLRQMLQEWIAFRQTTI
FT                   TRRSQHHLNKVLERIHILEGRQIVLLHLDEVIAIIRQADEPKAALMARWSLSDRQAEDI
FT                   LEIRLRQLARLEALRIGQELKELRDRQGKLEDILNHPGALRRTLIKEIETDAKTFADPR
FT                   RTLIQAEKKAVIEVRVPDEPVTVVVSQKGWVRVRSGHGHEAASFAFKAGDGLYGTFECR
FT                   TVDTLLAFGNNGRVYSVAVSLLPGARGDGQPVTTLIELEAGTQVLHYFAGPAQATLLLS
FT                   NSGGYGFLATVEHMISRQKGGKTFLTLAGGETPCPPSHAFGSTGSAPVLPATHVACAST
FT                   GGRILTFELGELKTMANGGRGLLLIDLEDKDRLAGAAAYVRSVRIDGLGRGGKLREETL
FT                   ELRSLNNARAARGRKGKATDLGFRPSGVTRIL"
FT   gene            451046..452854
FT                   /locus_tag="Veis_0400"
FT   CDS_pept        451046..452854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0400"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rfr:Rfer_2507
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56188"
FT                   /db_xref="GOA:A1WEY1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEY1"
FT                   /protein_id="ABM56188.1"
FT                   /translation="MPTRFRMAHKLWLAVVSTVVLLLIVLGFSGYRLDRAQARADAMAS
FT                   DMASRVQAAMRWAGLVEVNAARTQILSVISDPQAEAQFKDVMLATSAQIGAVQKSLEAM
FT                   ALTDADKAQMAQLAQLRQTAVDLRDQALQLKSADQQEPARAVLQKSYNPAVAIYLQGLQ
FT                   DFVRQQQRNAQQSQQEMDDAHALIMQISAVTAGLLILLIIVGAHYLIGSMQRPLAQANA
FT                   LVERMAGGDLSMQEPVTRGDEFGDLLRSLYTMGNALGRMVHQVRLSTDSIALASAEIAT
FT                   GNQDLSARTEQTSSNLQQTAAAMEQFTSTIAQSAGSAQQASSLAAGATGVARKGGEVVT
FT                   QVVSTMEDINHSSKKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVASEVR
FT                   NLAQRSAEAAKEIKQLIIASVEKVEAGSRLVSNAGSTMADIVQSVQHVTDMIGAITAAS
FT                   SEQSVGVSQVNKAISNLDQMTQQNAALVEQSAAAAQSLREQADHLAREVSIFKVNAADY
FT                   ASHGPAQAAMAQAAMTTARTSAGAAMPAASARPAKPAAGARTQAAPRLGAGAAPTPAGA
FT                   PALPGKAGGKKPAMAKQDPEEEWESF"
FT   sig_peptide     451046..451129
FT                   /locus_tag="Veis_0400"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.638) with cleavage site probability 0.329 at
FT                   residue 28"
FT   gene            452944..453954
FT                   /locus_tag="Veis_0401"
FT   CDS_pept        452944..453954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0401"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: pfl:PFL_2353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56189"
FT                   /db_xref="GOA:A1WEY2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEY2"
FT                   /protein_id="ABM56189.1"
FT                   /translation="MMNDPAHAKLRTHAGEIFTGKNLQRRFGRQKDFTMQFNRKTSIGM
FT                   GLALMAAFMNSFIAILSKQLSSANLNPSSIAFYRASIVFCIMLLVAYGVNVTRAGGRPE
FT                   KPAAMASIGSVKVFAIAALFGLFGLFYFETSAYKYEMASNVVFVMMASAAISSLLLESS
FT                   LKMERITGKKILALGASILGLLIVFDLAHLRNMNGVMLAMAAGTSYGLFSVYLRKQGVK
FT                   ASMHFMRNMFFFGAIYLAIPATIDGFSAVKPAHVPAILALAIVPSLLGTLCTMKSLEYL
FT                   SASRVQTIELTEPIFVAIMAYLMIAETPGPTQMMGYAFILAGVFCMNSPDRTANT"
FT   gene            complement(453970..454428)
FT                   /locus_tag="Veis_0402"
FT   CDS_pept        complement(453970..454428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0402"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rfr:Rfer_2506
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56190"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEY3"
FT                   /protein_id="ABM56190.1"
FT                   /translation="MSVYEQLKELRISLPPVSVPSAAYVPYVQTGPLVFLSGHIARKDG
FT                   KPWVAQLGRDIGTEEGQAAARAVAIDLLGTLQTACGGDLNRVKRIVKLLSLVNCTSDFT
FT                   EQHLVTNGASELFVRLFGDKGAHARSAFGVAQLPMGACVEIELIAELA"
FT   gene            454540..457176
FT                   /locus_tag="Veis_0403"
FT   CDS_pept        454540..457176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0403"
FT                   /product="DNA internalization-related competence protein
FT                   ComEC/Rec2"
FT                   /note="TIGRFAM: DNA internalization-related competence
FT                   protein ComEC/Rec2; PFAM: beta-lactamase domain protein;
FT                   ComEC/Rec2-related protein; KEGG: rfr:Rfer_2476 DNA
FT                   internalization-related competence protein ComEC/Rec2"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56191"
FT                   /db_xref="GOA:A1WEY4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEY4"
FT                   /protein_id="ABM56191.1"
FT                   /translation="MPAMRSRVPDGAPAAARAAWRLPALLPGVVSGAALQLLQPRLWPP
FT                   LVYGALLCAALALGWYAGAAATRRRHAALWAAAPALLAAGLAAAAMFAVCGLRAWGYME
FT                   QALAPALEGQDIRVTGLVAAMPQASETGTRLRLEVDSALLRGQAVRLPPRIEVGWYGAG
FT                   FGDANADAGQAPGLRGRPPVVRAGERWALTVRLKAPHGMRNPHGFDYELWLWEQGVQAT
FT                   GYVRTGPKDAPPLRLGATWRHPVERWRQSVRDAIVERLGRGAQDSSEPFRARIAGVVAA
FT                   LVTGDQRAIERADWELFRATGVAHLMSISGLHITLFAWLAALAVRTLWRRSTGLCLAVP
FT                   APSAALVAGVLLAAGYALFSGWGVPAQRTVIMLGSVACLQLSGRRWPWPQVWLLACAAV
FT                   VLADPWALAQAGFWLSFVAVGVLFATNPTVDDSYRLGAMGRFHALLREQWVVTLALTPL
FT                   TLLLFAQLTLVGFAANLVAIPWVTLVVTPLALAGLLWAPLWSLAALALQPLIALLQWLA
FT                   QWPWAQLFLPAAPLWAGGAAVAGGALLALRMPWQLRLPALALLVPVLWWQPQRPAPGQF
FT                   ELLAADIGQGNAVLVRTANHTLLYDAGPRFGRDSDAGQRVLVPLLRARGERLDLLMLSH
FT                   PDADHTGGAAAVLAQQPQARLTGSIDASHAALHGLRPVQPCLAGQRWQWDGVAFEVLHP
FT                   LAGPVGKTGGTGAAGETGPAPRAPTSRTPASNASSCVLRIAANAASTANGASGAERPDP
FT                   PVALLAGDIEAPQEQALVARGAPLRADLLLVPHHGSKTSSTPAFLEAVRPRTALVQAGY
FT                   RNRFGHPAPEVLQRYRERNIRVLESARCGAATWSSAQPGRVACERDTDGRYWQHRLPPR
FT                   GAGRDAR"
FT   gene            457268..458725
FT                   /locus_tag="Veis_0404"
FT   CDS_pept        457268..458725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0404"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: pol:Bpro_3157 protein of
FT                   unknown function DUF404"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56192"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEY5"
FT                   /protein_id="ABM56192.1"
FT                   /translation="MQKFDEMYAMLPLAGRAVREHYQRYAQWLDQQPPDLMQARRAEAE
FT                   MIFRRVGITFAVYGAKDEDGAGSERLIPFDLIPRIIPAHEWSRLQQGLVQRVTALNRFI
FT                   HDVYHGQDILRAAIVPADLIVGNAQYRPEMVGLDVPQDIYAHIAGIDIVRTPDAQGEYY
FT                   VLEDNLRVPSGVSYMLENRKMMMRLFPELFSRHKVAPVAHYPDMLLDALRASAPATADE
FT                   PTVVLLTPGMHNSAYFEHAFLAQQMGVELVEGQDLVVKDGFVYMRTTRGLQRVDVIYRR
FT                   VDDDYLDPQLFRRDSTLGCHGLMGAYRAGHVGICNAVGTGVADDKSVYPYVPEMIRFYL
FT                   GQEPILKNVPTWMCRKPDDLQYVLAHLSELVLKEVHGAGGYGMLIGPAATRAQIEDFRR
FT                   ALQAHPAGYIAQPTLSLSSCPTYVDNGIAPRHIDLRPFVLSGREVQMVAGGLTRVALQE
FT                   GSLVVNSSQGGGTKDTWVLGQAGTEPC"
FT   gene            458719..459678
FT                   /locus_tag="Veis_0405"
FT   CDS_pept        458719..459678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0405"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403; KEGG:
FT                   pol:Bpro_3156 protein of unknown function DUF403"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56193"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEY6"
FT                   /protein_id="ABM56193.1"
FT                   /translation="MLSRTADHLFWMSRYTERAENTARMLNVSYETSLLPQSADVAQEG
FT                   WEGLLSISELIPAYTARHGKVTPGRVLEFMVRDGSNPSAILSCLRAARENARAVRGALT
FT                   TEVWETQNQTWLELHRHLEGGAFERDPGQFFEWVKHRSHLSRGVVLGTMLQDEAFHFLR
FT                   MGTFLERADNTARLLDVKFHAVKNDFFGRTSERNQERDFYHWSAILRSVSAFEVYRKVY
FT                   RDVITPGRVADLLILHPGMPRSLHACLREVVDDLAVLANEQSAETRRRAGRLLADLQYG
FT                   RLDEILATGLHAFLTQFLDRVNDLGSGISRDFLVAAGD"
FT   gene            459809..460930
FT                   /locus_tag="Veis_0406"
FT   CDS_pept        459809..460930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0406"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_1270 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56194"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEY7"
FT                   /protein_id="ABM56194.1"
FT                   /translation="MNRREMLLATTPLALGARAGTFPDKPIRYICPVAAGGGSDMIARV
FT                   FSQRWGQLLGQPFVVDNQSGGGGVVACQSTAHAKPDGYTLMQGYVATHGTVPATRTVAY
FT                   DPIGDFTPIGMIGATPNVLAVTSSLPVDTLAQFVEYARKHPRQINYGSAGSGSLTHLAM
FT                   ELFIQASGASMLHVPYRGIAPAFNDLLGGQIQAMFPGLAATLPYLRAHRVKVLALTGNR
FT                   RSPLLKGVPTLDEAGFKGFVAAQWYGALGPAQMPADIVARLNQTQVAALNDPALREKLV
FT                   SCHRSDVVGCAQPSERSARRIAQPIPSVWASDATPRCAPMASADRQMTGDATLALEAVE
FT                   PMPMTATAFGQYIAAEVQRWSALAKARNIRFDM"
FT   sig_peptide     459809..459868
FT                   /locus_tag="Veis_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.983 at
FT                   residue 20"
FT   gene            460974..462344
FT                   /locus_tag="Veis_0407"
FT   CDS_pept        460974..462344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0407"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: pol:Bpro_1269
FT                   MmgE/PrpD"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56195"
FT                   /db_xref="GOA:A1WEY8"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEY8"
FT                   /protein_id="ABM56195.1"
FT                   /translation="MTRNTHVAADTDPPAITAILARFVSTHPGRGWNDAVEREAVRTFY
FT                   NWLGCAIGAARHPAADAALAALQMLEPAPQAAVLGRSERLDMASAALLNGITSHTFDFD
FT                   DTHLKTIIHPAAPVASAILALAEQRGASGRALLDALVIGIDVACRIGNAMYPEHYDRGW
FT                   HITGSTGMLGAAAGCARLLGLDTQQTGMALGIAASQPIGLREQFGTMTKPFHPGAAARA
FT                   GMLSALLASKGFTASARALEAPRGFVQVVSNKRAWHEVSDALGERFEISFNTYKPFACG
FT                   IVIHPGIDACVQLRAQGVQPQQVERIELRVHPLVLELTGKKTPRDGLEAKFSVYHGCAV
FT                   GLIFGRAGEAEFRDEIVNRADVMALRGKVHATVDDSIDEAAADVTAVLRDGRSLHVRIG
FT                   HAIGSLQRPLDDAQLDDKFMSLVEPVLGRAKGTRIGQECRALATLADMRALTALCVP"
FT   gene            complement(462322..462624)
FT                   /locus_tag="Veis_0408"
FT   CDS_pept        complement(462322..462624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0408"
FT                   /product="transposase"
FT                   /note="KEGG: xom:XOO_2345 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56196"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEY9"
FT                   /protein_id="ABM56196.1"
FT                   /translation="MASPHRFNSREDMEQTLLRYVALYNHQLPQSALGSKTPMQAMKEW
FT                   HQQHPHLFHKRPYDHPGCDTQATWPASFFCRKFDAPALSRGHCTAGCGFMARTGP"
FT   gene            462897..464459
FT                   /locus_tag="Veis_0409"
FT   CDS_pept        462897..464459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0409"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: atc:AGR_pAT_490 OphA, putative peptide transport
FT                   system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56197"
FT                   /db_xref="GOA:A1WEZ0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEZ0"
FT                   /protein_id="ABM56197.1"
FT                   /translation="MKTEHSKLPEAASTRRQFIHGAAALGIGIGLGGRASAAAPRRGGT
FT                   LKLGMGGGSTTDSLDPALLVDWVSLNQAYMLMNGLVEINEKMEAVPELLESWEAKPGAA
FT                   EWLLNVRSGVTFHNGKTLDADDVVYSLNLHRGPATRSAVKSNLADVTDVRKSGAMQVTI
FT                   TLKSGNADLPYLLSDYHLLVVPHGFQDWAKPIGTGPFVFGEYTPGVRSLFKRNPDYWRP
FT                   NAAWVDAVELLVINDVAARTNALISGQVHAINRIDFKTVDLLKRNPALSIVRSAGGQHF
FT                   TFLMNCTTAPFTDNNVRLAIKYGIDRQKQLSTILRGYGSLGNDHPIPRTDRFFAADLPQ
FT                   RAYDPDKSKFYLKKAGLSTLDVELSSSGSAFAGALDSAALLREQAAAGGITLSIQRQSA
FT                   DSYWDKVWMKAPFCMGYWGGRPTADQMFSTAYKSDAKWNDAYWKNPQFDTLLLQARAML
FT                   DDNKRRELYGEMQRMVSDEGGTMIPLFADYIDATSNRLKGAIPHPLFNFMGGRLAERVW
FT                   LEG"
FT   sig_peptide     462897..463010
FT                   /locus_tag="Veis_0409"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.757 at
FT                   residue 38"
FT   gene            464459..465406
FT                   /locus_tag="Veis_0410"
FT   CDS_pept        464459..465406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0410"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mlr9211 dipeptide
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56198"
FT                   /db_xref="GOA:A1WEZ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEZ1"
FT                   /protein_id="ABM56198.1"
FT                   /translation="MRRLLMQRVLLGLLTLWLVSVLIFVGTEMLPGDVASAILGQSATP
FT                   ETVAALRASLGLDQPALQRYLMWLLHFLQGDLGTSLTNGRSIAADLMPRLYNTLFLASY
FT                   AALVVIPLSILLGIASAIWQNSLFDRAASVLSLASISMPEFFVGYVLIILLAVKWALLP
FT                   SLAVVSDSMSWSERLYATTLPMLTLLFVVTAHMLRMTRASVIAVMGSAYIEMAILKGLP
FT                   KWRIVVQHALPNALAPIINAVSFNLAYLVVGVIMVEVVFVYPGVGQLMVDAVSKRDLPV
FT                   VQACGLLFAAAYIGLNTLADVLAVWVNPRLRQAR"
FT   sig_peptide     464459..464536
FT                   /locus_tag="Veis_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.783) with cleavage site probability 0.605 at
FT                   residue 26"
FT   gene            465414..466244
FT                   /locus_tag="Veis_0411"
FT   CDS_pept        465414..466244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0411"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pfl:PFL_5625 peptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56199"
FT                   /db_xref="GOA:A1WEZ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEZ2"
FT                   /protein_id="ABM56199.1"
FT                   /translation="MKIFGKTVAASAVGGGLIVVALAGLVLLAPLVAPHGETETVGDIW
FT                   LLPGAEHLLGTDSIGRDMLSRLLYGGRTTLGIALAVSLLSFSLGIVSGFAAVVLGRYVD
FT                   LLLSRLVDTLMAIPVLIFALMILSVLGTSVPVLICTIAVLDATRVFRLARLVAQGIMVQ
FT                   EYVEAARLRGEGLGWIIRREILPNAVPALLAEFGMRFGFTILFVAGLSFLGLGIQPPYA
FT                   DWGGMVRDNAQAINFGGIAPLFPALAIALLTIGINLVVDWLLSVRAQGQAGSMA"
FT   sig_peptide     465414..465485
FT                   /locus_tag="Veis_0411"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.674 at
FT                   residue 24"
FT   gene            466241..467833
FT                   /locus_tag="Veis_0412"
FT   CDS_pept        466241..467833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0412"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pfl:PFL_5624 peptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56200"
FT                   /db_xref="GOA:A1WEZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEZ3"
FT                   /protein_id="ABM56200.1"
FT                   /translation="MSNILDMRNLRVQAPTGQVLVDGVSLTLAVGEVLGLIGESGAGKS
FT                   TIGLAALGYARGQCRIVDGEVWLAGENIMAASSAQRRALRGSRIAYVAQSAAAAFNPAL
FT                   TIGAQVVEGPLRHGSMTRAAALAWARELYLALDLPDPDHFGQRYAHQVSGGQLQRAMVA
FT                   MAMSCKPDVLVLDEPTSALDVTTQIEVLVILRKVVREFGTAALYISHDLALVAQIADRV
FT                   LVLRHGKQVEEGRTEAVLHAPREAYTQQLVAERAATTAPQAQAGTAPLLTVENLTAGYH
FT                   GNTILREINFTLGRGETLALVGESGSGKSTVARAIVGLIAQQSGRLRFDAEPLPAQLGA
FT                   RTREHKRRIQLVYQLPDVALNPQQSIHEIIGRPASFYFGLDAKAARSRVRELLQLVALP
FT                   ESCIDRRPGQLSGGQKQRVCIARALAAKPDLIICDEVTSALDPLVAEGILQLLESLQER
FT                   IGLSYLFITHDLGTVRRIAQRVAVMLSGEIIACGQTDTIFSAPMHPYTERLLSSVPEMR
FT                   MGWLDHALARQRP"
FT   gene            467808..469880
FT                   /locus_tag="Veis_0413"
FT   CDS_pept        467808..469880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0413"
FT                   /product="peptidase S15"
FT                   /note="PFAM: peptidase S15; X-Pro dipeptidyl-peptidase
FT                   C-terminal domain protein; KEGG: tcr:508699.120
FT                   dipeptidyl-peptidase Pfam: AXE1 Peptidase_S15 Peptidase_S9
FT                   Abhydrolase_1 PepX_C PROSITE: TYR_PHOSPHATASE_PTP"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56201"
FT                   /db_xref="GOA:A1WEZ4"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEZ4"
FT                   /protein_id="ABM56201.1"
FT                   /translation="MHWRANDHDTTLRQETGAMQDKHVIENVWIDLQDGTRLAARIWLP
FT                   ADAHARPAPAILEYIPYRKRDGTRMRDEPMHGYFAAHGYAAVRVDMRGSGDSDGSMADE
FT                   YLALEQDDALEVIAWIARQPWCNGALGMMGKSWGGFNALQVAARRPAALKAIITVCSTD
FT                   DRYADDIHFKGGCLLNDNLWWGSIMLAYQGRPPDPALVGDGWRQAWLQRLDQMPLFPAL
FT                   WMAHPWRDAYWQHGSVCEDWSAIECPVFAVGGWADSYTNAVFRLLAHLKVPTQGLIGPW
FT                   AHIYPQDAVPGPAIGFLQEALQWWDRWLKPDAAPAAAPTVSPAALRIWLETSRSPATTH
FT                   LHSPGRWIAEAAWPSRNVQMQTWYLGQGTLVAARPQTASITVCTPQGHGIAAGEWMGTG
FT                   VPGESPADQRLDDGWATVFDSAPLSAPLVILGMPELELELESDKPVAHLCARLSEVLPD
FT                   GAVTRCSYAVFNLTQRDGAATPTPLEPQRRYTVRIALDACAHECAPGSRIRVALATTYW
FT                   PLVWPAPEHATLTVQSGASALHLPVRKVGHEIAVAPFAAPERGPATPVEVLRNSSIERS
FT                   ATYDLARDEWTYVTESLGGLFGEGVLRLTEIDTSVEHNLRRQLTVRGKDPLSARYTITQ
FT                   SYRMGRPGWEIDIETALHMRADATHFHLDGTLTARENGSEVRQRRWQETLPRLLF"
FT   gene            469887..470201
FT                   /locus_tag="Veis_0414"
FT   CDS_pept        469887..470201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56202"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEZ5"
FT                   /protein_id="ABM56202.1"
FT                   /translation="MCDHCASSGGIYVYSSVTARKPGNPGKKLVSILPRRPSRSTARSG
FT                   DGSATLVGDSGQGGQSRGQTQVYLTPLHAKTQTIGSLIVNIRTASRHVHLESRQVVRWL
FT                   "
FT   gene            complement(470350..471831)
FT                   /locus_tag="Veis_0415"
FT   CDS_pept        complement(470350..471831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0415"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: pfo:Pfl_3147
FT                   N-ethylammeline chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56203"
FT                   /db_xref="GOA:A1WEZ6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEZ6"
FT                   /protein_id="ABM56203.1"
FT                   /translation="MRTCLKASYVIGFNGAGHELWQNGEVVFSGDRIEFVGRNFPGTVD
FT                   RTVDYGHALICPGLIDLDALGDLDSTVLTLDNGNRLEMGRMWSEEYLERGPWETYTEEE
FT                   ERFKYRYAFTQLIRNGITTALPITSMYYRQWAEHYQEFANVAEIAIELGIRAYIGPAYM
FT                   SGISYVRRDRSLGQFWDEARGLAGLDEALRFCRDFDGSGNGLIRGLLAPDRIETCTPAL
FT                   LERTAAASAELNAPVRLHCCQSVYEFEMVKRLRNTTPLGWLERTGLLNARAILPHGIYF
FT                   SGHPQVSDPSADDWQRLTASEVSLVHCPAVFARSGGALNSFGRYRAAGINLGLGTDTWP
FT                   PDLLHNMQIGLYIARVLEGDSTQTSTADMFNAATLGGAKALGRDDLGRLSAGALADIVV
FT                   FDLKGAHLGPFFEPLKNLILAGRGSDCRASYIGGRCVMEDFQVGATDSAALQAQADRQF
FT                   AKLMASHPSRAFGQPPLERIFHPVFPWAEAAAGGC"
FT   gene            complement(471845..473044)
FT                   /locus_tag="Veis_0416"
FT   CDS_pept        complement(471845..473044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0416"
FT                   /product="N-isopropylammelide isopropylaminohydrolase"
FT                   /EC_number="3.5.99.4"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   pfo:Pfl_3146 cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56204"
FT                   /db_xref="GOA:A1WEZ7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEZ7"
FT                   /protein_id="ABM56204.1"
FT                   /translation="MTGDQVIRNVRPLGAAAVDIVLHRATIGAIVPAGSAAADIPCLLD
FT                   GGARLLLPGLVESHVHFDKTLWGMAWHSNTSGPGLSDKVANERRVLRAIDVPLAERAGP
FT                   LIEHCIARGSLYFRCHIDIDPELKLERVHAMLALRERYRDVIDMQFVAFPQAGMLIQPG
FT                   TLELMRAALELGVEHVGGLDPAGMDGDPIRHLEGIFALATRYDRGIDIHLHDRGSLGLW
FT                   QVERIADFTKACGRSGRVMISHAFCLGMLPTEQLLPLADRLAELGISIMTSGNAGIDVP
FT                   PVALLRSRGVNVCSGSDGIRDPWSPMGNGDMLERAMLIALRYRWNKDQELAMAFDIVSA
FT                   GGARALGIANYGLDVGCPANFVLVPAENPSEALINRPAMRTVISRGRIVARAGQFAGQQ
FT                   "
FT   gene            complement(473184..474635)
FT                   /locus_tag="Veis_0417"
FT   CDS_pept        complement(473184..474635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0417"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bur:Bcep18194_B2475 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56205"
FT                   /db_xref="GOA:A1WEZ8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEZ8"
FT                   /protein_id="ABM56205.1"
FT                   /translation="MQNLQQIDVLIEHGCIITMDAQRRVLDDGALAVHGQRIVAVGATD
FT                   ALRQRYQAARVLDARRKAVLPGLIDAHAHAGHAMLKTMGGGNGEAWMHACKTIYTSASD
FT                   ENFWEVESHLAALERLKAGVTTGVSLLGGGDSIMRVDDPVYAQRHCAAVAKTGTRSVVA
FT                   VGPSRPPAPRNYTTYAAHGATVRAVDFDTMYAVCQAIIDACHDSADQRIKIALTLPVYG
FT                   PAFDPELAAFEAIYRSQAGQYMALARARGLTFTQDGHRAGTLAFAHRELGLLGRASFMS
FT                   HAIDLTGEDIALCRETGTSIVHNPSAIMSIRGRCPVPELIDAGVNVAIGSDGAAPDRGY
FT                   DMFRHMSQCMHYHRRHFRDAGVLPHGKVLEMVTIDAARALSMEQDIGSLEAGKKADIIL
FT                   VDLFKPHLMPLNMPVYRITCFANAGDVCTTIVDGNILMEDYRVLSVDETEVLERVTIEA
FT                   ERMLERSGLRHLLDAPPRLWGASHY"
FT   gene            complement(474649..475620)
FT                   /locus_tag="Veis_0418"
FT   CDS_pept        complement(474649..475620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0418"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: atc:AGR_L_359 oligopeptide ABC transporter
FT                   (ATP-binding protein); TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56206"
FT                   /db_xref="GOA:A1WEZ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEZ9"
FT                   /protein_id="ABM56206.1"
FT                   /translation="MMMSELDMEHMDRPYLKVSEVKRYFQAQGRTVKSVDGVSFDIPLG
FT                   TTFSLVGESGCGKTTLARMVAGLDRPTAGAIAFDAQGAQRPHRVQMIFQDPYASLNARW
FT                   RVGSTIAEPIRFQGLRGAAGVDLRVVELLQRVGLAAADVSKFPHEFSGGQRQRISIARA
FT                   LAGEPSFLVCDEPTSALDVSVQAQILNLLKRLQREEGMTSLFISHNLAVVRFISTRVGV
FT                   MYLGRLVEVAPTEMLFERPQHPYTQLLMDAIPRLEHGRRRVRNASGDVPSPLDPPGGCT
FT                   FHPRCPLAMERCRSETPLLKAAADGSAVACHAVVPTVHASAA"
FT   gene            complement(475749..476744)
FT                   /locus_tag="Veis_0419"
FT   CDS_pept        complement(475749..476744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0419"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bbr:BB4025 putative ABC transport ATP-binding
FT                   subunit; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56207"
FT                   /db_xref="GOA:A1WF00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF00"
FT                   /protein_id="ABM56207.1"
FT                   /translation="MVVMNERHSQRPPLLQVANLHVEIPTRHGVLKALEDVSFAIHAGE
FT                   IVGFVGESGAGKSLTGMAVLGLLDAPARVASGAILFDGRRLDTLGPQAMRKIRGKQIGA
FT                   IFQDPLVSLNPLLTIGDQLIETMTTHLEIGPKEAAQRAVEWMRAVGIPAPQERLHAYPH
FT                   QFSGGMRQRIVIALALCAEPKLVVADEPTTALDVSVQAQVLELLKQLCRERGTAILLVT
FT                   HDMGVIAENADRVAVMYAGRIVEQGPVEDIVSAPRHPYSRGLMGAIPPLEHAVEWLTQI
FT                   EGAMPRLNAKPQGCAFNPRCPAVTPQCRERRAEIRSLGNSQVDCWHPVDH"
FT   gene            complement(476754..477677)
FT                   /locus_tag="Veis_0420"
FT   CDS_pept        complement(476754..477677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0420"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bbr:BB4910 putative
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56208"
FT                   /db_xref="GOA:A1WF01"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF01"
FT                   /protein_id="ABM56208.1"
FT                   /translation="MAALLAFLQRARNSDLSYSFLRSPEALIGAAVLALYAMFALFAPW
FT                   LATQDPFDPAALNLMDARMPPAWLEGGAPMYWFGTDGQGRDLLSVMLYGLRVSLIVAIT
FT                   ATVLSMVIGVTLGLFSGYAGGRLDNFIMRVADVQLSFPTILVALLIDGLARTVLPKEIQ
FT                   EQVAIWVVVAAIGLSNWVQYARTVRGVTMVEQSKDYVNAARLIGLGKWRILFCHVLPNV
FT                   LNPVLVIATLSIGMAILTEATLSFLGLGVPPTSPSLGTLIRLGNEVLFAGEWWVTVMPG
FT                   VCLMVLVLAINLFGDWLRDVLNPRLK"
FT   gene            complement(477717..478682)
FT                   /locus_tag="Veis_0421"
FT   CDS_pept        complement(477717..478682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0421"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bbr:BB4027 putative
FT                   binding-protein-dependent permease"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56209"
FT                   /db_xref="GOA:A1WF02"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF02"
FT                   /protein_id="ABM56209.1"
FT                   /translation="MLRFLAQRLANGLAVMLVVSMVSFAIFNFIGDPVNNLVGETATQA
FT                   EKEALRARLGLDAPLPVQYLLFLGRALQGEFGVSYRNLEPVSRVIASRIPATLELSLCA
FT                   ALLALGLGLPLGIYAGIRRKAWGARALQVVSLIGISVPSFLIGIALILLFSVELHWLPS
FT                   FGRGEVVSVGFWTTGLLTASGWKSLVMPTITLSLFQLTLFMRLTRAEMLEVMRSDYIKF
FT                   ARARGIRERSIHFHHALKNTLIPIITVVGLQLGSMIAFAIITETVFQWPGLGMLIIQAI
FT                   TFSDVPLIAAYLMLIALMFVLINMVADLLYFLVDPRLRVS"
FT   sig_peptide     complement(478605..478682)
FT                   /locus_tag="Veis_0421"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.726) with cleavage site probability 0.569 at
FT                   residue 26"
FT   gene            complement(478725..480308)
FT                   /locus_tag="Veis_0422"
FT   CDS_pept        complement(478725..480308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0422"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: pol:Bpro_2113 extracellular solute-binding
FT                   protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56210"
FT                   /db_xref="GOA:A1WF03"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF03"
FT                   /protein_id="ABM56210.1"
FT                   /translation="MKISNLRLVLGVMLAIGVHTALPAKTLTWTAGLDALSMDPHSSTN
FT                   SFTNAFVTNVYESLVRFNDKLQIEPALAESWKMRNPVVWRFHLRRGVKFHNGEAFDADD
FT                   VVFTWSRASSPGSLVRINLSDIKEVRKVDQYTVDIETHAPFPTLLNELVQFLVMSKSWS
FT                   EANNATEASDLMQKKENYANRHTNGTGPFIVKSREIDVRTEFLANPHWWDKKPRHNLSN
FT                   VVFTPIKSDATRTSSLLSGVVDVSVSVPVQDVQRLQQGAAIDVVQGPELRTIFLGMDQF
FT                   RDELLYGNVKGKNPFKDLRVRQALYQAIDVEVLKRAVMRGASWPAGSLISPFLNGAPAS
FT                   LNQRAFAYDTAAAKKLLADAGYPNGFSVGLQCPNNRYVYDEQLCLAITAMLARVGIKAN
FT                   PMIEPAAKWNQRLNTNDVSLYMMGHAGLPMADTYAILKDVVGTQTANIGGLNSGRYSNP
FT                   RFDAYLPKIASELDLAKRNQLITAAVAIERNDISHIPLHQQPVIWAAKKGIDLRQSPDN
FT                   QLRLWLITVK"
FT   sig_peptide     complement(480246..480308)
FT                   /locus_tag="Veis_0422"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.908) with cleavage site probability 0.548 at
FT                   residue 21"
FT   gene            complement(480374..481957)
FT                   /locus_tag="Veis_0423"
FT   CDS_pept        complement(480374..481957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0423"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: pol:Bpro_2113 extracellular solute-binding
FT                   protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56211"
FT                   /db_xref="GOA:A1WF04"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF04"
FT                   /protein_id="ABM56211.1"
FT                   /translation="MRISNLRIMAMLVISLAAALPASAKTLAWTAGMDAVSMDPHSSNS
FT                   TFTNAFVTNVYESLVRFDDKLKIEPALAESWKMTTPMVWRFNLRRGVKFHNGEAFGADD
FT                   VVFTWARVNSPGSLVRGNLSDIKEVRKVDQYTVDIETKTPFPTLLNELVQLLVMSKSWS
FT                   EANNATEASDITQKKENFANRHTNGTGPFIMKSREVDIKTEFVANPNWWDKKLRHNLSD
FT                   VAFMPIKSDATRTSSLLSGVVDVSVDVPVQDVQRLQAGAAINLVQGPELRTISLGMDHA
FT                   RDELLYSDVKGKNPFKDLRVRQAMYQAIDVEALKRAVMRGASWPAATMISPFLNGAPVS
FT                   LNKRVLAYDPAAAKKLLADAGYPNGFSVGMQCPNSRLVYSEQLCLAIGTMLSRVGIKVN
FT                   LMIEPIAKWIDRLNSTDLSLYIMSHAGLPMADAYAILKDVVGTHTATIGGLNAGRYSNP
FT                   KFDEYLPKIASELDTAKRNQLITEAVTIERNDISHIPLHQQPVIWAAKKGIELHQSPDN
FT                   QLRLWLVTVK"
FT   sig_peptide     complement(481883..481957)
FT                   /locus_tag="Veis_0423"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 25"
FT   gene            complement(481979..482377)
FT                   /locus_tag="Veis_0424"
FT   CDS_pept        complement(481979..482377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56212"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF05"
FT                   /protein_id="ABM56212.1"
FT                   /translation="MHHPRRARRSRFPNQGTRRDRLCQAEGIRGGAGASKFVYIQRLTI
FT                   SSCKRFRNRVYWLATPGLKEHWKKITSAACIDSTCVIGTKTETDRHHVISSLPADSERV
FT                   CAGVRATGGWRCPEQFGDSVAKSARFGF"
FT   gene            482576..482815
FT                   /locus_tag="Veis_0425"
FT   CDS_pept        482576..482815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56213"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF06"
FT                   /protein_id="ABM56213.1"
FT                   /translation="MHFGAAMICNAALVPKARLHVLLFVVQGTSVASPIICRSALAIEA
FT                   HRGVASLANTLGMGCAMRLALRSDGCAQPTTSDR"
FT   gene            complement(482823..484058)
FT                   /locus_tag="Veis_0426"
FT   CDS_pept        complement(482823..484058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0426"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix, Fis-type; GAF domain
FT                   protein; KEGG: pol:Bpro_5567 putative transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56214"
FT                   /db_xref="GOA:A1WF07"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF07"
FT                   /protein_id="ABM56214.1"
FT                   /translation="MNTMALDRRIGTANAPHQLFASTPVQRVALARQQFFEEGVRPSGL
FT                   VGEAVIQSWMRCSRTHTDRQRILPFDAVTPSRLHATLARNRELLDVARQELVQMEHALA
FT                   GTDCRVILIDREGVVVYATQQSTAAHQPVLRKTARVGVNISERVIGTTAPGIVASTGQA
FT                   CTVNGAEHFFDVLCHMQCAAAPIRDVTGQLAGVLDLSAEAQHFGFDAASIVSLYATIIE
FT                   NRLLQAQSREHLILRFQASPTLLGTPLEALAGIAPDGTIAWLNNVGARLLGRLPEVADG
FT                   RDVECLLGHDLASLQRLERREAAQPLRLASGLGVWVQAHIKGADGANWRHAVAMPGEAA
FT                   PRAIEREAKTDTAEACERTDCGVPAPAAETTLRGHSRKLIEETLAAHSGNVAQTARQLR
FT                   VSRGTLYRRLRG"
FT   gene            484183..486303
FT                   /locus_tag="Veis_0427"
FT   CDS_pept        484183..486303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0427"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; KEGG: pol:Bpro_5302
FT                   pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56215"
FT                   /db_xref="GOA:A1WF08"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF08"
FT                   /protein_id="ABM56215.1"
FT                   /translation="MRHIYSGRRLMLVGALCLGASTAAMAQSAQDAQERAATAVKRVDG
FT                   NFIRANAAQKKTPDWPSTSLDYAETRFSKLDQVNADNVKQLGLVWSYNLESTRGVEATP
FT                   LVVDGIMYVTASWSVVHAIDTRTGDKLWTFDPQVDKSKGYKGCCDVVNRGVALYQGKVY
FT                   VAAYDGRLIALDAATGQKVWEKNTIEGQNGSYTITGAPRVFKGKVIIGNGGAEYGVRGY
FT                   VSAYDAKTGEQKWRWFAVPGDPGKPFEDESMARAAKTWDPSGKYWEAGGGGTAWDSFAF
FT                   DPELNLMYVGTGNGSPWAHKARSPNGGDNLYLGSVVALNPDTGKYVWHYQETPGDNWDY
FT                   TSTQSMILADVKIGGKVRKVLLHAPKNGFFFVIDRSNGKFISAKNFVEVNWATGYDKNG
FT                   RPIEVAAARGDKPYDSIPGPYGAHNWHPMSFNPQTGLAYLPAQNLPINLVDDKDWKFDQ
FT                   NMPGRPHAGLGWNLGKFANVEPPKSKPFGRLVAWDPVAQKEAWGIDYASPWNGGTLTTA
FT                   GNLVFQGTADGRLLAYNAKTGEKLWETPTGTGVVAAPSTYLVDGKQYVSVAVGWGGVYG
FT                   LAQRATERQGPGTVYTFALGGTAKMPDFVQYRLGKLVQGVKYDPAKVQAGTMLYISNCV
FT                   FCHGVPGVDRGGNIPNLGYMDAAYIENLDKFVVQGPATARGMPDFTGKLSSDDIESIKA
FT                   FIQGTADAIRPK"
FT   sig_peptide     484183..484263
FT                   /locus_tag="Veis_0427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 27"
FT   gene            complement(486727..487905)
FT                   /locus_tag="Veis_0428"
FT   CDS_pept        complement(486727..487905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0428"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rha:RHA1_ro00763 probable formyl-CoA
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56216"
FT                   /db_xref="GOA:A1WF09"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF09"
FT                   /protein_id="ABM56216.1"
FT                   /translation="MQDSPSSSFSAYPLAGITVLDLGQIYQGPYCGFLLAMAGARVIKI
FT                   EPPKGEPIRSRRGVSVPLAMLNSNKEGITLDLKSNEGRDAFLRLVDRADVVIENFLPGV
FT                   MDRLGVGGKLLLGRNPRLIFASASGYGSSGPYRDLLAMDLTIQAMSGMINATGFPDQSP
FT                   VKAGPSICDFLGGAHLYGAVITALFERSRTGAGRICEVAMLDAAYIALTSTIGLHFDDP
FT                   TANPRTGSRHAGMAMAPYNVYPSADGYVAIICVNEEHWHGVARAMGRADLIGDSRFATH
FT                   AARCAIMEEIDTMVGAWTGKLTRDRLMDASKVHRFPAAPVRKTAEVVQDPHLHARGMLI
FT                   DFDHPELGPVVLPNSPMRFDGLPPMPLRASPSLGQDNTRILKTHAAMPLEQA"
FT   gene            complement(488039..488827)
FT                   /locus_tag="Veis_0429"
FT   CDS_pept        complement(488039..488827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0429"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bch:Bcen2424_5509 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56217"
FT                   /db_xref="GOA:A1WF10"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF10"
FT                   /protein_id="ABM56217.1"
FT                   /translation="MSSRSDGTLATRDVHFDRRGAVAHILIDRPGVMNALAPATMEKLA
FT                   DAFLRAERDPEVRVIVIRGAGERAFSAGVDLGVTREALVHPMKRETRNLHEIILETEKP
FT                   TIAAINGVCIGAGCEIALACDLRIAVKEARFGQTEAKVGMGGNFAAVLLPQLLPRALAM
FT                   ELLYTGRLFSADEAFGWGLLNRVVDASELDSAAADMANSIAANAPLTVRKLKATLIRSH
FT                   GLPLSAALRLDAGPDPYNSQDRMEGALAFKEKRAPRFRGI"
FT   gene            complement(488811..489860)
FT                   /locus_tag="Veis_0430"
FT   CDS_pept        complement(488811..489860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0430"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   rme:Rmet_5356 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56218"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF11"
FT                   /protein_id="ABM56218.1"
FT                   /translation="MVCQKIQHEDQPLIDFGDNMETTDATRRFFCLRLGAAAVGTALNS
FT                   AHAALPVGYPAKPIRIVVPFPAGQGADASARALARELEAVLGQPLIIENRPGGNNVIGV
FT                   KAVTNAAADGYTLFYGTNSPMAANAVFFRDLGYDPVKDFTPVAMFGRSRWVVVVSAESP
FT                   IRSFADLVEASKRQTGGVSFAVGATGYQLAVILLANSSGLVANIVPYKGTPQAITDVIG
FT                   QQVTATMSDFGTMRALIEAGKVRPILAFADRRIAAIPGVPSLKDLKLDIPTLFSWTALF
FT                   AAAGTSSDIVNHLAEATSKALQSPAYKEYSAKNNSEIVFAGPAELAKFQRQEVENYRHA
FT                   MKVGNVEPQ"
FT   gene            490065..491051
FT                   /locus_tag="Veis_0431"
FT   CDS_pept        490065..491051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0431"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rme:Rmet_5360 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56219"
FT                   /db_xref="GOA:A1WF12"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF12"
FT                   /protein_id="ABM56219.1"
FT                   /translation="MRNFDLNLLLVLRTLLETTSVSETARRLDSTQPSVSRMLERLRVE
FT                   LGDPLLVKSSNTMVRTTRANELRPLLDKVIELLQAVYRAPGDYRLRDERRTCTIGASDS
FT                   LQAMFAMPLIATMRALAPNARLRFKPVPYPNPMRSLLAGEIDLLLAMTDEENSGFRSDV
FT                   LFKSSFSCMCAIENPHIGTRASIAAIAAMPYLEISHMGRISAATDAIFAVADKRKNTVA
FT                   AMSSFLAAPGVIANSPMICLVPDYLARTLGLHPGVKVVPLQDDLKQHTIRMIWHNTTHF
FT                   DAFLGAVRSLLQEIAKTPPYTVGSDGARTDAVQKSKKVKCDRPGCDS"
FT   gene            491177..492148
FT                   /locus_tag="Veis_0432"
FT   CDS_pept        491177..492148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0432"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   rme:Rmet_5382 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56220"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF13"
FT                   /protein_id="ABM56220.1"
FT                   /translation="MNQKILLQALVLVALAVTTPGQARDFPPKRPVTLVVGFAAGGAAD
FT                   VAARLIAKKLAENIGQSVVVDNKGGAGGNIAHQFVAQAAPDGSVLLLGSVGPLAIAPHL
FT                   MKLGYDPFKDLAAVSGGVNFPNVLVAHKGAGVKTLAEFVQLSKDKPGSVDFASTGTGSA
FT                   SHLAGELFNQRAGIDMTHVPYKGGAPALQDLLGERVTAYFAAPPTALPHVASGKLIPLA
FT                   TTGLTRPAYLPHIPTVAESGFPGFEALNWYAFVAPGKTPAPLLERWNQEIVKVLSDLAV
FT                   QEALNQQGLTPQPTTRAELTAFMKKESMQWAALIEERKIAAQ"
FT   sig_peptide     491177..491248
FT                   /locus_tag="Veis_0432"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            complement(492363..493517)
FT                   /locus_tag="Veis_0433"
FT   CDS_pept        complement(492363..493517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0433"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rme:Rmet_5435 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56221"
FT                   /db_xref="GOA:A1WF14"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF14"
FT                   /protein_id="ABM56221.1"
FT                   /translation="MAAPGLHARRNDGTLEARMAGPLTGLRMVEMAGLGPGPFCAMLFA
FT                   DLGADVIAIDRPGVEGDHSGVTGRGKRRLSLDLRQSGPRAAALALIAQADWLVEGFRPG
FT                   VMERLGLGPAECQALNPRLVYGRITGWGQSGPLSSAAGHDINYIALSGALHAIGRPGAA
FT                   PPPPLNYIGDYGGGAMLLAVGLLAALHEARQSGQGQVIDAAMTDGAALLSSLFYGLHAA
FT                   DSWSGGRGGNLLDGGAHFYDSYICADGKFVAIGAIEPKFFRRLCALCGLDESFAAQQME
FT                   RAQWPSMKLRLADVFRTRTRDEWCALLEGSDACFAPVLDWDEAPAHPHNRARGSFVTLG
FT                   AVVQPAPAPRFSRTPAAQPRAGSSIDLAAALDGWGATLPAQKMS"
FT   gene            complement(493751..494662)
FT                   /locus_tag="Veis_0434"
FT   CDS_pept        complement(493751..494662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0434"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bbr:BB0530 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56222"
FT                   /db_xref="GOA:A1WF15"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF15"
FT                   /protein_id="ABM56222.1"
FT                   /translation="MDTDTGHNAAQQGIRRLRFRHPELLSLQHQDASLRVAAQALHQTP
FT                   PALSKSLREVEAASGFALCVRSARGLAPTPRGERALCGATHVAARTGPSAGRSGAEPVL
FT                   TSLRIGVPPFAAQSTLPGISLRLFSRHSHPRVQVPQEPAPPLVQALRAGALDALISRYP
FT                   ARWPQTPGQPLRYEKRLDAGFAVIAPTGHALARARCVDWQRLAQAPWIMPAASAMLRRL
FT                   IDDAFRREGLPTPIIGSNCPSTNIRLVAAGLGLGAVPQVLMRAALAAGQMARVRVAPGI
FT                   RPGPVVLICREAAEQPARGHAA"
FT   gene            494760..495740
FT                   /locus_tag="Veis_0435"
FT   CDS_pept        494760..495740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0435"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   reh:H16_A2866 probable extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56223"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF16"
FT                   /protein_id="ABM56223.1"
FT                   /translation="MDRRSFCATASTAAAAAFFPWRVRAAAPYPGKPIRVISPYAAGGG
FT                   PDLLLRQVGPALGQALGQPIVIENKVGAGGVLAAIHAAQQPADGYLLLMGANTHLVQKA
FT                   MQPELGFDPIADFAPASNFATSPAMLVVNAGSAYQKLDDLMAAAKTWPGQMNYGSGGIG
FT                   TAAHLAGATLVSLMGIEAVHVPLKGSVEISASLLRGDTQFAFPIAGTAVPQVKGGKLRA
FT                   LAVTSRSRLQELPELPTLHELLGGNELAIQESWFGLWAPARTPAQILATLNAAVKKVVA
FT                   TPSLRSAAQALGTELSASPQACAAFVRGENLKWAELVRLAGVSGG"
FT   sig_peptide     494760..494837
FT                   /locus_tag="Veis_0435"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.826 at
FT                   residue 26"
FT   gene            495836..496881
FT                   /pseudo
FT                   /locus_tag="Veis_0436"
FT   gene            497114..497620
FT                   /locus_tag="Veis_0437"
FT   CDS_pept        497114..497620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0437"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   rfr:Rfer_1677 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56224"
FT                   /db_xref="GOA:A1WF17"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF17"
FT                   /protein_id="ABM56224.1"
FT                   /translation="MFHIVLVEPEIPPNTGNVIRLAANTGCTLHLIEPLGFSMEDRRMR
FT                   RAGLDYHEYARVLCHADWAAFLRTARPDASRMFALTTQSLQWVHATCFRPGDWFVFGAE
FT                   TRGLAAALRASFAPAQCLRLPMIEGQRSLNLSNAVAVTVFEAWRQNGFAMPSGQSAVAM
FT                   PGLLE"
FT   gene            complement(497704..498198)
FT                   /locus_tag="Veis_0438"
FT   CDS_pept        complement(497704..498198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0438"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   pol:Bpro_1240 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56225"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF18"
FT                   /protein_id="ABM56225.1"
FT                   /translation="MAGAGRYIAAMKIFHSYSDLSACVGQEVAVTEWLTITQEQINLFA
FT                   QATGDHQWIHVDPERAQAGPFGAPIAHGYLTLSLLPRFFQTGLRIEGARMGVNYGLNRV
FT                   RFTAPVPVGSRLRARLTLQATEPLAPDGLQMRWLVTVERDGSGKPVCVAESITRNYGAA
FT                   P"
FT   gene            complement(498480..499199)
FT                   /locus_tag="Veis_0439"
FT   CDS_pept        complement(498480..499199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56226"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF19"
FT                   /protein_id="ABM56226.1"
FT                   /translation="MNQLMGIDFKKLALVDANKLVDSMGSLNCTIEMGGAIHDTFDIHW
FT                   ICITSSTEDLQRIAIALLACAIGTQHQTYLPISTESLTENESRRCSTKPLTSFGKGIRI
FT                   TAARPSIDQPKSFTYTPKRKLKRYPWYPWSLTCDAQTELPVFTLAGVPGETACPRLWDG
FT                   RRDLREPYIACIGGHPKALIRLARLLLDYSDTSIPSDIDIVLETEGGLRGAGPLSYVAH
FT                   FERVDPCRCAACAGDSS"
FT   gene            complement(499196..500032)
FT                   /locus_tag="Veis_0440"
FT   CDS_pept        complement(499196..500032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56227"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF20"
FT                   /protein_id="ABM56227.1"
FT                   /translation="MQTDWVPGGGGVINPRHCSGAGCKGGKSGVYAEESTTGACRPGIQ
FT                   RLIGEHEMNKLMGVDLRKLASVDANKLVDSLGGSLNCSIQIGCHSYASAGGEYEISRIC
FT                   IASNAEDLQRLALVLLACAIGTQCETYLPITAVGPTKGIKIGSARPLEFDPFHQPKSFT
FT                   YTPKRDLKRYPWYPWSLTCDYWTELPCFGFDCAPGEYYTNMLWSGLADIPKPHVIVVSG
FT                   YPKALVRLARLLLDYANTDIPPEQIDLEVDGGFRGVKSFSYEVRFTRIADRLECMK"
FT   gene            complement(500071..500781)
FT                   /locus_tag="Veis_0441"
FT   CDS_pept        complement(500071..500781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56228"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF21"
FT                   /protein_id="ABM56228.1"
FT                   /translation="MNQLMGISFRKLALADANQVVASIGSLNCAIKVRGNSHNFCCIRI
FT                   YSEAEDLQRIAITLLACAIGTQHQVYLPIDTGDLAEKWSYKWNPNPGNSFAKGIRITAV
FT                   RPSIDQPKSFTYTPKSRLKRYPWSPWYKTCDPQTELPVFTLAGMPGETACPRLWDGRRD
FT                   LREPYMVCIGGHPKALIRLARLLLDYSDANIPSDEDIVLETERGLQGVGPLSYEARFER
FT                   VEPCRCPACVGDSS"
FT   gene            complement(500796..501437)
FT                   /locus_tag="Veis_0442"
FT   CDS_pept        complement(500796..501437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56229"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF22"
FT                   /protein_id="ABM56229.1"
FT                   /translation="MGVNLGKLASVDANKLVDSLGNLSCTIQFGCHSYASVGGEYEISR
FT                   MCISSNAEDLQRLALVLLACAIGTQSEAYLPIGTGGPTKGIQIDSERPSEYDPFHQPKS
FT                   FTYTPKRKLKRYPWYPWSLTCDHWTELPGFDLDDIPGESLHIFDGRMDLRKPHLVCIYG
FT                   YPKAFMRLARLLLDYASTDIPPEQIDLEIGGGFRGVSSASYEARFTRIAD"
FT   gene            complement(501513..502223)
FT                   /locus_tag="Veis_0443"
FT   CDS_pept        complement(501513..502223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56230"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF23"
FT                   /protein_id="ABM56230.1"
FT                   /translation="MNQLMGIEFKKMALIDANKLVGSIGGLNCVILIWGASHNFCCIRT
FT                   YSDAENFQRIAIMLLACAIGTQHQVYLPIDTGDLAEKWSYKWDARPGNSFAKGIRITAV
FT                   RSSIDQPKSFTYTPKRRLKQYPWHPWSVTCDVQTELPVFTLAGMPGETACPRLWDGRRD
FT                   LREPHMVCIGGHPKALIRLARLLLDYANTDTPPDEEIVLETVGGLRGVGPLSYEARFER
FT                   VDPCCCAACVGDSS"
FT   gene            complement(502238..502894)
FT                   /locus_tag="Veis_0444"
FT   CDS_pept        complement(502238..502894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56231"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF24"
FT                   /protein_id="ABM56231.1"
FT                   /translation="MNKLMGVDFKKLALIDANKLVDSLGILNCAIQFGCHSYASAGGEY
FT                   EISRICISSNAENQQRLALVLLACAIGTQRATYLPIDTGGPTKGIQVGSARPSEYDPFH
FT                   QPKFFTYTPKRELKRYPWYPWSLTCDGLAELPCFDLSYVPRESLHTLWDGRQDLRKPHI
FT                   ICIYGYPKAFIRLARLLLDYANTDIPPEQIDLEVDGGFRGVSAASYEVRFTRIAG"
FT   gene            complement(502958..503668)
FT                   /locus_tag="Veis_0445"
FT   CDS_pept        complement(502958..503668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56232"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF25"
FT                   /protein_id="ABM56232.1"
FT                   /translation="MNQLMGISFRKLALADANQVVASIGSLNCAIKVRGNSHNFCCIRI
FT                   YSEAEDLQRLAITLLACAIGTQHQVYLPIDTGDLAEKWSYRWNPNPGNSFAKGIRITTV
FT                   RPSIDQPKSFTYTPKRRLKRYPWSPWYKTCDPQTELPVFTLAGMPGETDCPRLWDGRRD
FT                   LREPYMVCIGGHPKALIRLARLLLDYSDTNIPSDIDIVLETERGIQGVGPLSYEVRFER
FT                   VEPCRCPACVGDSS"
FT   gene            complement(503683..504405)
FT                   /locus_tag="Veis_0446"
FT   CDS_pept        complement(503683..504405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56233"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF26"
FT                   /protein_id="ABM56233.1"
FT                   /translation="MYAEESTTGVCRPGIQRLIGGHEMNKLMGVDFKKLALIDANKLVD
FT                   SLGSLNCTIQFGCHSYASAGGEYEISRICISSNAENLQRLALVLLACAIGTQSEAYLPI
FT                   GTGGPTKGIQIDSERPSEYNPFHQPKSFTYTPKRELKRYPWYPWSLTCDHWTELPGFDL
FT                   DDIPGESLHIFDGRMDLRKPHLVCIYGYPKAFMRLARLLLDYASTDIPPEQIDLEIGGG
FT                   FRCVSAASYEARFTRIAD"
FT   gene            complement(504532..505251)
FT                   /locus_tag="Veis_0447"
FT   CDS_pept        complement(504532..505251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56234"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF27"
FT                   /protein_id="ABM56234.1"
FT                   /translation="MNQLMGIDFKKLASIDANKLVDSMGSLNCTIEMRCGVHDTYKIYW
FT                   ICIASSTEDLQRIAIALLACAIGTQHQTYLPISTESLTENESRRCNTKPSSSFGKGIRI
FT                   TAARPSIDQPKSFTYTPKRKLKRYPWYPWSLTCDAQTELPVFTLAGVPGETDCPRLWDG
FT                   RRDLREPYIACIGGHPKALIRLARLLLDYSDTSIPSDIDIVLEPDGGLRGAGPLSYVAR
FT                   FERVDPCRCPACVGDSS"
FT   gene            complement(505248..505928)
FT                   /locus_tag="Veis_0448"
FT   CDS_pept        complement(505248..505928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56235"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF28"
FT                   /protein_id="ABM56235.1"
FT                   /translation="MNKLMGVDLRKLASVDANKLVDSLGGSLNCAIQIGCHSYASAGGE
FT                   YEISRICIASNAENLQRLALVLLACAIGTQCETYLPITAVGPTKGIKIGSARPLEFDPF
FT                   HQPKSFTYTPKRDLKRYPWYPWSLTCDYWTELPCFGFDCAPGEYYTNMLWSGLADIPKP
FT                   HIIVVSGYPKALIRLARLLLDYANTDIPPEQIDLEVDGGFRGVKSFSYEVRFTRIADRL
FT                   ECMK"
FT   gene            complement(505943..509233)
FT                   /locus_tag="Veis_0449"
FT   CDS_pept        complement(505943..509233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_1475 YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56236"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF29"
FT                   /protein_id="ABM56236.1"
FT                   /translation="MHSHNTLTPWHPWLRPIARLLIGTLLCHALLPLSALAQQGAVPVS
FT                   PTDQAQIQRLRPPQQRDGPGQSARTRRPAPASERIARNLALAHSLVRALAKPVAAPGTG
FT                   AFAIKSASGQASEQQQLRALVQAIDADTDMALAEFHASRADLIEQQVGPEILARHDQAE
FT                   TQLRIRAQTLRQRLRAWQSQPDEQNLGAIGQFFEQYPAARARNPLNPGELPWGTPRPTT
FT                   AEPASSQAAWHQSLYADQKVLLAQAGTTIAGIRFDIPPAPGTAPDVADLAPTAEVTLSR
FT                   AIQAKAAQLGNNPVLIDNWVRNTVEFLPTWGALQNADSTLQTLRGNAFDIASLHIALLR
FT                   AAKIPARYQFGTIELPADKVQNWVGGTANAQAALNLLHQGGIAATGLARGGAIERIRME
FT                   HVWVQAYVNWSPGRGHRQGGAAASPPIRTPDAHLQHVNPNAHLNAWVPLDASYKQYRYT
FT                   SGLDIRSQVPQDASALLNAARHDDSTIDTAQGWVRRLNHAGIRAQLDAYQDRALAYIQA
FT                   QKPNASLADVFGHKRIIAWAPDVLAGATPYAVVLQGPQTTVVPDALRWAITFKLYASAN
FT                   DKADGAPLLSQSVLFSDIGSRRITAEGVAASSADQALIGQYVANATALPLYLIRQKTRL
FT                   KLDDRVLAESGPQRMGDPQWWSYVLTGPHFGSVEEDFKFENAVGDAIAFSVDATGIRCQ
FT                   DALDRAAAVAPDTALENLHQFGLGYWSRANEAGAIMANASNVIAYRLPSIGLFTSPLSV
FT                   TYSWGIPRTGQYRSYAVDIRRMSVAVTGVANPAATREYLLQTGARNSFLEGRIFEEMLG
FT                   LAPGAAASAVSVIAAANDQGVALWQLHAGNLQQYLAVTTVSASMQQQVASAVANRLEVL
FT                   APQAPVQLMRWSGQGFIATDPQTGAGAYIIDGVGNGGELVTCEESVQPLAESIAQRILT
FT                   SIALSIAAALLAVTVVSLPPATPALVSVMVMLGISSLTFSAHAAPNPCDKGSKDCHRGR
FT                   FQAQGGKKGDYAEESTTWVQPDPLTKREAFVLIEQLKAKLTPQQLKVREVAFFKAKRAI
FT                   AGVPSGGVCPRDWENSRAFYSLNNNNKNNKNNDIRIDVEVFAGQAFKD"
FT   sig_peptide     complement(509120..509233)
FT                   /locus_tag="Veis_0449"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.992 at
FT                   residue 38"
FT   gene            complement(509432..509947)
FT                   /locus_tag="Veis_0450"
FT   CDS_pept        complement(509432..509947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56237"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF30"
FT                   /protein_id="ABM56237.1"
FT                   /translation="MNGSVCESCCAPSRQARPASDHNAPPVTGQRRPAQTAWPALRVLA
FT                   ARVLGRLEATTTIITARLLPVLSLPCAALGATDPIGSGLAWLQSQILSDGQPSRTSALV
FT                   APTQARCETAKTLLRLLVSRHRSDVVGCAPPSERSARRIAQPIPSCIGKRCNAAMRFDG
FT                   QRGPTDDR"
FT   gene            510295..511062
FT                   /pseudo
FT                   /locus_tag="Veis_0451"
FT   gene            complement(511258..512394)
FT                   /pseudo
FT                   /locus_tag="Veis_0452"
FT   gene            complement(513066..513617)
FT                   /locus_tag="Veis_0453"
FT   CDS_pept        complement(513066..513617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56238"
FT                   /db_xref="GOA:A1WF31"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF31"
FT                   /protein_id="ABM56238.1"
FT                   /translation="MMKVDYRYLSFIILFVAFTSSLTMAAVTAGAWDGFTLLTIVALSF
FT                   ICTLAFYLAYISQARLTDEYLKDPWGRRVLGVILFCFALFLAYNIVGLTNAFPQAMIDV
FT                   KWAIKAAMLLGSGVVLMGTAGMAMIVHKEDMSSAGAGRNPITHEQLLRDLIVIVAWFLM
FT                   TFFIITEILERWVGSFFILT"
FT   sig_peptide     complement(513540..513617)
FT                   /locus_tag="Veis_0453"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.788 at
FT                   residue 26"
FT   gene            513665..513976
FT                   /locus_tag="Veis_0454"
FT   CDS_pept        513665..513976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56239"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF32"
FT                   /protein_id="ABM56239.1"
FT                   /translation="MKTPGDHSYFLSADQGCGELFRIVAISRSLLIGNFTVHKCHHQCD
FT                   PSFLVQTLHGADFICLASTFDKVIVFIVPAQSLVKYEVDYNKKKSGHHEVYYNHNNTS"
FT   gene            complement(514839..515171)
FT                   /locus_tag="Veis_0455"
FT   CDS_pept        complement(514839..515171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56240"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF33"
FT                   /protein_id="ABM56240.1"
FT                   /translation="MHHFCSGFVDFGLMEHFVLSQKKKKPYANLGDESINHSCEQHANN
FT                   YCVCFVHALRSLLHVIDGYNNQTLGKDWTGVCRYKTAYKTGIPSTCPGLDNRHDFSIPF
FT                   VRMGVE"
FT   gene            complement(515205..516008)
FT                   /locus_tag="Veis_0456"
FT   CDS_pept        complement(515205..516008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56241"
FT                   /db_xref="GOA:A1WF34"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF34"
FT                   /protein_id="ABM56241.1"
FT                   /translation="MENPGLSYGLLHTVAESVLGWGVVRKMAFRGVTINLASIPIWIYI
FT                   MDQWQPLLYKWIIYNRLRGQHMSALEHAIPERFFNDPATCNLQETTTPTAGLPACPQGI
FT                   SAVRALGIAATQRQRIYTITQRVYNDNPGIVNNELSAHSYETKSRIQQALDAGYEVTIH
FT                   ERPITQSGWTGAGFVTIDPNTGAGSYTIEGGGNGGFLGFINANGSWMSLLALLIGALPF
FT                   AYAFGVSTAITIVLAEIGLITYMKGLSGGPCDKMALPIYFSLLSC"
FT   gene            complement(516125..516748)
FT                   /locus_tag="Veis_0457"
FT   CDS_pept        complement(516125..516748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56242"
FT                   /db_xref="GOA:A1WF35"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF35"
FT                   /protein_id="ABM56242.1"
FT                   /translation="MDKMADLLVSSYFSILGTMCGFALLRALMKIDYRCFSAIFLIVVF
FT                   VFSFTMAMVTAGTWNGFNLLLTVVLSCICTLTFYFGYISRVKLTDEYLKNPWGRRVLGV
FT                   ILFCFALLFKNNIVTMVEVFPDAMIGVMEIIKWVMLFGSGVVCMGGVGAAMVIYKEGMP
FT                   SFDADRSPISHNQVLKSFIIVITCFTMAFLIIVVILEFMQTKPG"
FT   gene            complement(516842..517330)
FT                   /locus_tag="Veis_0458"
FT   CDS_pept        complement(516842..517330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56243"
FT                   /db_xref="GOA:A1WF36"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF36"
FT                   /protein_id="ABM56243.1"
FT                   /translation="MNSSIILASNKPVLDVFFLCMPFGFIFMLVMAATIKHWERAGPEF
FT                   AGIRLPTRQDFHRLALSWIIGMILSFPLFAWELNDIDRIRCETRGLRIKSRLDSRLISS
FT                   TNGLSINVKFHWSRGRYFMVEFKLNEQERWKTIALSREDAEQIKARAIQCLSSGNGSG"
FT   sig_peptide     complement(517232..517330)
FT                   /locus_tag="Veis_0458"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.890 at
FT                   residue 33"
FT   gene            complement(517645..520560)
FT                   /locus_tag="Veis_0459"
FT   CDS_pept        complement(517645..520560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0459"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   bur:Bcep18194_A4937 rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56244"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF37"
FT                   /protein_id="ABM56244.1"
FT                   /translation="MHSHNTLTPWHPWLRPIARLSIGALLCHALLPLSALAQHGAAPIS
FT                   PTDQAQIQRLAQWQQRIEQAKITRARAAQPMGSRVSERTSRNLSRVHELLKGIKARTER
FT                   APAGMKDLGSTMAAKTAKAAPTTGQADPAELEQIGALLGAIDADTDTVLADFAAQRQAL
FT                   QTQQVSAEILARHDQTQGELKQRANELRGIIGQWRQARSAAVLGALYAYFERYPAARVD
FT                   NPVDPAKLPWSNPPPNQRLPAESRAAWWRNLHPGQAVKLAQAGGGSTGIEFRIPPEPGL
FT                   APRPEDLAETPEVTLTPDIRAKALELKNNPVVIHNWVRNHIEWVPTWGAIQSAQDTLDK
FT                   RRGNAVDIASLQIALLRAAGIPARYQWGTVDMPAAQAMNWVGNASNPRAALQLMNRGGI
FT                   AARALVQGGTIQSIRFEHVWVQAYVNWSPGRGHHNASATQHVNPNGPLNAWVALDASVK
FT                   QYRYAAGMDLQTAVPLHAQALLDAAQTGATIDEQQGWVQNLNQAAARSHLEQYQNRLKT
FT                   YIDSQKPDASVADVIGKKIIAQTVHSVLAGVTPLAIVQTGQQAAAVPDSLQHKFSYTLS
FT                   DRWGNELLSYRQATSRLAGKRLTLSYEPADQATSDLIASYLPKPHADGSPIQPSELPGS
FT                   LPGYLIRLKPRITLDGQVVAQGGSAVTMGTDLQGQGGFTRLDDPTQWDLTPDASHTAGQ
FT                   VTAIGISAGGVSTAQLERLKARLEQTRNQLQANDTTRLTGEQISGQLLAATIWSWFAAA
FT                   ESHSRLSQNPAEIVENPGLSYGLLHTVAEPVLSWGVVRKVTFPGVNLDIGHIRNITWTK
FT                   DNDPAKWIVYNRLRGQHMSALEHAIPERFFNDPATCNLQETTTPTAGLPACPQGISAVR
FT                   ALGIAATQGQRIYTITQRVYNDNPGIVNNELSAHSYETKSRIQQALDAGYEVTIHERPI
FT                   TQSGWTGAGFVTIDPNTGAGSYTIEGGGNGGFWGSINANGH"
FT   sig_peptide     complement(520447..520560)
FT                   /locus_tag="Veis_0459"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.921 at
FT                   residue 38"
FT   gene            complement(520570..527994)
FT                   /locus_tag="Veis_0460"
FT   CDS_pept        complement(520570..527994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0460"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein; KEGG: mxa:MXAN_1046
FT                   FG-GAP repeat/HVR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56245"
FT                   /db_xref="GOA:A1WF38"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF38"
FT                   /protein_id="ABM56245.1"
FT                   /translation="MATISYHKTHLDILRWPEGVATVPAASIPRQTLPKASQQDIMNGS
FT                   VCESSCAPSRQTRPASDHNAPPVTGQRSPAQPAWPALRVLAAQVLGRLQTTTIITALLL
FT                   LPVLSLPCAALGATDPIGSGLAWLQSQILSDGQLSRASALVAPTQARCETAKTLLRLSG
FT                   SSPAVVTLTSTLPSDASTSTQALVCQSHLHRLLGSIANAGLAERSVAGGGYSAYPGQTG
FT                   TDGGASLLDTGWALHSQWQSLTPAELADTIAWLRTRQHPDGSFAQGPGAELMTTASILL
FT                   GLKDAATGSANAATIATRAASYLLAQREPSGRWASDLAMTALVFEAVQPYTGSDPAIAA
FT                   SVHGYLAGAQNPDGSWAGDPYVTALALRALHAAGQTPLNPTQAGIRLQFVDARTGIAIP
FT                   GVTLSGTGPSAIDASTDRSGQISIQGLYPGAYQLQASATGYSTVSLSLTLVAGQVSDAG
FT                   SIQMLVRPDTRSATVSGIARAQDGNAPLAGVTVVLQGQNLSAITAADGSYLIANVAPGT
FT                   LRLTASKAGYLDASGSATVQAGQVAHFSPLLIAAPVDPDHPGHPGRRIECSVQGRILGA
FT                   ASEQPLAGVQVTITGGHSAMTDANGRYRISGLTSGAVTISASLAGHDLAQARTHILCSD
FT                   LRSTALDYSPRLYASRQTPAHANSATLGGIVMDAGTNRPIAGAALILRPEQGAALALQT
FT                   GADGRFSQAGLDGASVQLDVAASGYQSASLHYALGPMQNLDVGQIRLRPPQVEQLLPDL
FT                   AIQAVRRATAVTDPQSLRLSGTIALQLANVGKHSAPGNVALLAFSDVNANGRFDAADDT
FT                   VLGTATLPTALAPNQSVGLELEVAGQLPFRDAPIHVLLDANAQLAEASKSNNTRSTAQD
FT                   EIVIPVRSRFALKKAYRWPGSVMMSPVVGRIHDTNGDGRIDQRDTPRIVFTNYSGSYFS
FT                   ASTLHAIDGATGQEVLTVPTSLFGGVVSQTGLALADLDGDGQPEIIGIKHSGGIIVLSA
FT                   TGQIRWQVPGAIPIPVSVADIDADGHPEVLLGNEVYSHTGALKSTLAGCHHESGAYAID
FT                   LDPGRAGQQILCGTAAYDSDGTLLWPGVLPGRSVFTTAIANFNGDPHPEIVVVHAGNVW
FT                   LMDHRGQALWGPVALASGAGGAPTVADFDGDGVPDIGVAGASHYSVFRADGSLLWRTRI
FT                   YDASANTGSTAFDFDGDGRVEVIYRDQGTLRIFDGATGQVLLHTDSSSSTGAEYPLVAD
FT                   VDGDGHADLVVPGDAGAQGGIVVYRDVDNAWVATRSVWNQYDYSITNINDDLSVARQPV
FT                   ASWQAQNTFRLNRRTDGDPRAVADLTAGFVRVTDPGADSGAALITVRLGNAGSYKVPAG
FT                   TAVLIYDADPALGRPAVVGRATIGRELASNEYLDLDITPTRALHQISPGHSVWIVADDD
FT                   GSGHGSFADFDRSNNTVRAPLDALARRLDIAVAPDKPVYREAEQAQFTATVSNRGSFAR
FT                   DAQLRWSVLDAGGQIVARLPLAASVHLPVAGTAQVRASWPAAGTLAGVLAGPYQIEAEL
FT                   IDPQGQAYASALAPWAVDSSQARQIFARISTDRSSYSAAERVQISSQIGNLTSNTMLSD
FT                   LLAVTELLDAGGQVVRQYAQNLPQLPPAARRQYDYTLPASGLAAGSYSARLRVSAAANA
FT                   AAPLAEHSTGLRVLDSSQSGVGITGQLQARPASAAPGQSVTLSLALRNAGNAALHHSTV
FT                   RVRVLDPASGQVLGSFARTDFALARGASQSLSWEWVATNGAAAAGSTALAAATIELRPG
FT                   QEIPLSQTPIALTAPALQPLTGTVSASPRSVPGGTAVQLLYAAHNPNPGPVPASLTLSI
FT                   RPTDGTDTGAVAQWPMEHHFGAHTGLTGNQSWTPDGPIGSSYTVTWSAATAASGSPVGT
FT                   VLASDTFTVSAAPAAAAPVSVQARAGSLPRLLMLLSCSPSADDNLAPSPACDEFKAQAV
FT                   RGYFAQRGIEASVVTSRAEFVTAMRCGNYGIFAISGGTHKLTDTSVKELREAIERGAGL
FT                   WLDGAPHARDRILHQVAGIERQSILDSDAPVASFVGDLFPPGGINTIGKPALIALHGGT
FT                   VQARFGTAPAIVSRSVGQGRSLAFALNLATMLGQPQASADALLADLVQRSLAYLSPRAP
FT                   NSGVPGAPQSLVTDIRNDGPRPASVSVQALLPAGVDLLGQHPASDPPRSMPGGGTRIDW
FT                   RLTLPPGQVVSLVVQVGSHSPGQYDIPLQVQADASNQSLTHRLHIATPAALALDATQAL
FT                   ALLQAPASTGAAAVHAARSAAARASDLMALARYADSRFAWLEAADAVRSIPEPDSSATA
FT                   AARQAIAVALQAAQRQLCRQWACLSGALGFTVNGQRSHAVPLAGHVEGSRTVYNQCPQP
FT                   FEGIAVTSQWIDRRTGVGVQYLSDTLSLAGDSQHRRANVWQADGWHSDIIDVILTAQWP
FT                   TADELLFLDRSALQIAARPPGPGRPKPKPQLCLRSGPAQPGATQPHCQGPGPAPAPAAP
FT                   AAPGRTASPD"
FT   gene            complement(528385..528461)
FT                   /locus_tag="Veis_R0001"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(528385..528461)
FT                   /locus_tag="Veis_R0001"
FT                   /product="tRNA-Met"
FT   gene            complement(528487..529266)
FT                   /locus_tag="Veis_0461"
FT   CDS_pept        complement(528487..529266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0461"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rfr:Rfer_1573 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56246"
FT                   /db_xref="GOA:A1WF39"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF39"
FT                   /protein_id="ABM56246.1"
FT                   /translation="MAYETIAVRVEADQVGVITLDRPKQLNALNDLLMNELGAALKAWD
FT                   ADEKIGCMIITGSEKAFAAGADIGAMAKYSFADAYKGDYITRNWETIRAIRKPVIAAVS
FT                   GFALGGGCELAMMCDFIIAADNARFGQPEIKLGVIPGAGGTQRLPRAVGKSKAMDMALT
FT                   GRMIDAAEAERIGLVSRVVAYGQLMDEALGAALGIAGLSRIAVMAAKESVNRAFEGTLS
FT                   DGLMFERRLFHALFATHDQKEGMDAFVNKRPAHFTHQ"
FT   gene            complement(529418..531196)
FT                   /locus_tag="Veis_0462"
FT   CDS_pept        complement(529418..531196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0462"
FT                   /product="peptidase M61 domain protein"
FT                   /note="PFAM: peptidase M61 domain protein; KEGG:
FT                   rfr:Rfer_1574 peptidase M61"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56247"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF40"
FT                   /protein_id="ABM56247.1"
FT                   /translation="MSSPSKAQAADVHYRIAPADLHAHLFTVALTVARPAAGQELSLPV
FT                   WIPGSYLIREFSRNLQALKARQGRHEVALTQLDKHRWQIDCTPGSPLELTYAVCAYDRS
FT                   VRSAWLDADRGFFNGSSLCLRVHGQEKQRHTLDIAGTSATAQWSVATALEAIATDPRGF
FT                   GRYAAADYDELIDCPVELGIFWVGRFKACGIPHQMLVSGATPAFDGQRLLADTRKICET
FT                   AIRFWHGPRGAAPHRRYLFMLHAVAEGYGGLEHRNCSALTCGRADLPRRQESRASEGYT
FT                   TLLRLISHEYFHTWNVKRLRPAEFASYDYSRENYTELLWFFEGFTSYYDDLLLRRAGLI
FT                   DDATYLRLLGKAINQLLQTPGRTLQTVAQASFDAWVKYYRQDENTANATVSYYTKGALV
FT                   ALCLDLTLRREGRTTLDEVMRALWARSAGGPITQADLCALLHTLAGRPFDEELAQWVHS
FT                   TAELPLADLLAAHGVSLKAEPPQWAQRLGLRVTENHGLHIKSVLRGGAAEKAGLAAGDE
FT                   WLGVQVQGQGWRIRQLDEMALYLGSGTALTALVARDGRLLQLPLELPRQPNRRAAAPDT
FT                   VSLSATDTVALGRWMG"
FT   gene            complement(531228..531968)
FT                   /locus_tag="Veis_0463"
FT   CDS_pept        complement(531228..531968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0463"
FT                   /product="putative thiol:disulphide interchange protein
FT                   (periplasmic)"
FT                   /note="KEGG: pol:Bpro_1124 putative thiol:disulphide
FT                   interchange protein (periplasmic)"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56248"
FT                   /db_xref="GOA:A1WF41"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF41"
FT                   /protein_id="ABM56248.1"
FT                   /translation="MKLTTALLTTAAAITLALSLSANAQEAQIRQALAERFPKLEKIDE
FT                   VRATPLVGLYEVRIGTDLYYTDAKGDYVLHGNLIDAKSRRNLTQERVNKLLAVDFSTLP
FT                   LKDAVTIVRGDGRRRLAIFEDPNCGYCKLLERSLQQVNDITVYLFLYPILNDDSTQKSR
FT                   NIWCAKDKAGAWQDQMLRNKPAAAADCDTSALQRNLAFGAKHKITGTPTMIFANGSRVP
FT                   GALDAQEVEKRLAEAAGGKSPSTP"
FT   sig_peptide     complement(531894..531968)
FT                   /locus_tag="Veis_0463"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(532075..533223)
FT                   /locus_tag="Veis_0464"
FT   CDS_pept        complement(532075..533223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0464"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase,
FT                   FAD-binding; KEGG: rfr:Rfer_1576 ubiquinone biosynthesis
FT                   hydroxylase, UbiH/UbiF/VisC/COQ6 family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56249"
FT                   /db_xref="GOA:A1WF42"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF42"
FT                   /protein_id="ABM56249.1"
FT                   /translation="MAPSFDVCIRGAGIVGQTLALLLARERLKVALVSAPGPQAAVADV
FT                   RAYALNRASRQLLESLRSWPEAQQATAVRRMQILGDRDGVVRFDAASQGVDALAWIVDV
FT                   PALQARLAQALRFQPEVELLDAAAPAALTVVCEGRHSSTRAEFGVDFHATPYAQQAIAT
FT                   RLHCERPHEQIAHQWFLPDGIVAFLPLEGAHGNSVAVVWSVAPEQAARLLALSPQAFAQ
FT                   ELQTASQGALGTLTLCAQRAVWPLQLAHAERWCAAVPADGKNPHDRGGGGSWVLAGDAA
FT                   HNVHPLTGQGLNLGLADAQALAHVLRQRDYWRTVADLRLLRRYERERKAALLAVGLVTD
FT                   GLQQLFSRQQGPWQALRNWGMKGFEHSGPLKKFVARQAMGMY"
FT   gene            533312..534184
FT                   /locus_tag="Veis_0465"
FT   CDS_pept        533312..534184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0465"
FT                   /product="MOSC domain protein beta barrel domain protein"
FT                   /note="PFAM: MOSC domain containing protein; MOSC domain
FT                   protein beta barrel domain protein; KEGG: pol:Bpro_1126
FT                   MOSC-like beta barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56250"
FT                   /db_xref="GOA:A1WF43"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF43"
FT                   /protein_id="ABM56250.1"
FT                   /translation="MSFNPDGHLSGHIARLFVYPVKSCAGIAVQQALLTETGLDLDRAW
FT                   MVVDAHGMFVTQRDLPRMALIRPQLRSDDMVLRAPGMLALHVALDAVEAPATVTLWQDR
FT                   VPAWDMGAVAAQWFSDFLGQPCRLVRFDPEHRRLSSMQWTDGWEAPNQFSDGFPLLLLG
FT                   EASVEEFNGRLLAAGHAAVGIERFRPNLVLAGMAAHDEDRMDMLRVDGGARDELRLQPV
FT                   KPCARCAIPDIDPATARISPSVGDMLRSYRQDRRLAGAISFGMNAIVRQGAGQMLRVGQ
FT                   RVAADWRFD"
FT   gene            534291..535385
FT                   /locus_tag="Veis_0466"
FT   CDS_pept        534291..535385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0466"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: GTP-binding
FT                   protein, HSR1-related; Protein of unknown function DUF933;
FT                   KEGG: bpe:BP3121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56251"
FT                   /db_xref="GOA:A1WF44"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF44"
FT                   /protein_id="ABM56251.1"
FT                   /translation="MSLQCGIVGLPNVGKSTLFNALTRAGIAAENYPFCTIEPNVGVVE
FT                   LPDPRLGQLAAIVAPERIVPAIVEFVDIAGLVAGASQGEGLGNQFLAHIRETDAIVNVV
FT                   RCFEDDNVIHVAGRVDPISDIEVIQTELCLADMATVEKALNRHTKAAKSGNDKDAARLV
FT                   ALLTRIRTALNQGLPARSVDLAKEEQPLLKPLCLITAKPTMFVANVGEDGFRNNPFLER
FT                   LNEYAASQNAPVVAICAKMEAEMAEMSDADRQLFLAEMGQSEPGLARLIRGAFKLLGLQ
FT                   TYFTAGVKEVRAWTIPIGATAPQAAGVIHGDFERGFIRAQTIAFDDFIACQGEQGARDA
FT                   GKMRAEGKDYRVKDGDVLNFLFNV"
FT   gene            535616..536014
FT                   /locus_tag="Veis_0467"
FT   CDS_pept        535616..536014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebB86 RelE-like cytotoxic translational
FT                   repressor of toxin-antitoxin stability system"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56252"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF45"
FT                   /protein_id="ABM56252.1"
FT                   /translation="MKPCTEERQDLIDYLAEHPKAGDVMEGTSGVRKLRWRRGGQGKSG
FT                   GVRVIYYHHDDLMPLYLLTLFAKGDKANLTKAERNDLVSRHRSSVGLRWPSKRIAALHR
FT                   LPIQLGMGCAMRLALRSDGCAQPTTSDR"
FT   gene            536072..536356
FT                   /locus_tag="Veis_0468"
FT   CDS_pept        536072..536356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0468"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bpa:BPP2999 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56253"
FT                   /db_xref="GOA:A1WF46"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF46"
FT                   /protein_id="ABM56253.1"
FT                   /translation="MSTAFESIKQGLQEAIAHARGDERGVRVHRPRAIDVKAVRAKVGM
FT                   TQEQFAARFGFSTATLRHWERGDRTPHGPALVLLNVIERNPQAVIEALA"
FT   gene            complement(536408..536641)
FT                   /locus_tag="Veis_0469"
FT   CDS_pept        complement(536408..536641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xom:XOO_2345 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56254"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF47"
FT                   /protein_id="ABM56254.1"
FT                   /translation="MMRKNQLLRSLADALKTRRFNRRADMEQTLLRYVARYNHPLAQSA
FT                   LGSKTPMQAMKFCARAAGAAGALRCSLDAQIT"
FT   gene            complement(536679..537677)
FT                   /locus_tag="Veis_0470"
FT   CDS_pept        complement(536679..537677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0470"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: pol:Bpro_0313 lipoic acid synthetase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56255"
FT                   /db_xref="GOA:A1WF48"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WF48"
FT                   /protein_id="ABM56255.1"
FT                   /translation="MASADRQMIGDATLAYDPRAKQKAAAKLARIPIKVEPGERLKKPD
FT                   WIRVKAASPGTRFDDIKRILREHRLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRC
FT                   PFCDVGHGRPDPLDQDEPMNLARTVAALALEYVVITSVDRDDLRDGGSGHFVDCIQSIR
FT                   KLSPQTRIEILVPDFRGRDDRALAILQAAPPDVMNHNLETAPRLYPQARPGSDYRFSLN
FT                   LLKKFKALHPTVPTKSGIMVGLGETDEEILQVMRDMRAHGIEMLTIGQYLAPSSSHLPV
FT                   RRYVHPDDFRMFEQEAYRMGFSHAAVGAMVRSSYHADRQAQAAGLHVNAPK"
FT   gene            complement(537866..538561)
FT                   /locus_tag="Veis_0471"
FT   CDS_pept        complement(537866..538561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0471"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: rfr:Rfer_3935
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56256"
FT                   /db_xref="GOA:A1WF49"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WF49"
FT                   /protein_id="ABM56256.1"
FT                   /translation="MSMVVRTLGRVDYLATVQAMQDYTARRGPQDPDLLWLCEHDRLYT
FT                   QGLAGQDRHVLAPGDIPVLQSNRGGQVTFHGPGQVVAYPLIDLRRAGYYVKEYVYRIEE
FT                   AVIRCLAQWGVTGHRVAGAPGIYVRPDDPGGHALLPLRPPKSPGTPAPAPDFQGLGKIA
FT                   ALGVKVSRHCSYHGVALNVAMDLEPFARINPCGYAGLRTVDLSTIGVRLRWDEAAQLLG
FT                   RQLCIWLAP"
FT   gene            complement(538561..538944)
FT                   /locus_tag="Veis_0472"
FT   CDS_pept        complement(538561..538944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0472"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   rfr:Rfer_3936 protein of unknown function DUF493"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56257"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF50"
FT                   /protein_id="ABM56257.1"
FT                   /translation="MAKCKAPPVIEADETDALCTMSSATPPPANHHGLDPQATDPRQDS
FT                   LIEYPCRFPIKVMGVKADGLVHAVTTLARRFDPGFDAATIELRDSRAGHYLGITITITA
FT                   TSRAQLDGLYRALSSHPMVKIVL"
FT   gene            539144..539644
FT                   /locus_tag="Veis_0473"
FT   CDS_pept        539144..539644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0473"
FT                   /product="putative ATP synthase protein I"
FT                   /note="KEGG: rfr:Rfer_0113 putative ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56258"
FT                   /db_xref="GOA:A1WF51"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF51"
FT                   /protein_id="ABM56258.1"
FT                   /translation="MKTIAPDEATEAEESDFEPLTAQQAQEWREHRRGAREHQAPLSVW
FT                   RLLAGQAMVGMLVALLAWGLTGRAVAGWSAACGALAVVLPAALFARAVLRPKAGVDPRA
FT                   VLLGFVGWELAKIMLTLALLAAAAQWVPGLSWVALLVGMASAMKMYWVALWVWPGVRKT
FT                   VSV"
FT   gene            539664..540527
FT                   /locus_tag="Veis_0474"
FT   CDS_pept        539664..540527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0474"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit; KEGG:
FT                   pol:Bpro_0321 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56259"
FT                   /db_xref="GOA:A1WF52"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WF52"
FT                   /protein_id="ABM56259.1"
FT                   /translation="MAASAHAPTASEYIVHHLQHLQNVPQTKIVDFSVVNYDSMVLALL
FT                   LGGLTLLILWTAARKASCGVPGRLQAAVEILVEMVDNQAKANIHNAESRKFIAPLGLVV
FT                   FVWVFLMNAMDMVPVDLLPSIWGQIRQDSHEPLRVVPTADLSTTMGLALAVLGLRFWYS
FT                   LKIKGAGGWAHELVSAPFGTSKNPLFALILGLVNLLMQVIEYVANTVSHGMRLFGNMYA
FT                   GELVFMLIALMGGAAALSLSGVLLPVGHVIAGTLWTLFHILVITLQAFIFMMLALIYLG
FT                   QAHNAH"
FT   gene            540567..540836
FT                   /locus_tag="Veis_0475"
FT   CDS_pept        540567..540836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0475"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+-transporting two-sector ATPase, C subunit; KEGG:
FT                   rfr:Rfer_0111 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56260"
FT                   /db_xref="GOA:A1WF53"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WF53"
FT                   /protein_id="ABM56260.1"
FT                   /translation="MEIILGFVALACGLIVGLGAIGASIGIGLMGGKFLESSARQPELI
FT                   NELQTKMFILAGLIDAAFLIGVAIALMFAFANPFVSTLLANMPK"
FT   sig_peptide     540567..540635
FT                   /locus_tag="Veis_0475"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.882) with cleavage site probability 0.761 at
FT                   residue 23"
FT   gene            540880..541350
FT                   /locus_tag="Veis_0476"
FT   CDS_pept        540880..541350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0476"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, B/B' subunit; KEGG:
FT                   pol:Bpro_0323 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56261"
FT                   /db_xref="GOA:A1WF54"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WF54"
FT                   /protein_id="ABM56261.1"
FT                   /translation="MSINATLFVQAIVFLILVWFTMQFVWPPIAKALDERAQKIADGLA
FT                   AADRAKSELSAANQRVEKELSQARNETAARLADAERRAQAIIEEAKARATEEGNKLVAA
FT                   ARAEAEQQMVQAREALRAQVAVLAVKGAEQILRKEVDAGVHAGLLRRLQTEL"
FT   gene            541361..541912
FT                   /locus_tag="Veis_0477"
FT   CDS_pept        541361..541912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0477"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta (OSCP) subunit;
FT                   KEGG: pol:Bpro_0324 ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56262"
FT                   /db_xref="GOA:A1WF55"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WF55"
FT                   /protein_id="ABM56262.1"
FT                   /translation="MAELATIARPYAEALFKATTGAGVDPVSAAAWLDELAAIADRPEL
FT                   RQLAGNPKVTADQVFALFTQVLKDAARAALPEMAGNFLRTVIANGRINVLTQVAQQFRA
FT                   LLNRRNGFSDAVVYSAFPMDSAALSEVGAALQKRFGRKLNLAVQQDPSLIGGIRVVVGD
FT                   EVLDSSVKARLEQMKAALTA"
FT   gene            541976..543589
FT                   /locus_tag="Veis_0478"
FT   CDS_pept        541976..543589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0478"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: pol:Bpro_0325 ATP synthase F1, alpha subunit;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56263"
FT                   /db_xref="GOA:A1WF56"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WF56"
FT                   /protein_id="ABM56263.1"
FT                   /translation="MQLNPAEISELIKSRIEGLGVSADIRNQGTVVSVTDGIVRVHGLS
FT                   DAMQGEMLEFPPTADGTPSFGLALNLERDSVGAVILGEYEHISEGGTVKCTGRILEVPV
FT                   GPELIGRVVNALGQPIDGKGPINAKMTDVIEKVAPGVIARKSVDQPMQTGLKSIDSMVP
FT                   VGRGQRELIIGDRQTGKTAVAIDAIINQKGQNMTCVYVAIGQKASSIKNVVRSLEQAGA
FT                   MDYTIVVAASASESAAMQYVSAYSGCTMGEYFRDRGQDALIVYDDLSKQAVAYRQVSLL
FT                   LRRPPGREAYPGDVFYLHSRLLERAARVNADYVEAFTKGAVKGKTGSLTALPIIETQAG
FT                   DVSAFVPTNVISITDGQIFLETSLFNAGIRPAINAGISVSRVGSSAQTNLIKNQSGGIR
FT                   TDLAQYRELAAFAQFASDLDEATRKQLDRGARVTELLKQTQYSPLPISLMNATLFAVNK
FT                   GFTDDIDVKKVLPFEHGFHQLLKTSHAALLETMEKNGAKWDVKPAKPDDSAEKQAFKKV
FT                   CQDAEAELLAAATSFKKSFA"
FT   gene            543623..544498
FT                   /locus_tag="Veis_0479"
FT   CDS_pept        543623..544498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0479"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: pol:Bpro_0326 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+-transporting two-sector ATPase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56264"
FT                   /db_xref="GOA:A1WF57"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WF57"
FT                   /protein_id="ABM56264.1"
FT                   /translation="MAAGKEIRGKIKSVENTKKITKAMEMVSVSKMRKAQERMRAARPY
FT                   SEKIRNIAANLGKANPEYTHAFMKKNDAKALGFIIVTSDKGLCGGLNTNLLRAVTAKLR
FT                   EAQAAGVAIESVAIGSKGLGFLNRIGARVVAHVTHLGDTPHLDKLIGPVKTLLDAYAEG
FT                   KLSAVYLSYTKFINTIKQEPLVEQLLPLAEDSLKVEEGQHSWDYIYEPDAQSVIDELLV
FT                   RYVESLVYQAVAENMASEHSARMVAMKAATDNAGNVISELKLVYNKTRQAGITKELSEI
FT                   VSGAAAAAGV"
FT   gene            544542..545957
FT                   /locus_tag="Veis_0480"
FT   CDS_pept        544542..545957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0480"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: pol:Bpro_0327 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56265"
FT                   /db_xref="GOA:A1WF58"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WF58"
FT                   /protein_id="ABM56265.1"
FT                   /translation="MAQAEAVQGKIVQCIGAVVDVEFPRDKMPKIYDALKFEGSALTLE
FT                   VQQQLGDGVVRTIALGSSDGLRRGLIVTNTQAPITVPVGKATLGRIMDVLGAPIDERGP
FT                   VDQTLTASIHRKAPAYDELSPSQDLLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNM
FT                   MELINNIAKAHSGLSVFAGVGERTREGNDFYHEMADSGVVNLEKLENSKVAMVYGQMNE
FT                   PPGNRLRVALTGLTIAESFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPT
FT                   LAEEMGRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFAHLDSTVVLSRDIASLG
FT                   IYPAVDPLDSTSRQLDPNVVGQEHYNVARAVQGTLQRYKELRDIIAILGMDELAPEDKL
FT                   AVARARKIQRFLSQPFHVAEVFTGSPGKYVPLSETIRGFKMIVNGEADHLPEQAFYMVG
FT                   TIDEAFEKAKKVA"
FT   gene            546009..546425
FT                   /locus_tag="Veis_0481"
FT   CDS_pept        546009..546425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0481"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta/epsilon subunit;
FT                   KEGG: rfr:Rfer_0105 ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56266"
FT                   /db_xref="GOA:A1WF59"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WF59"
FT                   /protein_id="ABM56266.1"
FT                   /translation="MNTIHVDVVSAEESIFTGQARFVALPGEVGELGIYPRHAPLITRI
FT                   KPGSVRIEMADGSEEFVFVAGGLLEVQPHCVTVLSDTAIRGKDLDDEKANAAKAAAEEA
FT                   LKNAKSDLDLAKAQSELAVMAAQIAALRKFRQKK"
FT   gene            546684..546896
FT                   /locus_tag="Veis_0482"
FT   CDS_pept        546684..546896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syn:slr0725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56267"
FT                   /db_xref="GOA:A1WF60"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR021679"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF60"
FT                   /protein_id="ABM56267.1"
FT                   /translation="MIVLAWVNDEDSKRANGSGNDAYRVFGKMRQSGHPPDDWGQLLLQ
FT                   ARARNERLAGLGNPGAAGSGSDNGA"
FT   gene            546893..547957
FT                   /locus_tag="Veis_0483"
FT   CDS_pept        546893..547957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0483"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   rfr:Rfer_0576 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56268"
FT                   /db_xref="GOA:A1WF61"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF61"
FT                   /protein_id="ABM56268.1"
FT                   /translation="MNPQPSDNSPSTAAVTDLHPYARLTPDHVLDALASVQLYGDGRLM
FT                   ALSSYENRVYQVTLEDGQRVVAKFYRPGRWDAAQILEEHAFAAELMAAEVPAVGPMALN
FT                   GATLHQHQDFAFSVSPWRGGRQPELDDPEVLQWIGRFLARIHTVGAAQPFVHRPRLDLQ
FT                   DFGVASRNWLLEQQVIPLDMQARWREQCDKAIELIADGACSTCAGGPSGLKDARLIRLH
FT                   GDCHPGNILWTPLDEYGRGGPHFVDLDDARMGPAVQDLWMLLSGDRRQRTQQLGALLDG
FT                   YEQLRSFDQRELALIEPLRTLRLIHYSAWLARRWQDPIFPLNFPWFGSSDYWRGQVDML
FT                   IEQIEAMQEAPLMV"
FT   gene            complement(547995..549983)
FT                   /locus_tag="Veis_0484"
FT   CDS_pept        complement(547995..549983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0484"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region,
FT                   ATPase domain protein domain protein; KEGG: rfr:Rfer_3551
FT                   heat shock protein HSP90"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56269"
FT                   /db_xref="GOA:A1WF62"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WF62"
FT                   /protein_id="ABM56269.1"
FT                   /translation="MSKQTLSFQAEVAQLLHLVTHSLYSNQEIFLRELISNASDACDKL
FT                   RFAGLNQPALFEDAPQLEVRVSFDQTARTLTITDNGIGMSQQEAIEHLGTIAKSGTKDF
FT                   MGQLSGDQKQDAQLIGQFGVGFYSGFIVADKITVESRRAGLPASEGVRWASGGTGDFEV
FT                   ETIDRPARGTSVILHLRDSAEEYLNNWKLKSIISRYSDHISLPILMEKQEWKDGELINP
FT                   GDEKGGRQPGAMVKTGDWETVNQASALWARPKKDVSDAQYAEFYKTISHDPLAPLTWAH
FT                   NRVEGSTEYTQLLYIPAKAPFDLWNRDKKAGVKLYVKRVFIMDDAEALLPTYLRFVKGV
FT                   IDSADLPLNVSRELLQESRDVRAIREGSTKRVLSMLEDLARHDRHDSPAPQPAEGADRV
FT                   SDVVDADDKAKEGKYSQFYAEFGAVLKEGLGEDFANRERLARLLRFASTSSDQASVGLA
FT                   DYKARMKEGQEAIYYITADTLAAAKHSPQLEVFKKKGIEVLLMTDRVDEWALNYLHEFD
FT                   GTPLQSVAKGAVDLGKLQDEAEKKAAEEAAEAFKPLLARLKETLKDKAEDVRVTTRLVD
FT                   SPACLVVHGDGMSTQLARLLKQAGQQAPETKPVLEVNASHALVRKLDGSQHFDDLAHIL
FT                   FDQALLAEGGLPADPAAYVKRVNALLV"
FT   gene            complement(550244..551161)
FT                   /locus_tag="Veis_0485"
FT   CDS_pept        complement(550244..551161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0485"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; KEGG: pol:Bpro_0606 pseudouridine synthase, Rsu"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56270"
FT                   /db_xref="GOA:A1WF63"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF63"
FT                   /protein_id="ABM56270.1"
FT                   /translation="MSSSNPSAPTPAPRAVLRRPTAAAKPATPACPAGMAAGVVPDAAR
FT                   GAVPGTANGTDRLRLNKRMAELGLCSRREADDWIAQGRVRVNGQVAPIGLRVTASDRIA
FT                   VDKQARGAQRQRVTILLHKPMGYVSGQAEDGHRPAVALIDQRTHWRDDTSRNRFAPAQL
FT                   RGLAPAGRLDIDSVGLLVLTQDGRVARQLIGADSTVDKEYLVRVQYGAVALDVRSVFPA
FT                   GQLASLCHGLSLDGQPLKPAVVDWQNPEQLRFVLTEGRKRQIRRMCALVGLTVVGLKRV
FT                   RIGRVRLGLLPAGQWRYLAADEQF"
FT   gene            551289..551591
FT                   /locus_tag="Veis_0486"
FT   CDS_pept        551289..551591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56271"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF64"
FT                   /protein_id="ABM56271.1"
FT                   /translation="MPTTVRNRNPDHVPARPAPACRRTLRCAGAVRKRIWHLSLLVSRH
FT                   RSDVVGCAQPSERSARRIAQPIPSVLASDATPRCASMASADRQMIGDATLASWYA"
FT   gene            complement(551605..552771)
FT                   /locus_tag="Veis_0487"
FT   CDS_pept        complement(551605..552771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rle:RL2519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56272"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF65"
FT                   /protein_id="ABM56272.1"
FT                   /translation="MGFAHSSRRMAVSRVLLALLVLAGCGGSDGGGGSAGAGAGPPIVA
FT                   LRLLGAAAIPTGTLFEGVEFGGISGLDRAADGSYWALSDERGGDGRVPRFYNLSIDYEA
FT                   SGNVSVQINRQTAMLREDGSAFPAATRTVDPEAIRVAAGGQLYWASEGNWDAAAARRFQ
FT                   PFVRQMTAQGAFVREFAIPAIYHYVDNRTQGARNNKVFESLAVAPDGTVYVANEDALIE
FT                   DGPSASLQAGSVVRVTALDPGTGQARAQYAYELPKIPVDGKPDAAFGPDNGLSDMLAAG
FT                   PRQFIAVERAFAFGVGNTIRLVWTEINDTTTDVSRIASLVEAKYTPMSRRLLLEMPLRY
FT                   QGVKLDNIEAITWGKTLPNGNRTLVLASDNNFSATQTNQFIVLEVLAN"
FT   sig_peptide     complement(552652..552771)
FT                   /locus_tag="Veis_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.316 at
FT                   residue 40"
FT   gene            552945..553931
FT                   /locus_tag="Veis_0488"
FT   CDS_pept        552945..553931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0488"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_0597 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56273"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF66"
FT                   /protein_id="ABM56273.1"
FT                   /translation="MKTMLKIALLAAATATAFGATAQDFPAKDKTITVVVPFSAGGPTD
FT                   RVARDLAEALRKPLGVTVVVDNTAGAGSSIGSARVARAAADGYTLLLNHIAMSTMPALY
FT                   RKLSFNVANDFEYLGLVNEVPMTLIGRPTLTANNFKELSAWIQQNKGQINLGNAGLGAA
FT                   SHLCGLMFQSAVQVEMTSVPYKGTAPAITDLIGGQIDLLCDQTTNTLGQIEAKKVKAYA
FT                   VTTSRRLTIPALKDLPTLAETGLKNFEVSIWHGLYAPKGTPADVQKKLNDALKVALKDP
FT                   DFIKKQEGLSAVVITDRRVEGAEHKKFVLSEIEKWGAVIKAAGTYAD"
FT   sig_peptide     552945..553013
FT                   /locus_tag="Veis_0488"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            553954..554988
FT                   /locus_tag="Veis_0489"
FT   CDS_pept        553954..554988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0489"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_0596 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56274"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF67"
FT                   /protein_id="ABM56274.1"
FT                   /translation="MQAQPWHLFRSSRRRAVIAGALLSACVTGLTSTAQAQAAWPGKPV
FT                   RIVVPFTPGGTTDILARAMAPELSRAFGQPFIVDNRAGAAGNLGSEIVAKSPADGYTLL
FT                   MGTVGTHGINRALYAKLSYDPIHDFAPITLVASVPNVLVMNPDKARSMGVRNVQDFIRV
FT                   LKANPGRLNMASSGSGTSIHLAGELFKSMTGTFMLHLPYRGSGPALVDLMAGNVDVMFD
FT                   NLPSSMAQIKAGKLSALAVTSAERSSALPDVPTVEQAGGPALKGYEASSWFGLLAPVGT
FT                   APEIIQRIQHEVARSLATPALKERLLAQGAIPGGNSPAEFAKHIADEHRKWAQVVKVSG
FT                   AQVD"
FT   sig_peptide     553954..554064
FT                   /locus_tag="Veis_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.546 at
FT                   residue 37"
FT   gene            555073..556323
FT                   /locus_tag="Veis_0490"
FT   CDS_pept        555073..556323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu3302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56275"
FT                   /db_xref="GOA:A1WF68"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF68"
FT                   /protein_id="ABM56275.1"
FT                   /translation="MSTQTNDATDAGQISRLVLRGYKSIAECDLELRRRNVLIGANGAG
FT                   KSNFIGFFRLVHQILNQQLQMAVGLAGGPDALLHFGRKKTQELYAAVYFGDGSYSFTLQ
FT                   PTQDNRMMFASEVLSSGELRADDARTQATAQADLHEDLRWHAAIAVLNHPGSSQEQREA
FT                   ARAFMDQWSSKHGPFETSIEEQKKRIGPHHFDLLYPVMRSWRIYHFHDTSASASIKQIH
FT                   NINDNEYLRDDARNLAAFLLRLKNQHEEHYRRIVKTIRLVAPFFGDFMLRPTVDNRERI
FT                   QLEWTQSGQDEPFTASALSDGTLRFICLSTVLLQPQEHMPATILIDEPELGLHPFAISV
FT                   LGASMKSAACRHQLIVSTQSVELVNEFDAQDLIVVDMRAGASIFKRPDAEALSEWLTEY
FT                   SLGDLWKKNLLGGRPGR"
FT   gene            556320..556970
FT                   /locus_tag="Veis_0491"
FT   CDS_pept        556320..556970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu3301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56276"
FT                   /db_xref="InterPro:IPR025455"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF69"
FT                   /protein_id="ABM56276.1"
FT                   /translation="MIRVYLLVEGQTEETFVNDLLQPHCAEMGLYLTPIIVSTSTGHRG
FT                   GVVRYAKVKSQIERLCKQDARAYVSTLFDLYALPDDFPGKSNRDFPGAANGRCKAEFLE
FT                   AKLAADIGQRNFIAHLQVHEFEALLFTRIEDFTPWVDDASMLAPLRAVRKTTAPEDIND
FT                   SPQTAPSKRILAAMPHYQKTSHGPQIACAIGLHPMRAACPHFDHWLQRIEGLA"
FT   gene            556967..557311
FT                   /pseudo
FT                   /locus_tag="Veis_0492"
FT   gene            complement(557314..558654)
FT                   /locus_tag="Veis_0493"
FT   CDS_pept        complement(557314..558654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0493"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   pol:Bpro_3190 cyclopropane-fatty-acyl-phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56277"
FT                   /db_xref="GOA:A1WF70"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF70"
FT                   /protein_id="ABM56277.1"
FT                   /translation="MKHLLHTLEGRLATLPVPIALQLPAGQQLGAPDPAVTLRFHDRMA
FT                   LVALATGELGNVGAAIVEGRVALEGGMRDLMAAAAGLLTRDPARDWPQRWWQRLLAWTR
FT                   VRALATRTLAHAMARDARQVQFHYDLSDDFYALWLDPRRVYSCAYFRTPDMALAQAQEA
FT                   KLDHICRKLRLRAGERFLDIGAGWGGLLLWAAEHYGVDATGITLSHNQHAHVQRLIQAQ
FT                   GLQGRVRMLLCDYRALPVGQPFDKIASVGMFEHVGRAQMGRYFATLARLLRPGGLLLNH
FT                   GITAGAVDNAGLGAGMGDFIEQYIFPGGELLHVSAVLHHMARAGLEMVDTENLRPHYAR
FT                   TLWAWSDRLEARLPAARQVLAAQSGAGQGDKVLRAYRLYLAGSALGFERGWMALHQILL
FT                   AQPDGNAGTGTMPGAQSDYPFMRDYIYAAQGNALPCSTDSSPALAPT"
FT   gene            558877..559368
FT                   /locus_tag="Veis_0494"
FT   CDS_pept        558877..559368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0494"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: pol:Bpro_0592
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56278"
FT                   /db_xref="GOA:A1WF71"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF71"
FT                   /protein_id="ABM56278.1"
FT                   /translation="MDLEARLHDAAPSAHPEALRLWLRMLTCTQLIEKQVRSQLRTQFD
FT                   TTLPRFDLMAQLERVPDGMKMKDLSRRMMVTNGNITGITDQLVAEGLVERLDVQGDRRA
FT                   WFVRLTPRGRRQFMVMARQHEQWIVQAFAALGEHDIATLHRLLGKVKEHCQNPSPESSE
FT                   "
FT   gene            559365..560219
FT                   /locus_tag="Veis_0495"
FT   CDS_pept        559365..560219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0495"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   pol:Bpro_0591 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56279"
FT                   /db_xref="GOA:A1WF72"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF72"
FT                   /protein_id="ABM56279.1"
FT                   /translation="MKHYIAASNPMRPQFNPQAGYAARHFAWHFDAGVGTITLDRPERK
FT                   NPLTFQSYAELRDFFGALRQATDVKAVVLTGAGGNFCSGGDVHEIIGPLTRMSMPELLE
FT                   FTRMTGELIKALRACPQPVLGAIDGICAGAGAMLALACDLRYGSAATQTAFLFTRVGLA
FT                   GADMGACALLPRMIGQGRASELLFTGRAMTAQEGLAWGFFNQLYDSAELLARVQATARQ
FT                   LAEGPGFAHGMTKTMLGQEWSMGLEQAIEAEAQAQAICMQTEDFRRAYTAFAARQKPVF
FT                   QGD"
FT   gene            560223..561458
FT                   /locus_tag="Veis_0496"
FT   CDS_pept        560223..561458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0496"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   pol:Bpro_0590 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56280"
FT                   /db_xref="GOA:A1WF73"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF73"
FT                   /protein_id="ABM56280.1"
FT                   /translation="MHVATPPAPCPPPTAHLALPFFDAAHRTLALGLLPWAAAQQVDET
FT                   DDRAACRDWVRRLGAGGWLRYCVPAAHGGALPALDSRALVLLRETLAYHSPLADFACAM
FT                   QGLGSGAITLAGNPAQQARYLPGVASGRLIAAFALSEPEAGSDVAAMQTMARSAEETNP
FT                   GDRPDSYSLAGSKTWISNGGLADFYCVFAKTDPTAGTRGISAFIVDADTPGLDATQHLH
FT                   VMAPHPLATLRFADCRLPASALLGPLHGGFKLALRTLDIFRASVAAAALGMARRALAEA
FT                   VQHARQRRMFGQTLADFQLTQARLGEMAALVDSAALLTYRAAWLRDEGEKHQRSVAAEL
FT                   RERSVAAAMAKMTATENAQRVIDMALQLHGGRGVERGSKVEALYRDIRALRIYEGATEV
FT                   QQLIIGKAVLQP"
FT   gene            561466..561837
FT                   /locus_tag="Veis_0497"
FT   CDS_pept        561466..561837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0497"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_02417 2-aminobenzoate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56281"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF74"
FT                   /protein_id="ABM56281.1"
FT                   /translation="MNAPCAQPEHCVHDRLPPQWPARRLANAANPVPTLPGQAAGRAGH
FT                   SDRPLIKALRVPRPGHTGAAAMARALPEHLRTGAAPCHTPRVVPFVSTLPRTETGKLQR
FT                   CAPHPLTHNPDPSKPAATP"
FT   gene            561834..562226
FT                   /locus_tag="Veis_0498"
FT   CDS_pept        561834..562226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0498"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: pol:Bpro_0587
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56282"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF75"
FT                   /protein_id="ABM56282.1"
FT                   /translation="MNILQPPGWVSPKGYANGVAARGTMIFTGGQIGWNAQQQFESDDF
FT                   IAQTRQTLLNVRAVLAAGGAGPEHLVRLTWYVLDRREYNARLTELGLAYREVLGRNFPA
FT                   MACVQVVALMHERAKVEIEATAVVPD"
FT   gene            complement(562278..562838)
FT                   /locus_tag="Veis_0499"
FT   CDS_pept        complement(562278..562838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56283"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF76"
FT                   /protein_id="ABM56283.1"
FT                   /translation="MLKRIRQGTGMAQGDTVGWMRARVLCDDGRTTLRSVRQAGGGGGP
FT                   EEHRDKAVRKGFARGQEGLFHSPAINETWVLPAPIDARRSGDASDRMALGRRRPARRGW
FT                   DVPQGAASARRQRRPGPSCGGQALAPGAFPLHTQAGGVENGKQSTPRAGVGFTQTTVLR
FT                   HLKQERFSRRPRPHRRHAWGGVA"
FT   gene            563147..563803
FT                   /locus_tag="Veis_0500"
FT   CDS_pept        563147..563803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0500"
FT                   /product="Tfp pilus assembly protein FimT-like protein"
FT                   /note="KEGG: noc:Noc_2270 putative type-4 fimbrial pilin
FT                   related signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56284"
FT                   /db_xref="GOA:A1WF77"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF77"
FT                   /protein_id="ABM56284.1"
FT                   /translation="MIHQSPRAGAAHPSMQRLREQLPKSRLRTVARGFTLTELLMTLAL
FT                   AAILGSLAAPAVRDFIVRSKLTNLGNEFISSVLKARSEAVNRNTCVTLCLSSNADADAP
FT                   ACASTTPTTDWHKGWILFLNPICNNDATAPADPINMLLARPAANADYSLLAQNGKTKMI
FT                   FNAHGGLANADLEQFNLIYKSSEDPLTKKFAFNICMNGLGRTRMIPPNKTCTNYH"
FT   gene            563803..564462
FT                   /locus_tag="Veis_0501"
FT   CDS_pept        563803..564462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0501"
FT                   /product="type IV pilus modification protein PilV"
FT                   /note="TIGRFAM: type IV pilus modification protein PilV;
FT                   KEGG: noc:Noc_2271 type IV fimbrial biogenesis protein
FT                   PilV"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56285"
FT                   /db_xref="GOA:A1WF78"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF78"
FT                   /protein_id="ABM56285.1"
FT                   /translation="MAFFMNHSKRKSTAPPSLQCARGVTLVEVMVAIVVLSIGLLGIAG
FT                   LQAATLKYKINTWARSSASTLLSDLSERVRINPDSAGKRFAETGADIASKYVIGDAWAA
FT                   QQLAALDPITPNCETEPCTPLQRATHDLQAWRQRVRNSLPQGAALISGNRKNGLTVTMM
FT                   WFDNELVEPATDGGPQALVATPVCSGSETGMAQQTCCPPEAAAPAGVRCARFSFIP"
FT   gene            564468..565529
FT                   /locus_tag="Veis_0502"
FT   CDS_pept        564468..565529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0502"
FT                   /product="Tfp pilus assembly protein PilW-like protein"
FT                   /note="KEGG: reh:H16_A2837 type IV pilus assembly protein
FT                   PilW"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56286"
FT                   /db_xref="GOA:A1WF79"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF79"
FT                   /protein_id="ABM56286.1"
FT                   /translation="MFKSIRAQQGLSLVELLVAMTISLVVMIAAAYVYLSARESQRAID
FT                   RTGSSRETGAFVMQMLGHEIRNAGFYPATVAPIFSDPAQQGMYDTYPPLPSDPRVATDW
FT                   QNPAEGWPPAAFQAGIFGCDGGEFNVTTSTCPTVDADAADTLVINYFTSDTKTMGSNAG
FT                   QRWDCTGHDVAPGEAGAGGDPSNDVRKKNSNGSPPTQTNEAIPPQLPVFVSNRFTLRDV
FT                   RVADQFQEIGTKSLVCSGNGKSPHGATDETAYQSIIAGLEDLQFAYGIHNGTSMQFHTA
FT                   TQIDGNAPLLWRNVTVVRVCLLTRTLGGNTRLPGAPSTYRDCNGAEKDHPAGDTITRHV
FT                   EEFGLRNNMKQYY"
FT   sig_peptide     564468..564563
FT                   /locus_tag="Veis_0502"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.606) with cleavage site probability 0.424 at
FT                   residue 32"
FT   gene            565540..566313
FT                   /locus_tag="Veis_0503"
FT   CDS_pept        565540..566313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0503"
FT                   /product="Tfp pilus assembly protein PilX-like protein"
FT                   /note="KEGG: rfr:Rfer_2662 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56287"
FT                   /db_xref="GOA:A1WF80"
FT                   /db_xref="InterPro:IPR025205"
FT                   /db_xref="InterPro:IPR025746"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF80"
FT                   /protein_id="ABM56287.1"
FT                   /translation="MRYLMKPVPNAHGAAKAQERGVALVVVMLFLIAITGIGVWTARQS
FT                   MLAENMARNQMDHEVARQAAESALRDAERDIDSASMGVLQEGASCRRNASAGMTYGLNP
FT                   IEFTADCAQGLCDTNDTSYASSNWDTASSSSSSSSSSSNVEPWWPKNKGGQWNDDETSK
FT                   PGRNPVNDNNCLTFKGAVPLGTYTGVPPIRGVEKQPEYLIEVFMRKNIRMNLEETSVTS
FT                   TAENANQWARMYRITARGFGYSRRTQVVLQTVFFP"
FT   gene            566310..571340
FT                   /locus_tag="Veis_0504"
FT   CDS_pept        566310..571340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0504"
FT                   /product="Tfp pilus assembly protein tip-associated adhesin
FT                   PilY1-like protein"
FT                   /note="KEGG: noc:Noc_2274 fimbrial assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56288"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF81"
FT                   /protein_id="ABM56288.1"
FT                   /translation="MMNKTMTIHHMYQRTMKTSDNIKSSLLLAIMFSSMNLSAAPVHAD
FT                   VEVSKPVIAIPPNIVAIAKKPMVMLTASKDHLLFGPVYTDFEDLDDDGVIDTTFKPTFE
FT                   YYGYFDARKCYAYDNDAGQFNPAAMAIQTSVTVGSATATKYSCSPRESHWSGNFLNWTT
FT                   MTRLDIVRKMLYGGYRVLDINGSTVLMGAKLVEDSHSFVKYYNGTDVRDYTPFDQAMLT
FT                   RPATDDSANAGYYAGLSICLTGNADDYEMSQPVMRLVKGNVRFWSTVNWEACRWIEEDR
FT                   EGAGTFGPKLSRAYSSANAGDGKIGDRPVHHEASLPSMARSGATYSGIGPQLNVRVKVC
FT                   DPARLGAERCQAFPPHSVTNFKPYGLLQEFGHPKTAGDAARAEFGLITGSYDNYNEDGH
FT                   IRGAAGALRKNMGDLEDEINRTTGVFCHNSGSGCPATLPDGRATGVGAIKTFDTMSLYG
FT                   RRTRGYQSNTAWLNPLGEMLAQTLQYYAYNGTTPVPSNPAVTAADSSAGMPVATWRDPF
FT                   IDSSARRARYGNAVCRPLNALAISSSTLSYDGQAASPFSSLPNSNAGLDFFVNKIGQAE
FT                   GIHGTARSVGSVPGNDEKSCSAKTVQQLSDVRGICPEAPALEGSYQIAGVALYGNTKPI
FT                   RDLGSHRPADLDRVENALKVKTMAVSLSGGAPRIDVPVPAPPVADSTANPSDPPSLLNP
FT                   RRYITITPESVHSGGKPNAPLVFASISSSPTHGAFLVAWNDQFLAADYDMDVVGFLRYD
FT                   LIRNVNSPSGWDIRVRTDISNLCSSLGGTYGFSIIGVQKRDAANNLVNADGRYLTHQYG
FT                   NAEGEEFEGQIYWDDYTEAWGQLRDMPPTSQYLCGDASYRRKTLLTDASVDYAHSVCYV
FT                   ADNYCEARNMDYFHDETFHVAGEANALIKEPLWYVGKYGSFKSSVENTDGTYSTLLMPP
FT                   TQNNHSWDSVRTDGSVGQDGVPDGYFLARRPELLEAQLRTALHAAAKSLNSAPAIASAQ
FT                   LTGGSRKFVARFSETTVSGELEAYEVDAEGEFQATPVWQAGAMLKERTRLSSGNDRAII
FT                   TNDGNGRAAGVGFRWADLPEDYRKKMTEQGTNQLSEANAQLALNYIRGDHSREDPNGLR
FT                   QRADSLLGPVVNATPWIQGPPGPVLAGFRSADERIGYSAFFSAHKDRAKLIWLAANDGM
FT                   LHAFNPDTGAEVFAYVPGALANRLAEIPLQRGAATRTKLEGSNFVTGPERHPPGGTVWA
FT                   YVDGHPFSADVMVGDDWKTYVFGTLGRGGKGIFALDATVVADLTESNAASVFKWQFTST
FT                   DDEDLGHITGEVSVHAASNQATPVVRMNNGKYALLLGNGYKSMPSTAPGKAVLYVLFVD
FT                   GPNDEGSWTGRYTKIVADAGPGNGLSMPRWEDIDGNGTADVAYAGDLKGNLWKFDLQSD
FT                   RPNEWQVALKEGTVNKPLYTASDAITTAPQIMYMGKGGFMVNFATGNAFETHDFPKLGV
FT                   PQRIYGIWDRPSFVGTRPIRTDTLALRAYTRNQDGKVIGAADAPALDWSRHNGWYMDLP
FT                   NPGEAVLSNPTLESGVLSFVTVRPKAADTGSTASCFSSPLAALYTVDPISGKTERNLQG
FT                   SITLNDTQVFVTAREIGDQKVRLAHDRTQKAFTKNCQAGQAGCTCTGSTCTKAAICGPG
FT                   QRAKRVIGSSADAVLCMSNPAPRLQWREVSGLGRTDQP"
FT   sig_peptide     566310..566444
FT                   /locus_tag="Veis_0504"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.670 at
FT                   residue 45"
FT   gene            571337..571816
FT                   /locus_tag="Veis_0505"
FT   CDS_pept        571337..571816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0505"
FT                   /product="fimbrial protein pilin"
FT                   /note="KEGG: net:Neut_1832 fimbrial protein pilin"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56289"
FT                   /db_xref="GOA:A1WF82"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF82"
FT                   /protein_id="ABM56289.1"
FT                   /translation="MKHQHVQGGFTLIELMIIVAIVGLLSALAYPSFREQVIKSRRADA
FT                   KTILVSAQQWMERFYTENFRYDKNRAGVRADDPTQFPARFSVSPTEGSALYDIAVVVED
FT                   GELDKYSVTATPRAGSAMARDRCGNFRIDHSGQKTVFSHGFGSANDAMANRVCWQ"
FT   gene            571881..572399
FT                   /locus_tag="Veis_0506"
FT   CDS_pept        571881..572399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56290"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF83"
FT                   /protein_id="ABM56290.1"
FT                   /translation="MRGLFEQAYGKPDAATDVAPDACEAVADTSITLADLRRVDQWRLV
FT                   SCHRSNVVGCAQPSERSARRIAQPIPSVLASDATPRCASMASADRQMIGDATLEYIRLG
FT                   DDDHGDFLPVWGNACMMLSHPFGGHHPPSLHARPIANCYNQHSCWQQPTATKATTFQEA
FT                   SSAHVHAQG"
FT   gene            572401..574197
FT                   /locus_tag="Veis_0507"
FT   CDS_pept        572401..574197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0507"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rfr:Rfer_3461 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56291"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF84"
FT                   /protein_id="ABM56291.1"
FT                   /translation="MRVAPGTVGLSDLVDDDRLVRRGHATPGMIRLSEIRLPFTLAEAP
FT                   EAALRAAVCELLNLAPADIARVDVFKRSFDARKALPLAVYIVDVTLAEPERATALLARW
FT                   AGHPQIQPRPDMTWRPVGQAPADLPLRPVVVGFGPCGIFAALVLAQMGFKPIVLERGKP
FT                   VRERARDTWDLWRKRVLHAQSNVQFGEGGAGAFSDGKLYSQIKDPRHLGRKVLHELVKA
FT                   GAPPEILYLAHPHIGTFKLVRVVENLRAQIIALGGEVRFGQCVTDINVVRQGAVGRQLR
FT                   GLSVLDLATGQTTGLRADHVVLAPGHSARDTFVSLYERGVAMQAKPFAIGLRIEHPQGL
FT                   IDRARWGRHAGHPLLGAADYKLVHHAANGRAVYSFCMCPGGTVLAATSEPGCVVTNGMS
FT                   QYSRNERNANAGLVVGITPSDYPRDDAAFEAQLGRSYGVQALHPGYCHPLAGMVLQRQL
FT                   ESHAFVLGGRDYSAPGQLVGDFMAGKPSTQWGTVAPSYRPGVTLGDLHAALPGYAIAAL
FT                   REALPVFGRKIKGFDMHDAVLTGVETRSSSPLVISRNGQLQSLGTAGLYPAGEGAGYAG
FT                   GILSAGVDGIEVGEAVARSLMK"
FT   gene            574426..575913
FT                   /locus_tag="Veis_0508"
FT   CDS_pept        574426..575913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0508"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   xom:XOO_1836 ISXoo5 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56292"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A1WE41"
FT                   /protein_id="ABM56292.1"
FT                   /translation="MPEPTDTADFFRSRLAEMIDLRHPLAVLASRLPWTQIEAALAPYF
FT                   ARRVRAGRVLEHDDLFGPSLQVAGAGVAAAGRPRLPLRLMASLLYLKHVYKLSDEELVE
FT                   RWAENVQWQFFSGMTFYEPRLPCDATQIGRFRSILGEAGVEELLKATIDTAVASKAIKP
FT                   AEFERVIVDTTVQEKAIAHPVDSRLLEIARAKVVAAAKRAGIALKQTFAKEGKNLRRRA
FT                   GGYAHAKQFKRLKKVLKRQRTVLGIVLREVQRKLCKLPATSVPAVDRLRALMGRAERIR
FT                   TQRPKDKNKLYALHAPEVECIGKGKARRPYEFGVKVSVAVTHKQGLVVGARSFTGNPYD
FT                   GHTLAEQLEQVKILTEDTGASPKQAVVDLGFRGVDAANPGIQIIHRGRFKSLTDAQRRW
FT                   LKRRQAVEPTIGHLKHDNGMDRCWLQGATGDALHAVLCAAGYNIRWLLRAIMRLGLKGL
FT                   LLRLIALLRTLIGVPHFFASNEITPSRAAARFAAIAK"
FT   gene            complement(576023..576613)
FT                   /locus_tag="Veis_0509"
FT   CDS_pept        complement(576023..576613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0509"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="KEGG: rfr:Rfer_1459 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: RecR protein;
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56293"
FT                   /db_xref="GOA:A1WF86"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WF86"
FT                   /protein_id="ABM56293.1"
FT                   /translation="MSSSNALDALIQALRRLPGVGVKSAQRMAFHLLQHDRAGGQALAQ
FT                   ALHDALGSVQHCARCHTFTEAETCRTCLDPGRDATRLCVVETPADQAALERTGAFKGLY
FT                   FVLMGRLSPLDGVGPKEIGLQKLIARATEGGVQEVILATNFHAEGEATAHVISQALKRQ
FT                   GLHVTRLARGVPVGSELEYVDLGTIAHALVDRR"
FT   gene            complement(576631..576963)
FT                   /locus_tag="Veis_0510"
FT   CDS_pept        complement(576631..576963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0510"
FT                   /product="conserved hypothetical protein 103"
FT                   /note="PFAM: conserved hypothetical protein 103; KEGG:
FT                   rfr:Rfer_1458 conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56294"
FT                   /db_xref="GOA:A1WF87"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF87"
FT                   /protein_id="ABM56294.1"
FT                   /translation="MFNKGQLAGLMKQAQAMQDNLKKAQDELALIEVEGESGAGLVKVL
FT                   MTCKHDVKRIRIDPSLLAEDKDMLEDLVAAAFNAAVRKAEETSEQKMGKLTAGMPGLPG
FT                   GMKFPF"
FT   gene            complement(576989..578833)
FT                   /locus_tag="Veis_0511"
FT   CDS_pept        complement(576989..578833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0511"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rfr:Rfer_1457 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase, central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56295"
FT                   /db_xref="GOA:A1WF88"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF88"
FT                   /protein_id="ABM56295.1"
FT                   /translation="MSYLVLARKYRPRNFAEMVGQEHVVQALSNALTRQRLHHAYLFTG
FT                   TRGVGKTTVARILAKSLNCQGPDGQGGITATPCGICPACSDIDSGRFVDYTELDAASNR
FT                   GVDEVQSLLEQAVYKPVQGRFKVFMIDEVHMLTNTAFNAMLKTLEEPPEYLKFVLATTD
FT                   PQKVPVTVLSRCLQFNLRPMAPQTVHAHLVQVLAAEQVAAEPQALQLLARAARGSMRDA
FT                   LSLTDQAIAFGSGQLQEAAVRQMLGAVDRSYVFRLIDALAQGDGRAVVETAQELRLNGL
FT                   SAASTLEEMAAVLQRMAVLQAVPQQADAVDAQDPEAAETARLAAAMPADETHLLYSLCL
FT                   HGRGELGLAPDEYAALTMVLLRLLAFKPGGAPSEKKSLHQPEAAPSGAVPVSVPVPAPT
FT                   PAPAPAAAAAAASTPADPVAPAQTIAPALLDPAGAEKSGAAAVQSAPLQNAPEFVAIPV
FT                   RVTPEPGARLQPTPHCASMPAPVSERCTPTEEGDIWHATVQELLAAEAITALARELALQ
FT                   SQLLARDDGHWLLRVDSESLNQPTARERLRAALQAAGHASQIRVELGVVCDSPARRNAA
FT                   ATAERQRRAQAIVANDPYVQSLMREHGAKIVPGSVKPA"
FT   gene            578922..579022
FT                   /gene="ffs"
FT                   /locus_tag="Veis_R0002"
FT   misc_RNA        578922..579022
FT                   /gene="ffs"
FT                   /locus_tag="Veis_R0002"
FT                   /product="SRP RNA"
FT                   /note="RNA component of signal recognition particle"
FT   gene            579021..579947
FT                   /locus_tag="Veis_0512"
FT   CDS_pept        579021..579947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0512"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding; KEGG: rfr:Rfer_3829 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56296"
FT                   /db_xref="GOA:A1WF89"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF89"
FT                   /protein_id="ABM56296.1"
FT                   /translation="MKITFCCTGTQAGPWLQGLAAALPQADISLWQPGAPQADHAVVWK
FT                   PPQQFIDEQPRLRTLFNLGAGVDALLRLRLPPAALVVRLDDAGMAVQMAEYVCHAVIGH
FT                   LREFDAYAGQMRAGRWDDLRPPRRRADLPVGVMGLGVLGQRVAGALAQFEFPVNGWSRS
FT                   RKTAMDGVRTFSGADGFDAFLAASRVLVNLLPLTPDTVDIMNRTTLSRLQPGAYVINVA
FT                   RGAHLVDEDLLALIDSGHIAGATLDVFRSEPLPADHAFWRHPRITVTPHISARTLRQES
FT                   IAQIAHKITTLEQGGAVAGVVDPARGY"
FT   gene            complement(580092..581000)
FT                   /locus_tag="Veis_0513"
FT   CDS_pept        complement(580092..581000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0513"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   reu:Reut_B3957 protein of unknown function DUF849,
FT                   prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56297"
FT                   /db_xref="GOA:A1WF90"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF90"
FT                   /protein_id="ABM56297.1"
FT                   /translation="MTAPKPDAARHERQAPLAGERQPTATPASTSAWSGNPLIVTVAPN
FT                   GAYKQPRDHAALPITADALAATARACLDAGAAMLHMHIRDAQGRHSLDLQGYRAAIHRV
FT                   RQAVGQALVLQITSEAAGIYRAAAQIALVEALRPEAVSVGLREFDQPEIGEAGLQRFFT
FT                   GLARQRTLTQIILYDLADLRRWQDLRARAVVPQAPWSLLFVLGRYSAGQTSSPRDLLPF
FT                   VTAHEGPEPWAVCAFGATENSCIAAAAALGGHARVGFENNLLCKDGSIAPDNAALVRQA
FT                   VQVAQALGRPLATADDIRQWR"
FT   gene            581184..582095
FT                   /locus_tag="Veis_0514"
FT   CDS_pept        581184..582095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0514"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   rfr:Rfer_3824 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56298"
FT                   /db_xref="GOA:A1WF91"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027167"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF91"
FT                   /protein_id="ABM56298.1"
FT                   /translation="MSLPAKVKIVDVGPRDGLQNEPAPVPAEIKIGLVQRLQDAGLKNI
FT                   EVTSYVSPQWVPQMADNHQVMAGIARQQGVVYSVLTPNLKGFAAALPDRPDEIVVFGSA
FT                   SEAFSQKNINCSIAQSIERFAPVVQAARAAGIAVRGAMSCAVGCPYEGDVAPERVAYLA
FT                   GLMKQIGVQHVGVADTIGVGTPRKVRRAVQAALQHYGIDAVSCHFHDTYGQALANTLAT
FT                   LEMGLWQYDSAVAGLGGCPYARGATGNVATEDMVYMLHGMDIETGIDLDKLVDAGAYIS
FT                   RFLGRKPHSRAASALLARRADG"
FT   gene            582134..582685
FT                   /locus_tag="Veis_0515"
FT   CDS_pept        582134..582685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0515"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: rfr:Rfer_3823 YbaK/prolyl-tRNA synthetase associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56299"
FT                   /db_xref="GOA:A1WF92"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF92"
FT                   /protein_id="ABM56299.1"
FT                   /translation="MTAISGASGMCATPLKDLPEAVQRVAAALQAQGHAHMPQMLDAAA
FT                   RTAQQAADALGIRVGQVAKSIIFRRQSDDAAVLVVTSGDRRVDEKKVAAQVGKIGRADA
FT                   DFVKARTGFSIGGVAPLAHATPPVTLIDQDLLRFDVVWAAAGHPHSVFALHPGDLQRLT
FT                   GAPVVDVVQEPADMAAKSAP"
FT   gene            582682..583290
FT                   /locus_tag="Veis_0516"
FT   CDS_pept        582682..583290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0516"
FT                   /product="protein of unknown function DUF1289"
FT                   /note="PFAM: protein of unknown function DUF1289; KEGG:
FT                   rfr:Rfer_3823 YbaK/prolyl-tRNA synthetase associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56300"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF93"
FT                   /protein_id="ABM56300.1"
FT                   /translation="MSAARPPEGAHTVAEGAGIPSIAARPPEGAHTAAEGAGIPSIAVR
FT                   PPEGARTVAEGAGTPVNAIDLLAERANKTCADGHFDGAHGAAVPSPCIAVCRMSPERGH
FT                   CEGCFRTLDEIRLWSSADGPLRRRIWQQLLGRAGIALPALVSRHGSDVVGCAQPSERSA
FT                   RRIVRPIPSVLASDATPRCASMASADRQMIGDATLETPP"
FT   gene            583287..583943
FT                   /locus_tag="Veis_0517"
FT   CDS_pept        583287..583943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0517"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: rfr:Rfer_3816 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56301"
FT                   /db_xref="GOA:A1WF94"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF94"
FT                   /protein_id="ABM56301.1"
FT                   /translation="MKQIRFYLDFVSPYAWLAFERLPEVLAGLSHSVAYQPVLLGALLQ
FT                   QHHNPGPAGIAPKRDWTYRHVGWLGHAQGTPLQLPARHPFNPLPLLRLALACSDDGHIN
FT                   RFVAGAVLRHVWQGGQDALDAGRLAALGTELAGQLRPGQDNHGAAPKALLRANTEAAQA
FT                   AGVFGVPTFEVDGKLFWGLDSLPMLRAYLDGDAWFDAGAWDAVRQIPSGLTPDKG"
FT   gene            584143..585804
FT                   /locus_tag="Veis_0518"
FT   CDS_pept        584143..585804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0518"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: pol:Bpro_4142 general
FT                   substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56302"
FT                   /db_xref="GOA:A1WF95"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF95"
FT                   /protein_id="ABM56302.1"
FT                   /translation="MATAHPAPRPMTPEEKKVIFASSLGTVFEWYDFYLYGALASIIAK
FT                   QFFSGLDAGSAFIFALLAFAAGFIVRPFGAIFFGRLGDMIGRKYTFLITILIMGLSTFL
FT                   VGILPSYATVGVAAPVILIALRLLQGLALGGEYGGAATYVAEHSPHGKRGAYTSWIQTT
FT                   ATLGLFLSLAVILGVRTTLGEEAFASWGWRLPFLLSIVLLGISVWIRLSMSESPAFQKM
FT                   KAEGKTSKAPLTESFARWKNLKIVILALLGLTAGQAAVWYSGQFYALLFLTETLKVDGA
FT                   TANILVAVALMIGTPFFVVFGTLSDRIGRKPIILTGCLLAALTYFPVFGALTKAANPAL
FT                   AEAQAKNQVLVMADASECSFQFNPTGQVKFTSSCDIAKQVLARASVSYENVPAAAGTPA
FT                   TIKIGETAITSYSSKGLPADEAKKKDAEFKQAVGDALKAAGYPAKADPERIDKVMIIAI
FT                   ITYLVLLVTMVYGPIAAILVEMFPTRIRYTSMSLPYHIGNGWFGGLLPTSAFAIVAQTG
FT                   NMYNGLWFPVVIAGATVVIGGLFIKDTKDVDIYAND"
FT   gene            complement(585821..586783)
FT                   /locus_tag="Veis_0519"
FT   CDS_pept        complement(585821..586783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0519"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bch:Bcen2424_3472
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56303"
FT                   /db_xref="GOA:A1WF96"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF96"
FT                   /protein_id="ABM56303.1"
FT                   /translation="MSVTSMTVGIDVAKAHIDVCVLEPKSGAQRFTNDAEGHSALAALL
FT                   QPLDVGLVVMEATGGYEVALACALQAAGLPVAVLNPRQARDFAKSMGRLAKTDAVDARM
FT                   LAELAAVLLRREDLSRFLRPLTDECQQWLAALVTRRRQLLTMLHSERQRLQITPAKLHP
FT                   SIEAIVAAIKAQLNELETQMVGHVREHFGDLDRLLQSAAGVGPVASATMIAELPELGRL
FT                   NRREIAALVGVAPMANDSGSSKGRRRVQGGRFEVRRVLYMATLTATRYNPAIKAFYERL
FT                   KAAGKLPKVALVACMRKLLTTLNAMVRTGKPWDKSLHGT"
FT   gene            587254..587703
FT                   /locus_tag="Veis_0520"
FT   CDS_pept        587254..587703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0520"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: rfr:Rfer_0732
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56304"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF97"
FT                   /protein_id="ABM56304.1"
FT                   /translation="MECTVSWTGGAGTRSGMGFVAETGSGHVLAMDGAPDAAHPAHGGQ
FT                   NLAPRPMETVLAGTGGCTAYDVVLILQRGRHDVRGCSVKLTTERAATDPKVFTRIHMHF
FT                   TVTGKGLAPAAVERAIALSHDKYCSASIMLGKTAEITTSYEVREL"
FT   gene            588066..588392
FT                   /locus_tag="Veis_0521"
FT   CDS_pept        588066..588392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56305"
FT                   /db_xref="InterPro:IPR021969"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF98"
FT                   /protein_id="ABM56305.1"
FT                   /translation="MLSPLSKEIFIQGITRDGKIFRPGDWAERLAGVMSRFRPGGAKPG
FT                   SHLSYSPWCLPTQRHGIKCVVVHRDLRDHEPMAWDFVINFARDNDLQMLPTGQLPDEPA
FT                   PARR"
FT   gene            588623..589597
FT                   /locus_tag="Veis_0522"
FT   CDS_pept        588623..589597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0522"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   reu:Reut_B3884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56306"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A1WF99"
FT                   /protein_id="ABM56306.1"
FT                   /translation="MIRRTFASGLLCSACAALACAASAQDGFPDRPMRIIVPFAVGGNT
FT                   DVLARLFSQKLGALLKTSITVENKTGSGSVLGTDAVAKAPADGYTLLLGTSSHAINAAL
FT                   YPKLPYDSRKDFAFISMIAQVPMVLSVHPRVPATNPKELIALLRANPGKYSFASSGNGG
FT                   SLHMAVELLKFQEQFDALHIPYRGAGPALTDTVAGQVDFIIDPVTTSAPFVKSGKLRAL
FT                   AVTTAQRSPVLPDLPTMQEAGFPNYETSTWNLLMAPAGTPAPVITRLSAALHSIAQDAD
FT                   FTRRLVDMGVIPLHMTPSETRRHVERETGQWARVIQSAGIRPE"
FT   sig_peptide     588623..588697
FT                   /locus_tag="Veis_0522"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.894 at
FT                   residue 25"
FT   gene            589613..590059
FT                   /locus_tag="Veis_0523"
FT   CDS_pept        589613..590059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0523"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu2710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56307"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFA0"
FT                   /protein_id="ABM56307.1"
FT                   /translation="MPPGTGMGGSTAAAGAGSAPDNEGVNNATHGTGLRIGQPALEGFC
FT                   PVLEAVDKLARDSASDERGAIYTRREVVGFMLDLAGYGPGRPLHRLRLLEPSFGAGEFL
FT                   REVPEAMRARLAKAAKALDLAECNAAACALYGLSPKEADMLAGE"
FT   gene            590086..590466
FT                   /locus_tag="Veis_0524"
FT   CDS_pept        590086..590466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0524"
FT                   /product="Type II site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.4"
FT                   /note="KEGG: plu:plu2709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56308"
FT                   /db_xref="GOA:A1WFA1"
FT                   /db_xref="InterPro:IPR007636"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFA1"
FT                   /protein_id="ABM56308.1"
FT                   /translation="MPLNLCDYENKTSDAIKAFWQTRDDARSKQKESGKADQGERAAVT
FT                   GGKNMHGVSRLVVDLVKANGLPNAQVHQQRAVLTLPGYFRPTKLWDLLVIDNGRLIAAV
FT                   EFKSHVGPSFGNDFNNRTGSPG"
FT   gene            complement(590580..591650)
FT                   /locus_tag="Veis_0525"
FT   CDS_pept        complement(590580..591650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0525"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sme:SMb20674
FT                   putative transcriptional regulator, LacI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56309"
FT                   /db_xref="GOA:A1WFA2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFA2"
FT                   /protein_id="ABM56309.1"
FT                   /translation="MKRLGSQPDPDRRAPTMVDVAKLAEVSLATVSAVINDSAPVSADR
FT                   KKRVLDAIRRVGYQTNAIARSLKTGSTKTIGLMIADITNPFFTAVIHSIQEVAYHHGYG
FT                   VMLCCSDEDPEKERLHLRLMSDRMVDALIIATAGETPPLRALIDSRRKPVVLIDRLLDG
FT                   VATDAVVIDNVAAARDAVRYLVSLGHRRIGLITGKSTLSTARERYQGYCQALAEAGIAI
FT                   ENALVGAARFGSADGYGAAMGLLSLAERPTAIFASNNLSGIGLMRGIKDSGLRCPADIS
FT                   VACFDDFEWADVFEPRLTTLVQPTRAIGAQAMAIVLEHLQDGGAQRSAARVVRMRAQLR
FT                   IRDSCVMWPPPPGLST"
FT   gene            591859..592965
FT                   /locus_tag="Veis_0526"
FT   CDS_pept        591859..592965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_0831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56310"
FT                   /db_xref="InterPro:IPR021345"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFA3"
FT                   /protein_id="ABM56310.1"
FT                   /translation="MNGFNGLGMHLGTLARLSDAKTRSISPENFSGEAGGGARATEGTG
FT                   AAAARSLGQGWKVSPSIDVAPGATVALADIAGQGAIQHIWATVRNARWRLLILRMYWDD
FT                   QEFASVECPIGDFFANGWESYAPVNSAAVCVNPGRAFNCYWEMPFRRRARITLTNLDEV
FT                   STRIYYQIDYTLTAVPDDVAYFHASFRRSNPLPYKSDHVVIDGICGQGQYVGTYMAWGT
FT                   HNNGWWGEGEIKMFLDGDRAFPTICGTGTEDYFCGAYNFDPGWCDAQTPNGYREFCTAY
FT                   AGLCQVIRPDGVYQSQQRFGMYRWHIMDPVRFQSQLRVTIQALGWRPDAERRYLPLQDD
FT                   IASVAFWYQTLPGARLKELPERDFLEVL"
FT   gene            592993..593982
FT                   /locus_tag="Veis_0527"
FT   CDS_pept        592993..593982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0527"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tma:TM0072 putative
FT                   oligopeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56311"
FT                   /db_xref="GOA:A1WFA4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFA4"
FT                   /protein_id="ABM56311.1"
FT                   /translation="MKFLISRLTSYLAVILFGITAIFFIPRLLPVNPVEAMLGRILSQG
FT                   AYMQQEQVSALREVLSDAFGLNGSLASQYAGFLRRVLLTQDFGPSLAMYPTPVKELIAQ
FT                   ALPWTFGLLLSSVLIAWVVGNALGLITGALPTRKLSRVLEGVALVFYPIPYFVLALVLS
FT                   ILFSFVWTVFPLTTTIRGVGWSWGFIGSVIYHSLLPAASIVAVTFGWWMLSMRALTETL
FT                   MDEEFVIYARLKGLSNRRIILRYILPNTLLPQITFLALQLGLMFSGAIVTEIVFNYPGV
FT                   GSLIHTAVLQGDYSLLTGAVSLSIVAVATLTLLVDLSCPLIDPRIRQR"
FT   gene            593987..594808
FT                   /locus_tag="Veis_0528"
FT   CDS_pept        593987..594808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0528"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tma:TM0073 putative
FT                   oligopeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56312"
FT                   /db_xref="GOA:A1WFA5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFA5"
FT                   /protein_id="ABM56312.1"
FT                   /translation="MRIKFWLGSAIVGLTVLLGPVAAMFAPQDPRTWQTYPRNLGPSLD
FT                   HFLGTTALGQDIFWLLSWSVRNSLLLGVTVGALATIIGVAAGLVAGYRGGLSDRVLSFL
FT                   MDGLIVIPSLPLLILLSALSKGQASMAVLGGMLVLFNWPFPARQVRSVALSLRERDFVS
FT                   LAWFSGESLLRIVRWQLFPYLRNWAVANFINTILVVIAVESSLAFLGLSNDAIPTLGTM
FT                   IYWALKYQALFAGRWYWIVPPILAVILIFVGLFLFSNSLTDRLRKHPGAAL"
FT   sig_peptide     593987..594058
FT                   /locus_tag="Veis_0528"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.882 at
FT                   residue 24"
FT   gene            594805..595761
FT                   /locus_tag="Veis_0529"
FT   CDS_pept        594805..595761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0529"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: tma:TM0303 putative oligopeptide transport
FT                   system ATP-binding protein; TIGRFAM: oligopeptide/dipeptide
FT                   ABC transporter, ATPase subunit; PFAM: ABC transporter
FT                   related; Oligopeptide/dipeptide ABC transporter, C-terminal
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56313"
FT                   /db_xref="GOA:A1WFA6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFA6"
FT                   /protein_id="ABM56313.1"
FT                   /translation="MISVDNVVAGYRTPGGLLRAVDGVSLQVRDGEILGIAGESGCGKS
FT                   TLLKLLYGSFSDGLEIFSGSITWRDREGTRTLDVKDFHRHWWSLFSYVPQGSMSAMNML
FT                   MKIGAQMIDAGSAHGVIDRTARAARIRSTLAELDLPEEVLGLYPHQLSGGMRQRVLIGL
FT                   ATYVDPEVILADEPTTALDVVVQRQILENLVRLQRARQNSIVIVSHDLGLHYQVADQVA
FT                   ILYAGRLVELGSAQNVLRNPQHPYTRGLVGALPRLGDQLPRQGIDGRPPSLLDLPGGCR
FT                   FLPRCAKALASCAQAQPALSPVGPGWLAACHRLGECR"
FT   gene            595761..596585
FT                   /locus_tag="Veis_0530"
FT   CDS_pept        595761..596585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0530"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rle:RL4413 putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56314"
FT                   /db_xref="GOA:A1WFA7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFA7"
FT                   /protein_id="ABM56314.1"
FT                   /translation="MGSAPPILAIDGLQKTYGRGGLFGQNAGRRALDGVSMVLDGGGGQ
FT                   ILAVVGESGSGKTTLARIILRLVKADAGTVRIAGEPVVGRPDGTVDDQRLRQLVQPIFQ
FT                   NPFETFSLHLPVDQYLIRTAINLGDAATARNPEPAISAALSAVGLRREQLLGKGIRSFS
FT                   GGELQRISIARALIAKPRLIVADEPVSMVDASLRMTIVNLFRQLSRERGVAFVYITHDL
FT                   STACYLSDRMAIMRHGQVVEFGRPEAILAAPDSAYTKALMAAIPTLDRRWID"
FT   gene            596619..598499
FT                   /locus_tag="Veis_0531"
FT   CDS_pept        596619..598499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0531"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: tma:TM0071 putative oligopeptide transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56315"
FT                   /db_xref="GOA:A1WFA8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFA8"
FT                   /protein_id="ABM56315.1"
FT                   /translation="MKRLIHASIALCIACAANTPALAENMTDVGTPRKETLVVDILTGR
FT                   VGNPKRMNPYLEGNSLVQGLHQLGYSNLWEIDTVKGVQYPALAATMPEAIDGKNTRWRF
FT                   KVRKGLAWSDGVPFSAADVAYTAQMIIGNPKLPYNRFLEKNIKSIQAIDAETVELETLS
FT                   AMPKIAYMFGSVIFGNGFRVLPKHVWEKVDPATFANFPPVTIGPYKLKEVDDNGFWFLW
FT                   EKRADWQKTDAGQIVGEPKPKYVLFRSYGTEEKRIMAMARNDIDVLTDITPEGLDILRQ
FT                   RNAKVKSWYDAFPWAALDDPCERGISFNTSSAPYDQWQVRWALALATRIDNVSIATFSG
FT                   MMRASPLHAPPISILMKTYHEPMLPWLKGFALPDGYKPFDSEFAIRMGKRLAAEKIPGL
FT                   PTGDAELRKLFGVGWWKFDPAKAAALLQSVGFRKADAGWLLPDGKPWKMTINAPADFEI
FT                   QSQRLAFAVANEWKKFGIDVNVQQQQGGVFTTEYASGNFQAGAYWNQTCAIGPDLWVRL
FT                   EWWHEKYVSPNGQPAAFNRERYTNPSLSHTIDQMAILQPTDPKNVELGTALLKELVAGM
FT                   PVIPMFGTSKFVPVNTTYWSNFPSASNYYEGPWWWWSNFKYIVARLRPAP"
FT   sig_peptide     596619..596690
FT                   /locus_tag="Veis_0531"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            598602..599525
FT                   /locus_tag="Veis_0532"
FT   CDS_pept        598602..599525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56316"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFA9"
FT                   /protein_id="ABM56316.1"
FT                   /translation="MRPKAGRARAVPAVPDMLAGPLPLRPGQSVELLKELHILTPEGRL
FT                   NQDSRRKLKQVHHLIQFIEPLLAELAAEGAGLTLADHGAGKSYLGFILYDLCFKALGQG
FT                   HIYGVETRAELVQKSRLLAQKLGFGRMSFLDLSVADATVADGLPAHIDVVTALHACDTA
FT                   TDDAIAFGLHKNARAMVLVPCCQAEMAACLRRDKALQLARTALAELWRHPLHAREFGGH
FT                   VTNVLRCLYLQASGYQVTVTELVGWEDSLKNELIIARHTGQKKHGAAQRLRAILSALGL
FT                   EEALGARFGLDASGTRQALAAQGAAH"
FT   gene            599567..602089
FT                   /locus_tag="Veis_0533"
FT   CDS_pept        599567..602089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0533"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rfr:Rfer_3255 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56317"
FT                   /db_xref="GOA:A1WFB0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFB0"
FT                   /protein_id="ABM56317.1"
FT                   /translation="MNLSFLRLGWRSLVRDLRAGALRLLIVAVSLAVAALTAVGFFADR
FT                   LQGGLQRDALQLLGGDAVVVSDLPTPAAFVERARALGLQSVTTLSFPTMGRASDAQGGA
FT                   SKLVALKSVPPGYPLRGNLTVADAPGAAGQSTRAIPAPGQVWVDASLLTALNLAIGDTL
FT                   LLGDAQLRIARIIVIEPDRGSGFIGFAPRVMINRQDLPATGLVQPASRLNYRFALIGPA
FT                   PAVAAFNAWALAEAKKPGVHGVRMESLDSGRPEMRQTLDRAQQFMGLVALLAALLAAVA
FT                   VALAARGFAAGQLDAAAMLRVLGQSQRAIAGAYSTEFALLGLLASVLGVALGYLVHHAF
FT                   VLLLAGLLGTSLPPPGLWPAASGLGLGLTLLFAFGMPPLLQLARVPPLRVIRRDLGGIK
FT                   PASLAVLALGLAGFAALLLAVSRDLLLGLIAVGGFAGAAALFAGLSWLAVKLLRHSVNE
FT                   VSAPRWLVLATRQIAARPAYAVVQVSSLALGLLALVLLVLLRTDLISSWRQATPPDAPD
FT                   RFVINVQPGQSAAFRQALADSGVLRYDWYPMIRGRLVAVNGQAVGPERYADERAKRLVE
FT                   RELNLSNTLEQPAHNQIVAGQWRPGEAGAISVEEGIAKTLGLRLGDRLRFDIGGVQDEA
FT                   RITSLRKVDWGSMRANFFVMYPVAQLEESLPLTYLAAYRAPAAPGFDNALVRQFPNITS
FT                   VDMGATIAQVQRVLDQVIHAVEFLFAFTLAAGLVVLFAAVTATREERAREYAIMRAVGA
FT                   SARLLRQVQRAELAGVGLLAGFLASAVALALGWALARFVFDFSWTAAPWVPLAGAGAGA
FT                   VLALAAGWWGLREVLLRPVTDTLRRSAE"
FT   sig_peptide     599567..599671
FT                   /locus_tag="Veis_0533"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.698 at
FT                   residue 35"
FT   gene            complement(602213..603178)
FT                   /locus_tag="Veis_0534"
FT   CDS_pept        complement(602213..603178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0534"
FT                   /product="Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: bam:Bamb_3882
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56318"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFB1"
FT                   /protein_id="ABM56318.1"
FT                   /translation="MPPALPTYDDVVAAAGRIAGHAHRTPVLTARRIDEVFGARLFFKC
FT                   ENLQRMGAFKFRGAFNALSRFDAAQRQAGVIAFSSGNHAQAIALAARLLGLPATIVMPQ
FT                   DAPASKIAATQGYGASVRLYDRYTQDREQISRALAERDGLTLIPPYDHADVLAGQGTAA
FT                   KELFEEVGPLDAFFVCLGGGGLLSGSALATRALSPRCKLYGVEPAAGNDGQQSFRSGAI
FT                   VHIDTPRTIADGAQTQHLGQITFPIIRRDVDDILTVTDEQLIDAMRFFAERMKLIVEPT
FT                   GCLGFAAAHALRSQLAGQRVGVLISGGNIDMARFCALLAP"
FT   gene            complement(603205..604152)
FT                   /locus_tag="Veis_0535"
FT   CDS_pept        complement(603205..604152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bma:BMA0304 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56319"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFB2"
FT                   /protein_id="ABM56319.1"
FT                   /translation="MAANWMRRMVAAGVSAALLTACGSSTTESAIAPQRLIAFGDAMSD
FT                   VGQNGTRYTVNDGSINNWTLQIAAKYDKPLTPVSAGGTSYATGNARIVAKPDAAGNAST
FT                   RTLSEQIDSFLAKDRFAKDDLVLMNGGLSDLIAGMAAVNLGTQTEAAQLAAAFQAGQDM
FT                   AAQVRRLVAAGARHVLLTGSYDLGKTPWAKVMGREAVLGRASSRFNEGLLLGIVDLGAN
FT                   ALYVDSAYYVNLYTGSPSSYGFNNATDAVCTSVDASNGIGIGPGQINAALCNSATLRPD
FT                   AKQDTYVFADFVHLTPSAQRQFGTFAYDRLRARW"
FT   sig_peptide     complement(604063..604152)
FT                   /locus_tag="Veis_0535"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.448 at
FT                   residue 30"
FT   gene            complement(604500..605732)
FT                   /locus_tag="Veis_0536"
FT   CDS_pept        complement(604500..605732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0536"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: pol:Bpro_3207
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56320"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFB3"
FT                   /protein_id="ABM56320.1"
FT                   /translation="MAMPLADASAAEPALLRQRGSNHVGLRQFNERVVLQALRTHGSLA
FT                   KAEIARVTGLTAQAIGLIAARLDDEQLLRREAPVRGRVGQPSVPIGLNPDGAFAVGIKI
FT                   GRRSADWLLVDFSGQVRARIRLDYAFPDIDQLLPAIGRHLNQLLDGLGPLRARVVGVGL
FT                   AAPLKLGGWHRMLGLSAAQSQAWNSIDLTGQVQQMTGLPVRFAKDTAAACVAELLQGRG
FT                   RDIPSFLYLFMDTFVGGALVLDSHLHRGLHGNAGAVASLPLAVAQPDSAAAPEQLIRQA
FT                   SLWELEQRLREQGLDPMAAYDERVLQAPWAAHSRAWIASAASALAHCIVSATAFLDLDA
FT                   VVIDAATTADLLQALAERVRALLHAYNWEGLHPPPPLALGSIGSDARALGGALLPLHAC
FT                   FAPDTDIFLKT"
FT   gene            complement(605785..606237)
FT                   /locus_tag="Veis_0537"
FT   CDS_pept        complement(605785..606237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0537"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: pol:Bpro_3206
FT                   RbsD or FucU transport"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56321"
FT                   /db_xref="GOA:A1WFB4"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFB4"
FT                   /protein_id="ABM56321.1"
FT                   /translation="MLKGIDPLLSPDLLRLLAEMGHDDALVLADANFIAMRPGAGTPVL
FT                   RLPGVGLVRALQAVTSLLPLAEDIPHPVAYMQVGGTEPPYRSALQREAVALLAGLGLDS
FT                   GQAEGVERFAFYERARKAYAIVVTGELQPWGNFILRKGVICASLRP"
FT   gene            complement(606290..607114)
FT                   /locus_tag="Veis_0538"
FT   CDS_pept        complement(606290..607114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0538"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_3205 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56322"
FT                   /db_xref="GOA:A1WFB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFB5"
FT                   /protein_id="ABM56322.1"
FT                   /translation="MDAFAPAHTVHAAAGAAPVLQAKGLVKRYGQVIALDGADFELRAG
FT                   EILAVIGDNGAGKSSLIKVLSGAIMPDAGEILLDGQRIQFKSPIDARKAGIETVYQDLA
FT                   VAPAMTIAENLFLGRELLRPGIRGSLLRMLDKKKMRAASAARLAELKVGIHSMTQAVET
FT                   LSGGQRQCVAVARAAAFARHVVIMDEPTAALGVKEGRMVLELICRVRDQGLPVILISHN
FT                   MPYVFEVADRIHIARLGRRAAVVQPKKISMSDTVAVMTGAMPASELPPECLA"
FT   gene            complement(607114..608082)
FT                   /locus_tag="Veis_0539"
FT   CDS_pept        complement(607114..608082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0539"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rfr:Rfer_1902 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56323"
FT                   /db_xref="GOA:A1WFB6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFB6"
FT                   /protein_id="ABM56323.1"
FT                   /translation="MPSITFRRPPQVTLATLGPFIALILACAFFASQSERFLSAQNFSL
FT                   ILQQVMVVAVIAIGQTLVILTAGIDLSCGMVMALGSIVMTKMAASHDLSAPLAIACGIA
FT                   VTVLFGLVNGLLVTKIALPPFIVTLGTMNIAFAITQLYSDAQTITDIPEGMTLLGGTFV
FT                   LGQTAIVWGAVLMLALYLIVWFALRETAPGRHVYAVGNNPEATRLTGIATDRVLLGVYM
FT                   LAGLFYGIAALLSVARTGAGDPNAGQTENLDAISAVVLGGTSLFGGRGMILGTLVGALI
FT                   VGVFRNGLTLMGVSSVYQILVTGILVILAVATDQLSRQGVR"
FT   sig_peptide     complement(607978..608082)
FT                   /locus_tag="Veis_0539"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.481 at
FT                   residue 35"
FT   gene            complement(608248..609261)
FT                   /locus_tag="Veis_0540"
FT   CDS_pept        complement(608248..609261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0540"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: pol:Bpro_3203 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56324"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFB7"
FT                   /protein_id="ABM56324.1"
FT                   /translation="MLQRRPAVVLSALALSGAMVCALARAADAPVIGLITKTETNPFFV
FT                   TMKEGAVAEAKKLGAKLVATAGKADGDNAGQVTALENLVAAGAKTILIAPNNAQAIVPA
FT                   IKKARASGVMVIALDSPTDPVDVVDALFATDNYKAGELIGQYAKAAMAGKKPVIAMLDL
FT                   LPGHPVGAQRHNGFLKGFGLPTLEAHSNELARPPEVVCMADSFGDRTKGQTAMENCLQK
FT                   NPDINLLYSINEPAAAGAHKALKAAGKEKNILIVAVDGGCAGIADVDRGVIAATSQQYP
FT                   LRMAAMGVAAGVEYAKTGKKASGYTDTGVTLIAAKPQAGVDSQDVKTGASLCWGKK"
FT   sig_peptide     complement(609181..609261)
FT                   /locus_tag="Veis_0540"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 27"
FT   gene            609529..609870
FT                   /locus_tag="Veis_0541"
FT   CDS_pept        609529..609870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56325"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFB8"
FT                   /protein_id="ABM56325.1"
FT                   /translation="MRHCVYTRAHKGRTLETRVGVKEFRAHLPAHLELASPLAITRHGE
FT                   TIGFYIPARPGRNQTELDALAEAAAKLHAMMSALRISQEDVVSEFKARRKAAKSWADKR
FT                   LSWMRMARL"
FT   gene            complement(609901..610914)
FT                   /locus_tag="Veis_0542"
FT   CDS_pept        complement(609901..610914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0542"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: pol:Bpro_3203 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56326"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFB9"
FT                   /protein_id="ABM56326.1"
FT                   /translation="MLQRPATVVLSALALSGALVCALARAADAPVIGLITKTETNPFFV
FT                   KMKEGAVAEAKKLGAKLLATAAKADGDNAGQVTALENLVAAGAKTILIAPNNAQAIVPA
FT                   IKKARASGVMVIALDSPTDPMDAADALFATDNYKAGELIGLYAKAAMAGKKPVIAMLDL
FT                   YPGHPVGAQRHNGFLKGFGLPTLEADSNELARPPEVVCMADSFGDRTKGQTAMENCLQK
FT                   NPDINLLYTINEPAAAGAHKALKAAGKEKNMLIVSVDGGCAGIADVGRGVIAATSQQYP
FT                   LRMAAMGVAAGVEYAKTGKKASGYTDTGVTLIAAEPQAGVDSQDVKTGASLCWGKK"
FT   sig_peptide     complement(610834..610914)
FT                   /locus_tag="Veis_0542"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            611144..612094
FT                   /locus_tag="Veis_0543"
FT   CDS_pept        611144..612094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0543"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bch:Bcen2424_3472
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56327"
FT                   /db_xref="GOA:A1WEL8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1WEL8"
FT                   /protein_id="ABM56327.1"
FT                   /translation="MSEPVYVGIDVAKRTFEVATTGQAQTFSLGNDEAGHAQLCQLLAP
FT                   LSPRLVLLEATGGYEQDLALALSAAGLRVSVINPRQARDFARCMGKLAKTDRIDAQALR
FT                   GFAALLDAQGHEPRMLADEQQRELTALVVRRRQLVAMLVAERQRLALAHPKAKPSILRI
FT                   MATIAEQLNDLDGQLKEHVLAHHADLAALLTSVKGVGPTTASTLLAQLPELGQLNRKQI
FT                   TSLVGLAPINRDSGTLRGQRHIFGGRADVRRVLFVAALVGTRFNPVLKAFYARLLAAGK
FT                   PKKVALVACMHKLLVILNAIARTKSPWRNELAEAV"
FT   gene            612238..613233
FT                   /locus_tag="Veis_0544"
FT   CDS_pept        612238..613233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0544"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: pol:Bpro_3202 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56328"
FT                   /db_xref="GOA:A1WFC1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFC1"
FT                   /protein_id="ABM56328.1"
FT                   /translation="MVFPSRTAQPDVQVATAGEALFDLIEEPDGRLRPCAGGAVYNLTR
FT                   ALGLQGVGTLYLNPLSADRLGRQLAQGLRAAAVALAVPEPVALPTSLALAALDGAGKAS
FT                   YGFYRDGVADRAITAQALNAACAAQPRLQIVATGCLALVAPDAAKYQPWLAAQRAAGRM
FT                   VVVDANLRLSAAGDADSYRANVHQALQHAHLIKVSDDDLEALEVPGVSVIGRAQQLLQS
FT                   TPAQWLALTLGARGAMLLQRGGGACQARERRPVDVVDTVGAGDCFLAGLIAALLERAVP
FT                   SPLAPMDEPDLRAVLQHALVSASLCVQRAGCAPPTRAEVKQRMADNDFEG"
FT   gene            complement(613303..614550)
FT                   /locus_tag="Veis_0545"
FT   CDS_pept        complement(613303..614550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0545"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bja:bll5494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56329"
FT                   /db_xref="GOA:A1WFC2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFC2"
FT                   /protein_id="ABM56329.1"
FT                   /translation="MSNITIIKNAHILNPPYQDVHGPCDIVIEGEYIKEIAERPVAMDG
FT                   ARLIDVQGRTVMPGLIDLHVHTNAVEVNLGKQSSMPNALVTLRSAGLMSAMLRRGFTTV
FT                   RDAGGAGDPMKQAVQMGLIQGPRLFVSGRALSQTGGHGDMRGRSDFLAASECACCVRAG
FT                   ALARVADGVDAVRRAVREEFQMGADQIKIMASGGVASPTDPIGAIGYSEEEIRAIVDEA
FT                   QRQGSYVLAHAYTAQAITRAVNFGVRTIEHGNLVDSAAAAAMAKQGAYAVPTLVTYDAL
FT                   ATEGEQYGLGPESLEKLLRVRDAGLGSLEIFKAAGVKMGFGSDLLGPSQRLQSEEFRLR
FT                   RQVQSAAEVLTSATSIGAEVLDMRDRLGLLAANAWADLLVVDGNPLRDIGCLLGQGEKI
FT                   PLVMKAGVVEFNTLGG"
FT   gene            complement(614636..615136)
FT                   /locus_tag="Veis_0546"
FT   CDS_pept        complement(614636..615136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0546"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; KEGG: bja:bll5495
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56330"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFC3"
FT                   /protein_id="ABM56330.1"
FT                   /translation="MSHFLDPLLLLADAQAQQQQPQACFQAIDQALAAAIGHRLFTILA
FT                   YHPQARESQRIYTSQPAAYPVGGRKPVTGSPWMQQVIHQGQPYIGYQRQDIIDSFYDHE
FT                   LIFSLGCASVLNIPVRWRGQTWATVNLLHQENWYQPSHIPLSRSVAQMLLPALLFPRMT
FT                   EEG"
FT   gene            complement(615133..616503)
FT                   /locus_tag="Veis_0547"
FT   CDS_pept        complement(615133..616503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0547"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; protein of
FT                   unknown function DUF1228; major facilitator superfamily
FT                   MFS_1; KEGG: bja:bll5496 hypothetical metabolite transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56331"
FT                   /db_xref="GOA:A1WFC4"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFC4"
FT                   /protein_id="ABM56331.1"
FT                   /translation="MSAVSARIERLPFGKYHRHLLLLGGLGYAFDAMDAAVIAFVLPVL
FT                   KSSWQLDGPQLGIVASANFIGFFFGALSAGALGDLIGRRRIMMWALVVYCVASFFSAMS
FT                   NEWGIFIALRIIAGIGTGAESAIIAPYLSEFVPRRYRGIFTGALAGFFSFGFIAAALLG
FT                   RYIITPDFEQGWRVVILITSTPVLMLLWWRRRLLESPRWLESQGRTDEALEVVAKMEQQ
FT                   VMREFPVLPQVDAEELDTPPPVVKQESLFAKYAFLLSKKLRPITIMTWCMWLSITFCYY
FT                   SFFSWIPTLLIQNGMTLTKSFTYALVMYIAQTPGYFSAAWFNEKIGRQATVVSYMVLGS
FT                   LAAIGMAYARSDAQVMTMGILLSFFMNGAYAGIYAYTPEVFPTHVRTIGTGLASAIGRI
FT                   GGITAPIMVGFTYETYGFIGVFGATTVILFLGAGAVLIMGIPTKGKSLEQIAASKLS"
FT   gene            complement(616617..617069)
FT                   /locus_tag="Veis_0548"
FT   CDS_pept        complement(616617..617069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0548"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: pol:Bpro_0114
FT                   phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56332"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFC5"
FT                   /protein_id="ABM56332.1"
FT                   /translation="MSYRSLTENPMPIWKKPFDLSLLNASNHGTAARHLGIEIIEMGDD
FT                   FVRGRVPVDHRTKQPFGLLHGGVSVVLAESLGSVGAYYASPEGHSAVGLDINANHLRSA
FT                   RSGWVTGQARPVHLGRSTQVWHIDLVNEADELICVSRLTMAILAPR"
FT   gene            617192..618346
FT                   /locus_tag="Veis_0549"
FT   CDS_pept        617192..618346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0549"
FT                   /product="extracellular ligand-binding receptor"
FT                   /note="KEGG: reu:Reut_B5396 extracellular ligand-binding
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56333"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFC6"
FT                   /protein_id="ABM56333.1"
FT                   /translation="MQRRPFVTLASSAAAVLAAPGFMRNAWAQESGISGKTLGIGCSTA
FT                   LSGHFAGFGHDIRLGMEAAVAHVNGRGGIFGRTLQLSLVDDAYVPQRTADNVKQMISQG
FT                   NVFVLLSCFGTPNNQAILPLLEEAGIPYVGPITGASSLRKSSRNVFHVRASYTDEIRRL
FT                   VQRLAGMGLTGVGVVFLDNGFGRELLEDATRAMAEQQIKPLLQVALAIDGKNLGEVLAK
FT                   VSEVRPPAVLLATSGLESVELIRGLKKNHPGILMTGTSVTLSGDDLKELGSASSGLAVT
FT                   MVVPDSNLAKIALVRDYQSAMRARNEQMFTQRSLEAYINLRVLAEGLERAGADLTRAKL
FT                   RSALASIRNWDMGGFVIDYASQPPYVGSRFVDLGVFGGTGRFLA"
FT   sig_peptide     617192..617278
FT                   /locus_tag="Veis_0549"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            618389..619540
FT                   /locus_tag="Veis_0550"
FT   CDS_pept        618389..619540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0550"
FT                   /product="extracellular ligand-binding receptor"
FT                   /note="KEGG: reu:Reut_B5396 extracellular ligand-binding
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56334"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFC7"
FT                   /protein_id="ABM56334.1"
FT                   /translation="MQRRPLVTFAFSSAALAAPGLMRNASAQESGVTSKTLGIGCSAPV
FT                   SGPLAGLTHDSRLGMEAAVAHINRRGGIFGRMLQLNITDDAYVPQRTVDNVKQMIAQGN
FT                   AFVLLSCAGTPNNQALLPLVEEAGIPYVAPLTGASSLRKSLRNVFHVRASYTDEIRRLV
FT                   QRLAGMGLTGVGVVFLDNGFGRELLEDATHAMAEQRIKPQVQAALTVDGKNLGEVLDKV
FT                   AQARPAAVLLATVGSASVALVRGLKKNHPGLLMAGTSVALSGDEIKQLGKAGSGIAVTM
FT                   VVPDAHLAKIPLVRDYQSAMRASNHRVFTQRSLETYINLRVLAEGLERAGAALTRAKLR
FT                   DALASIRNWDMGGFVIDYASQPPYVGSRFVDLGVFSGTGRFLT"
FT   sig_peptide     618389..618472
FT                   /locus_tag="Veis_0550"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.915 at
FT                   residue 28"
FT   gene            complement(619662..621185)
FT                   /locus_tag="Veis_0551"
FT   CDS_pept        complement(619662..621185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0551"
FT                   /product="glutamate-cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="TIGRFAM: glutamate--cysteine ligase; KEGG:
FT                   pol:Bpro_3399 glutamate--cysteine ligase, monofunctional"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56335"
FT                   /db_xref="GOA:A1WFC8"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFC8"
FT                   /protein_id="ABM56335.1"
FT                   /translation="MSTLQDRLAAYPADALRGMRCGIEKEGLRALPSGGLALTPHPLAL
FT                   GSALTHPLITTDYSESQLELITGAHRGVQQCLDELTEVHQFVHHTLKDSGELLWASSMP
FT                   CGLPTDETIPLARYGSSNIGRAKSVYRMGLGHRYGRRMQTISGIHYNWSLPGVDSGQYF
FT                   ALIRNFRRHAFVLLYLFGASPALCPCFVQGREHRLQQMAGGNALYLPHATSLRMGRLGY
FT                   QSEAQARLAVSYNGLQGYADSLHEALTQPYPAYESVGLRNPGGDYNQLGTSLLQIENEF
FT                   YGSIRPKRSVRTGERPLHALRERGVEYVEVRLMDLDPFVPVGITAATMRLLDVFLLHCL
FT                   LSDSPPDTPEEIAELQHNQQLAAERGREPGLRLQRNGHSLPLTDWGAELLAACAPLAAA
FT                   LDASHGSDDYGAALHAARALMTAPASTPSARVLDAIERRHGCNFEDFARRQSIAARDLL
FT                   LALPWSAGQQARYLALADESVAAQKAIEAADTLPFEAWREQYMAVAGLG"
FT   gene            complement(621499..622122)
FT                   /locus_tag="Veis_0552"
FT   CDS_pept        complement(621499..622122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_2657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56336"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFC9"
FT                   /protein_id="ABM56336.1"
FT                   /translation="MALAACASQPPVPDWQINAHGAAQKAIEAYLSGDARVEQLEWERS
FT                   RAEIARTGRPELLARLELLRCAAQLASLVLQACDRFEALRPDAAAPEQAYADYLAGRLP
FT                   PAHAALLPPAQRKLAATGDARALADIADPLSRLVAAGVLLRTGRASPALITLASDTASA
FT                   QGWRRPLLAWLLLQLQRAEAAGDAEAAAALHRRITIVGQGAALR"
FT   gene            complement(622161..623186)
FT                   /locus_tag="Veis_0553"
FT   CDS_pept        complement(622161..623186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0553"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: pol:Bpro_2658 ABC-type transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56337"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFD0"
FT                   /protein_id="ABM56337.1"
FT                   /translation="MNEHATPPPAPPASESLRPVACLELKAAALLLFTLLLIVGSGLYL
FT                   LYARGVFEPTQTVILTADDSEGVVVGMDMTFSGFPIGRVRRIELASAGHARILVDVPRK
FT                   DAHWLRTSSVFTLVRGLVGGANIRAYSGILSDPPLPDGAERPVLGGDVGAEVPRLLSAA
FT                   RDLLNNLSALSAPDAALGSSLAQIKTLTERLNGPDGALGVLLGNAADARQLLALLERSN
FT                   AVLARLDALLARIDGMAARADRQLLGSDDDKDSKDALLPALRASAAQLDGLLADTRASL
FT                   GRVDAVLQEAQAIGANAREATTDLGALRAQVQSNLSKLEGLINQIGRQWPFARDTELSL
FT                   P"
FT   gene            complement(623197..624060)
FT                   /locus_tag="Veis_0554"
FT   CDS_pept        complement(623197..624060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0554"
FT                   /product="ABC-type transport system ipermease component"
FT                   /note="KEGG: pol:Bpro_2659 ABC-type transport system
FT                   ipermease component"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56338"
FT                   /db_xref="GOA:A1WFD1"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFD1"
FT                   /protein_id="ABM56338.1"
FT                   /translation="MNGLSGPPCHRYDPAMAWLISLTSLVARLPGRAGPARVGHMARRW
FT                   ALAWWRIFYLGAVVLVLALSPSSYGPGRRQALARRLYLDTAPVLPGFTVLAALISLVLT
FT                   RIVVVTALSYGLSRYALEMVIRVLVLELIPLTAALFVAMRCTIGHGAQLAQLRQSGQLD
FT                   ALARQGLDPVRTELLPRAIAGVFACVTLAALSSVVALVLVYLGVYGLNGAGLPGYTRMF
FT                   GQVFSPGVTLVLALKTLFFSLAVALIPMGAGLYDSARPDSELGGLVRMFAVLLLIELAS
FT                   LMGNYY"
FT   gene            624470..625069
FT                   /locus_tag="Veis_0555"
FT   CDS_pept        624470..625069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_2998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56339"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFD2"
FT                   /protein_id="ABM56339.1"
FT                   /translation="MDTTADKLLELVRTQGLVRPNALAPLGIPRVALTRAVRRGQLERI
FT                   GRGLYGLTARPVSAHGALAEVARRVPKGVVCLLSALRFHDLTTQAPFAVWLAIDNKAAT
FT                   PKLDYPPLRLVRFSGAALTEGVEEHVVDGVPVCVTGVAKTVTDCFKYRNKIGLDVALEA
FT                   LREAWSAKRMTSDQIWHYAKIDRVANVMRPYLESLA"
FT   gene            625473..626042
FT                   /locus_tag="Veis_0556"
FT   CDS_pept        625473..626042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56340"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFD3"
FT                   /protein_id="ABM56340.1"
FT                   /translation="MTTVAIPAWNPQGLLPPIDVLNPTSVERSPYRVVLTDVMVRFATS
FT                   PERRQILRGWLGYRAALHGMGLTDGFQWLDGSFLEQVETLENRPPQDMDVVTFLNSPAG
FT                   FALTQQQIAALDNQAVKQAFRVDSYFVELNLPANELVERSAYWYSMWSHRRNQAWKGYL
FT                   EINLNPAHDQQATDYLNQQDALGAQP"
FT   gene            626039..626968
FT                   /locus_tag="Veis_0557"
FT   CDS_pept        626039..626968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56341"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFD4"
FT                   /protein_id="ABM56341.1"
FT                   /translation="MNTDQRNFLLAERETVKRMLAKTPATALLTRMSDEARLRNIEAEL
FT                   AALPADGRSPARARLTFNGLPVIGSHGIFADFGMKAVSSFTDAVATVAASLSAPLAAMG
FT                   PIPNRDQNQLLITNTAVGSFGFELEEYRAQELLDDESAVAVALDRTQSLLQATLGQDDE
FT                   LADIASETDPRALDKVRGFLRVLADNEAICTLQYGDKAMRFADPGQVRRSLDRLAADNL
FT                   RESQEMLEGEFVGVLPVARSFEFKLSGSDEIVHGKISPKVGDVEMLNDHLHQRVRVEAM
FT                   RTQVGNGRPRFLLTQIPQWAADAVPASS"
FT   gene            complement(627369..628601)
FT                   /locus_tag="Veis_0558"
FT   CDS_pept        complement(627369..628601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0558"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: HDOD; KEGG: tbd:Tbd_1938 putative diguanylate
FT                   phosphodiesterase (EAL domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56342"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFD5"
FT                   /protein_id="ABM56342.1"
FT                   /translation="MSACVLGSLALGYHPLWNRARQLAGMVLYATAMATDEPAPPAAGA
FT                   HLLRTLQDLWSARSPPLLICAQTRPLLDDLLEQAAPGAPSIAVRGDWLSDPALCARVHA
FT                   ARQRGLRLVWRGGLGQFPQAGLADCFECSLLTLRPKDAVAAWQTARAADPARPALAGHI
FT                   CEHITHRALMAHCLDHDRAQALAGWPAQDILRRLQHRRAQQPAQAVILKLLQAIDAEQS
FT                   LETFEDILGEDPLLAYRFLASANSAALDLRTGISSLRRGLVMMGCLALRRWLAELRPDA
FT                   STDPDMQPVRRAMVLRARLAAGLLDTGVGNELRSDIYLCGLLAQLDQLLGEPQDSILRR
FT                   LPLSERIHQATVLRTGPYSAGLQMACALEGDDASAIGPLCATFAMELEQVNRTLLRVLS
FT                   GQEVPAPAPGH"
FT   gene            complement(628810..630063)
FT                   /locus_tag="Veis_0559"
FT   CDS_pept        complement(628810..630063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0559"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="TIGRFAM: flagellar hook-associated protein 3; PFAM:
FT                   flagellin domain protein; KEGG: rfr:Rfer_3724
FT                   flagellin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56343"
FT                   /db_xref="GOA:A1WFD6"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFD6"
FT                   /protein_id="ABM56343.1"
FT                   /translation="MSNDITRLGTANMYDSALRNLGTRQSQLANLQESLTSGKRVVRAS
FT                   DDPVSAAQAERALNRLARIQSDQRALAAQRNAIALGESALGDAVDLVQNFRALVVSAGD
FT                   ASLQPADRATIANQLQSLREQLLQVANRKDTNGVALLSALGSAQTPFAGPLGGAPDYRF
FT                   AGQPGQSASAGARIAATLDGDAAFMFDPRRDGVYTATVSPIPTGRQLTTSAVTPTAPRL
FT                   VTGDDYRITFSAAGPGATPGTSSASYTITNSSTGAVSAPVRLPDFRADEPLTVTVTGIP
FT                   GLSLDIQGLPADGDSITLRPGTSLFGTLDSAIDGIRRAPNQNAAIQSVGQALANIDLGL
FT                   ERVHDMRGYAGELLNRADRISGDQTQRSIQLESDRSRAEDLDMIQGISDFQNQQVGYQA
FT                   ALKSYAQVQRLSLFQYIG"
FT   gene            complement(630090..632066)
FT                   /locus_tag="Veis_0560"
FT   CDS_pept        complement(630090..632066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0560"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: rfr:Rfer_3723
FT                   flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56344"
FT                   /db_xref="GOA:A1WFD7"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFD7"
FT                   /protein_id="ABM56344.1"
FT                   /translation="MGLLNVSTRALLADQVVLQTTGHNIANVNTPGYSRQSVALQTVPG
FT                   QFTGNGYIGQGVDVAGIVRSQSELLTRQSAAAGAAQSADAVRAERLGQLQDVFSGGSAG
FT                   LGAAINDMLNAFADVLGAPTDITARTVVLTRIDETAARMRTAAGRMDEIQAAASAQLQS
FT                   SVGVVNDLAMQMAAVNEQITRAKGNGQTPNDLLDRRDQIIRDINQQLQTTQIPADDGSV
FT                   GLFVAGSQPLVLGNTATSLSIAEASAFPGSGQARLFFNRPGAKPVEMDDSLLGGGAIPG
FT                   LLRFDNHDLSEGRNLLGRMAMGLGLALNQQQNQGLTLDGQPGKNLFGLPASMPGHTSGA
FT                   GVGTVTFSDPTRFAASDYEIRFATGSAGQVVRLSDGQATPFTDPAQLAAQAIDGLRFDL
FT                   TRPGAPGQSMLFKPFGTAASNLQALVHAPRDLAAANPVMAAMGSANGGTLQLAGLKATG
FT                   LPHPPGLVLPANANPAATPPIAGGVQLQFDAGPPMRYDVLDRRTTPPTTVATAQPYVSG
FT                   APIAIDGWEIRLQGAPNTGDTVLIGNALDPQYGDRFSRDTGNASALMDLRDLKMFDEST
FT                   LSDGYAQAIAQVGTRTQSAKFAADLSRTIAANLERDRTAISGVNLDEEAARLIQYQQAF
FT                   QASSKVMQVAQNIFDALLQGLAR"
FT   gene            complement(632085..633020)
FT                   /locus_tag="Veis_0561"
FT   CDS_pept        complement(632085..633020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0561"
FT                   /product="flagellar rod assembly protein/muramidase FlgJ"
FT                   /note="KEGG: rfr:Rfer_3722 mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosamidase; TIGRFAM: flagellar rod
FT                   assembly protein/muramidase FlgJ; PFAM:
FT                   Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase;
FT                   SMART: Lysozyme subfamily 2"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56345"
FT                   /db_xref="GOA:A1WFD8"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR013377"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFD8"
FT                   /protein_id="ABM56345.1"
FT                   /translation="MALTLPPNTLALDIRALDALKQGAGSSAQAAQTTREAARQFESLF
FT                   MHELVKSMRAATLKSGLMDSGQADLGQDLLDQQLALGLSGMPGGLSEAIRRQLARQMAG
FT                   AAGDAGGDANGNANGGANGGAKGHADGAPASGTLGLQPPAAASASAGAPSQERARFVQR
FT                   LGHSAERVARDSGIPAGFMLGQAGHETGWGQSEIKHVDGSNTFNLFGLKAGQGWAGKVA
FT                   EVRTTEYVDGRPRKVLAKFRAYDSYEESLRDYARLINGSPRYAKARAQTGSVVAYATEL
FT                   QKAGYATDPGYARKLSGAIHSALRAQRTQT"
FT   gene            complement(633105..634262)
FT                   /locus_tag="Veis_0562"
FT   CDS_pept        complement(633105..634262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0562"
FT                   /product="flagellar P-ring protein"
FT                   /note="PFAM: flagellar P-ring protein; KEGG: rfr:Rfer_3721
FT                   flagellar P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56346"
FT                   /db_xref="GOA:A1WFD9"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFD9"
FT                   /protein_id="ABM56346.1"
FT                   /translation="MIAMKALPKALPIAPRSAHRLWPLLALLAAGAVGPAQALRIKEVA
FT                   AVQGVRSNQLTGYGLVVGLDGTGDQTTQMPYTTQALSNYLQQMGLSLPPGAASQLQPKN
FT                   VAAVIVTAQLPAFAQPGQTMDVNVSSVGNARSLKGGTLVATPLRGADGEIYALAQGNVV
FT                   VGGAGAAAGGSKVQINHLSAGRIPLGAQVEQAVPTPLNEGQSIRLQLNSMDFQTARRVA
FT                   QAINAKLGQGLATALDGRTVQVQAPIDPDARVGFIADLEELPLESSAPAAKVVINARTG
FT                   SVVLNQSVTLGPCAIAHGNLSITISQTPVISQPNPLSSGQTVLAQKSDISIRQEAGNVI
FT                   QVPASPRLADVVKALNALGATPGDLLSILQAIQAAGALNAELEVI"
FT   sig_peptide     complement(634146..634262)
FT                   /locus_tag="Veis_0562"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.968 at
FT                   residue 39"
FT   gene            complement(634656..635405)
FT                   /locus_tag="Veis_0563"
FT   CDS_pept        complement(634656..635405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0563"
FT                   /product="flagellar L-ring protein"
FT                   /note="PFAM: flagellar L-ring protein; KEGG: rfr:Rfer_3720
FT                   flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56347"
FT                   /db_xref="GOA:A1WFE0"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFE0"
FT                   /protein_id="ABM56347.1"
FT                   /translation="MPAVAPIVMPIMVPAAMRRRPSGLRCAQRAGAMGLLLCAGCTSLA
FT                   PVPPPVDILSTTAPALAAAAQGPRPVTGGLFHNASYRPAFEDRRARMVGDSVTIQIVEN
FT                   VTASQKSSSTVDRQSQVSAGVQALPFIGKTLTGKLSLGTSADNTFSGKGGTESANTFSG
FT                   AITTTVVEVLPNGHLVVTGEKQIGVNQNVDVLRFSGTVDPSALQPGSIIASTLVANVRV
FT                   ESRGRGAQTEAQAMGWLGRFFNTVAPF"
FT   gene            complement(635417..636199)
FT                   /locus_tag="Veis_0564"
FT   CDS_pept        complement(635417..636199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0564"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgG;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: rfr:Rfer_3719
FT                   flagellar basal-body rod FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56348"
FT                   /db_xref="GOA:A1WFE1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFE1"
FT                   /protein_id="ABM56348.1"
FT                   /translation="MIDALWIAKTGMSAQQTQLDVIAHNLANVSTTGYKRSNAMFEDLI
FT                   YQNLRQVGANSTEQNQLPTGLQLGLGVRTVATSRCFVQGSLQESRNNLDVAINGNGFFQ
FT                   VMLPDGSLGYTRDGSFQVDAQGRLVTANGLPVANGITIAANAISVSISAEGAVSAIMPG
FT                   SVQPQPLGNLAMASFINPAGLEPIGQNLFKESAASGQPQQGIPGSNGLGVIKQGFLEAS
FT                   NINIVEELVTMIQTQRAYEMNSKAIQTSDQMLAKLSQL"
FT   gene            complement(636230..636970)
FT                   /locus_tag="Veis_0565"
FT   CDS_pept        complement(636230..636970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0565"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgF;
FT                   PFAM: flagellar basal body rod protein; KEGG: rfr:Rfer_3718
FT                   flagellar basal-body rod FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56349"
FT                   /db_xref="GOA:A1WFE2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFE2"
FT                   /protein_id="ABM56349.1"
FT                   /translation="MDHIIYTTMTGAGAAAYRQAVLANNLANISTGGFRAQLSTFRSVP
FT                   LQGDGAKTRVFALEATSGYDDSAGPVQHTGRNLDALAAGRAWFAVQGPDGTEAYTRAGS
FT                   FELSPTGQLLTPGGLPVLSDAGTPIDMPPGADITLGADGSISAKVAGQPAQTVGRLKLA
FT                   TPGAEDPLQRGGDGLFRTASGEPLPSDADARMLAGALEGSNVNPVECMVGMIAAARQFE
FT                   QQMQLLQTAQTNDKSASRLLGVND"
FT   gene            complement(636984..638264)
FT                   /locus_tag="Veis_0566"
FT   CDS_pept        complement(636984..638264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0566"
FT                   /product="flagellar basal body FlaE domain protein"
FT                   /note="PFAM: flagellar basal body rod protein; protein of
FT                   unknown function DUF1078 domain protein; flagellar basal
FT                   body FlaE domain protein; KEGG: rfr:Rfer_3717 protein of
FT                   unknown function DUF1078-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56350"
FT                   /db_xref="GOA:A1WFE3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFE3"
FT                   /protein_id="ABM56350.1"
FT                   /translation="MGFQQGLSGLNAASKSLDVIGHNVANANTVGFKSGRAEFAEMVAS
FT                   AIGSADGLNAGIGVDVAAVSQQFGQGSLTITGNNLDVAINGAGFFTLTLPDGTPAYTRS
FT                   GNFKLDKDGNMITNDAARVMGYPVDPATGLRTGAEPVGMVFPTSAPIPAKQTGTITAAF
FT                   NLDARAPDAAGNPAAQPPVPATPRTTYGTSINVYDSQGVAKPVNLYFQKTATANTWAVY
FT                   DRLDDPGATPPVQAMPIGQITFDNDGKITGPAAPAPATGFALPLTIDPTPPNPNGLPAY
FT                   TVQLKLDGVTQFGTRFAVSSLSQDGYTVGELAGIDIESNGMLMTRYSNGVTRSEGQLAL
FT                   SRIRNAQGLAAVGSNNWVATHASGPAVVGTASDGNFGALRSGALEDSNVDLTAELVNMM
FT                   TAQRTYQANAQTVKTQDQVMSTLVNLR"
FT   gene            complement(638314..639024)
FT                   /locus_tag="Veis_0567"
FT   CDS_pept        complement(638314..639024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0567"
FT                   /product="flagellar hook capping protein"
FT                   /note="PFAM: flagellar hook capping protein; KEGG:
FT                   rfr:Rfer_3716 flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56351"
FT                   /db_xref="GOA:A1WFE4"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFE4"
FT                   /protein_id="ABM56351.1"
FT                   /translation="MIANATQAPQALPGTAAPQVATAAVAATAAPGMTGAKAQAVTDPS
FT                   AAQDRFLKLLVAQLNNQDPMNPLDNAQMTSQIAQINTVTGIQQLNQTMQRMAAQFDALQ
FT                   VMQGAALVGRSVMTEGSALSMAGKTGQGGFDLAQAATGVKVEIMTAGGQVLDSMDLGAQ
FT                   DAGRHEFSWDASHYAGATDGLQFRVTAANGAGALDATALSLSKISAVGAENGQLVLTLA
FT                   NGKNIGYSQIEALL"
FT   sig_peptide     complement(638944..639024)
FT                   /locus_tag="Veis_0567"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.258 at
FT                   residue 27"
FT   gene            complement(639063..639467)
FT                   /locus_tag="Veis_0568"
FT   CDS_pept        complement(639063..639467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0568"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgC;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: rfr:Rfer_3715
FT                   flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56352"
FT                   /db_xref="GOA:A1WFE5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFE5"
FT                   /protein_id="ABM56352.1"
FT                   /translation="MSMLSIFNLSGSAISAQAQRLNVVASNLANVDAVAGPDGQPYKAR
FT                   QVVFQTAPMGAPSAAGVRVIAISESQVPGRRVHDPGHPLADAQGYVTHSNVNAVQEMVD
FT                   MISAARSYQNNVEVMNTAKSLLLKTLQLGQ"
FT   sig_peptide     complement(639411..639467)
FT                   /locus_tag="Veis_0568"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.810) with cleavage site probability 0.742 at
FT                   residue 19"
FT   gene            complement(639500..639925)
FT                   /locus_tag="Veis_0569"
FT   CDS_pept        complement(639500..639925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0569"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgB;
FT                   PFAM: flagellar basal body rod protein; KEGG: rfr:Rfer_3714
FT                   flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56353"
FT                   /db_xref="GOA:A1WFE6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFE6"
FT                   /protein_id="ABM56353.1"
FT                   /translation="MLDKMTGQLGFHGAALVLRAQRQRTIASNIANADTPGYAARDFKF
FT                   GDALREVAGMGSGLALRGAGSTDPRHIPLPALPGSASADRQGASGYAVQTAPSLDNSTV
FT                   DMDRERASFVDNAVRYETTLRFLNGRVKTMLGAIQGQ"
FT   gene            640182..641027
FT                   /locus_tag="Veis_0570"
FT   CDS_pept        640182..641027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0570"
FT                   /product="SAF domain"
FT                   /note="PFAM: SAF domain; KEGG: rfr:Rfer_3713 flageller
FT                   protein FlgA"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56354"
FT                   /db_xref="GOA:A1WFE7"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFE7"
FT                   /protein_id="ABM56354.1"
FT                   /translation="MPAHSRAHSRARFRPSFGRSASQPPMAPRSAGAALSALCLALLAL
FT                   AAGRAALAQAVADPAQELVPLTQRWLDEALLHNPPAGSLPSLAPAGSAPRPLRLQVSVG
FT                   ALDARLRLAPCARVEPYLPVGTQLWGRTRLGLRCVAGVSAWNVFLPIAIAAFGPAWVLT
FT                   RNVAPGALLTAEDATEAEVDWAAEPAPVLANPALWQGQVAARPLRAGQVLRQTMVRAPW
FT                   LFPAGAQVKVQVLGPGYAVVAAGQALSAGATGQMVRVRMDNGRIVSGMVNAAGTIDAGL
FT                   "
FT   sig_peptide     640182..640343
FT                   /locus_tag="Veis_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.751 at
FT                   residue 54"
FT   gene            641255..641590
FT                   /locus_tag="Veis_0571"
FT   CDS_pept        641255..641590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0571"
FT                   /product="anti-sigma-28 factor, FlgM"
FT                   /note="KEGG: rfr:Rfer_3712 anti-sigma-28 factor, FlgM"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56355"
FT                   /db_xref="GOA:A1WFE8"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFE8"
FT                   /protein_id="ABM56355.1"
FT                   /translation="MKIPTGQTPELPGALAPAEHAKPARNAAQWVAKDAPAAQAAPRAA
FT                   LPVTVSIAARALARSADIADASDDFDADKVHAMRAAIGQGQFHVDAQAVAHKMLANAQE
FT                   ILSRSRA"
FT   gene            641608..641982
FT                   /locus_tag="Veis_0572"
FT   CDS_pept        641608..641982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56356"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFE9"
FT                   /protein_id="ABM56356.1"
FT                   /translation="MSPQESLQAVEQLLDQVSAALLAADPSAVEKHGQALRDAAARCAQ
FT                   LLGHMAASRRGHSAAPWQPRIVAISHRLRLQREGLARLAALAERQLAGLLPPGTAAPTY
FT                   GAGPGAAAKPTLARIYHGAS"
FT   gene            642383..644092
FT                   /locus_tag="Veis_0573"
FT   CDS_pept        642383..644092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0573"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: rfr:Rfer_0773 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56357"
FT                   /db_xref="GOA:A1WFF0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFF0"
FT                   /protein_id="ABM56357.1"
FT                   /translation="MLTAKDELLAALAAELQALCAGAGAKAALESPKVAAHGDFACTAA
FT                   LQLAKTLHMNPRQMAEKLRSALLATPAFQRWVSDIDIAGPGFINIRLKPAARQAVVSEV
FT                   LAAGAHFGCQPPNGQRVLVEFVSANPTGPLHVGHGRQAALGDAICKLFATQGWQVHREF
FT                   YYNDAGAQIQTLAHSTRLRAKGFKPGDACWPTDPDDPASRGFYNGDYIQDIANDFLAQK
FT                   TVQADDRSFTASGDVDDLESIRQFAVAYLRNEQDKDLRAFNLQFDEYYLESSLYTSGRV
FT                   EAAVNRLIANGKTYERDGALWLRSTDYGDDKDRVMRKQDGSYTYFVPDVAYHIAKWERG
FT                   YAKVVNVQGTDHHGTIARVRAGLQAADVGIPPGYPDYVLHTMVRVVKGGQEVKISKRAG
FT                   SYVTLRELIEWTSRDAVRFFLLSRKPDTEYSFDVDLAVAQNNDNPVYYVQYAHARICSV
FT                   LRSWADQGGGDMAVLRAADLSLLDDPQAQALMLQLGKYPAMLTAATASQAPHDVSFYLR
FT                   DLAASYHGYYDAQRILVADERVKHARLALVSATAQVLHNGLAVLGVSAPARM"
FT   gene            644096..644773
FT                   /locus_tag="Veis_0574"
FT   CDS_pept        644096..644773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0574"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   rfr:Rfer_0774 sporulation related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56358"
FT                   /db_xref="GOA:A1WFF1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFF1"
FT                   /protein_id="ABM56358.1"
FT                   /translation="MNSTQRATQQTQTGGTIVGFIVGVIVGLGIGLAVTVKVTGVPVPF
FT                   LNKGNGRGADSDAAESRKNRDWDPNSPLYGKNPVRPPAPAASGAAPTASAAEAASAAVQ
FT                   MPSPAAVTAAAPRPTASQPEAKAKAPADSRPGADPFDYFVQAGAFRTQADADTQRAQLA
FT                   MLGWEARVSEREQNGRAVFRVRIGPFSKRDDAEQLKEKLDSAEVESTLVRVQRQTAPGS
FT                   ARD"
FT   gene            644833..645504
FT                   /locus_tag="Veis_0575"
FT   CDS_pept        644833..645504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0575"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: pol:Bpro_4488 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56359"
FT                   /db_xref="GOA:A1WFF2"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFF2"
FT                   /protein_id="ABM56359.1"
FT                   /translation="MKRREFSLSAAAVLATGTLSKPALAQARQFREGRDFRRLGTPVTP
FT                   DAPAGKVEVIEFFWYSCPHCHAFEATLSAWAKTAPKDMHLRRMPVAFNSSFVPQQKLFY
FT                   ALEGMGKLGEMHTKVFRAIHEEKQKLDKDQDILAWAGKQGLNAAKFKEFYNSFNVSNQA
FT                   RRATQLQDIYGVEGVPAMGVAGKFYTDGQMTGGGLQTVLQVVDYLVAMSRTPSSPAPDK
FT                   P"
FT   sig_peptide     644833..644910
FT                   /locus_tag="Veis_0575"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            645650..646303
FT                   /locus_tag="Veis_0576"
FT   CDS_pept        645650..646303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0576"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: rfr:Rfer_0776
FT                   OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56360"
FT                   /db_xref="GOA:A1WFF3"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFF3"
FT                   /protein_id="ABM56360.1"
FT                   /translation="MTPGLLSLFLLAALAGSSGRVHAEKADRTQPMNIEADALRHDEPT
FT                   RTSVFSGHVVLTQGSIVLRGARLEMRQDADGHQHGLVTAEAGKRAFFRQKRDRPVGAPE
FT                   EFIEGESERIEYDGKADTVRLSTRAELRRYRAALLSDQITGAVIVYSHLTEVFTVDGQP
FT                   SAPAGNAAEAAPAPAGRVRAVLAPKNPPPAAAAAPAAPASAPVLRPDNSLGSPR"
FT   sig_peptide     645650..645721
FT                   /locus_tag="Veis_0576"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            646315..647085
FT                   /locus_tag="Veis_0577"
FT   CDS_pept        646315..647085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0577"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_4486 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56361"
FT                   /db_xref="GOA:A1WFF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFF4"
FT                   /protein_id="ABM56361.1"
FT                   /translation="MLVDGPATEVESRLEAWHLAKSYGNRKVVKDVSLVVQKGEVVGLL
FT                   GPNGAGKTTSFYMLVGLVRSDAGDIRIDGQSVARMPIHRRSRLGLSYLPQEASIFRKLS
FT                   VEENVRAVLELQRAADGQPLARETIEERLTELLQELRVAPLRASAALALSGGERRRVEI
FT                   ARALATQPRFILLDEPFAGIDPIAVIEIQRIIGFLKARGIGVLITDHNVRETLGICDHA
FT                   FIISDGRVLAQGTPSQIVDNAEVRRVYLGEHFRM"
FT   gene            647085..648665
FT                   /locus_tag="Veis_0578"
FT   CDS_pept        647085..648665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0578"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor, core-binding region;
FT                   sigma-54, DNA-binding domain protein; KEGG: rfr:Rfer_0778
FT                   sigma-54 (RpoN)"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56362"
FT                   /db_xref="GOA:A1WFF5"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFF5"
FT                   /protein_id="ABM56362.1"
FT                   /translation="MKPGLSLRVSQHLTLTPQLQQSIRLLQLSTLELTQEIEQMLDENP
FT                   FLERMSDEAPREEFGLDSADTPAQADDYSADEVLFSAATGSSAEALPDADTPGSAADEP
FT                   DWGGDGSVEMAPSDAEWGGDAPASQHNDAEGDGIEATELAQSEESLAAFLHRQALALRL
FT                   SEIDRAALYFLIESLNDDGYLEDSLEELASALAGPQNPEQIEELVHRFTVAQRLLQSLE
FT                   PVGVGARNLAECLTLQLNALARERAPAADPQTVQTALRICQQPLQMLARRDLRRLTQVC
FT                   GDSQEGTRAAMALIARLEPHPGRRFANVQRNVIVPDVIVRKTGRANGRDGRQHFIVQIN
FT                   PDVLPRLRVHDIYAGALRGHRGGAGHQGMQQRLQEARWFIKNIQQRFDTILRVSRAIVE
FT                   RQKNFFTHGELAMRPLVLRDIADELGLHESTISRVTTAKYMATPIGTYELKYFFGSGLG
FT                   TETGGNASSTAVRALIRQFVAAESQAKPLSDSQLADLLKEQGIECARRTVAKYREALKI
FT                   APANLRRTL"
FT   gene            648665..649957
FT                   /locus_tag="Veis_0579"
FT   CDS_pept        648665..649957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0579"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   KEGG: pol:Bpro_4484 putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56363"
FT                   /db_xref="GOA:A1WFF6"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFF6"
FT                   /protein_id="ABM56363.1"
FT                   /translation="MNPLPLFLPCAAGVENYLADEVHRITGLTGQDLLIGRGGVLLQAS
FT                   WRDALRLNLHSRMAQRVLVQLAQRPCRSENDLYAAASDVAWEQWFTARQSFKVEVTAQH
FT                   SPLPSLNYAGLKIKDAVADRFRAKSGMRPDVDTRRPDVRIHLHLAADQATLYIDTSGEP
FT                   LFKRGWRADTGDAPLKETLAAAMLAASGWDPLGQQPTPLYDPCCGSGTIAIEAAQIACR
FT                   IPAGLLRRFAFEQLLPFQAPVWTALKDQAHSAIQPGSVPIFGSDVAFRMIDFALHNAER
FT                   AGVAAALRLRGGDALQRQPPCAAPGLMLLNPPYGERMAAAGSAGRNAHERAAERARGAS
FT                   VGRQAAHTDTEGNFFGQLAAHWKQNYAGWTAWLLTPDPKLPGKMRLKESRRVPLWNGPI
FT                   ECRLLRFDIIEGSMRAPRAAAAPKAQNDHGA"
FT   gene            complement(649959..650264)
FT                   /pseudo
FT                   /locus_tag="Veis_0580"
FT   gene            complement(650375..650902)
FT                   /locus_tag="Veis_0581"
FT   CDS_pept        complement(650375..650902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0581"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: pol:Bpro_4476
FT                   CinA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56364"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFF7"
FT                   /protein_id="ABM56364.1"
FT                   /translation="MDRIQLSKKERSAQETLAPADCLAAISRCLIERGRMLATAESCTG
FT                   GMIAAACTDLAGSSQWFERGFVSYSNAAKTDMLGVPARLIEQHGAVSQAVACAMAEGSL
FT                   RHSRAQVSLAVTGVAGPTGGSAATPLGSVWFGWCVDGQTHSERQHFAGDRAAVRAATMR
FT                   HALQRLLDRLTA"
FT   gene            complement(650902..651429)
FT                   /locus_tag="Veis_0582"
FT   CDS_pept        complement(650902..651429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0582"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /EC_number="3.1.3.27"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   pol:Bpro_4475 phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56365"
FT                   /db_xref="GOA:A1WFF8"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFF8"
FT                   /protein_id="ABM56365.1"
FT                   /translation="MTNPMTSPAPRPALRPAWRFLLAHPAHCIALGFGAGLAPKGPGTI
FT                   GTLWAWLAYLVLQQWLSQRQIGLLIAASTVVGWWACTTTARHLRVADPGCIVWDEVVAF
FT                   WLVLWLAMPMGWSGQLLAFLLFRVLDATKPGPVGWAERQFKGLGWRGGWGILWDDFVAA
FT                   FCTLLALALWRF"
FT   gene            complement(651426..652442)
FT                   /locus_tag="Veis_0583"
FT   CDS_pept        complement(651426..652442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0583"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="KEGG: pol:Bpro_4471 thiamine-monophosphate kinase;
FT                   TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56366"
FT                   /db_xref="GOA:A1WFF9"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFF9"
FT                   /protein_id="ABM56366.1"
FT                   /translation="MGEGMGEFELIARYFTRPVRRAALGVGDDCALLLPAAGMQLAVSS
FT                   DMLVAGRHFFADVAPHRLGHKALAVNLSDLAACGARPLAFTLALALPRIDEPWLEGFAR
FT                   GLLALADAHGCELVGGDTTQGPLNICITVFGEVPAGQALLRSNARPGDDIYVSGNLGDA
FT                   RLALLALQGQLALPAERLERARQRLEQPAPRLALGQALRGIASSAVDISDGLLGDLGHI
FT                   LQASGVGARIDTRSTMGLIAESAYETCATCAGSPLDPELIQQCTLAGGDDYELAFTAAP
FT                   ALRAAVAAAAQASATPVTRIGLVQARPGLRLVDAQGQPVRQRYASFDHFASPASAPS"
FT   gene            complement(652460..653584)
FT                   /locus_tag="Veis_0584"
FT   CDS_pept        complement(652460..653584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0584"
FT                   /product="uncharacterized enzyme"
FT                   /note="TIGRFAM: uncharacterized enzyme; PFAM:
FT                   glutamate--cysteine ligase, GCS2; KEGG: pol:Bpro_4470
FT                   enzymatic protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56367"
FT                   /db_xref="GOA:A1WFG0"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1WFG0"
FT                   /protein_id="ABM56367.1"
FT                   /translation="MGLEAFSRSAPLTLGVELELQLVNTNDYDLAPYADDMLRLMKKTP
FT                   LPGSVVPEMTNSMIEISTGICHSCSEVLGQLTPIRDALVKSADKLNIAVLGGGTHPFQQ
FT                   WHERRIYDKPRFRELSELYGYLSKQFTIFGQHVHIGCPDANAALLMLHRMSRYIPHFIA
FT                   LSASSPYVQGQDTAFDSARLNSVFAFPLSGRAPLALTWEDFGAYFDKMTRTGVVRSMKD
FT                   FYWDIRPKPEFGTIEIRVFDTPLTIERAAALAGYVQSLGAWFLADQPFMPAEDDYLVYT
FT                   YNRFQACRFGLEAVYVDPAAGGHMPLRQHILATMDEMASHAAAQGASSALHLLRTEVEA
FT                   GQNDARWLRERQREEQLLAEVCRQAAQRFRGLAL"
FT   gene            complement(653574..654836)
FT                   /locus_tag="Veis_0585"
FT   CDS_pept        complement(653574..654836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0585"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: pol:Bpro_4469
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56368"
FT                   /db_xref="GOA:A1WFG1"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFG1"
FT                   /protein_id="ABM56368.1"
FT                   /translation="MNEILLTFWAQWLRPSAGLPTVHWSLLLAMAALVGYLIQRHTGLP
FT                   KVVGYSLVGTLAGLAGFGGAVWPLQGIGLFLLELGAAIVLFECGARIPLRWFRHNPMVL
FT                   VQSIAESALSYFAVYWVLVWLNLPTQVAGPLALVALVASPAVLTRVVADTLAAGPVTER
FT                   AIVLTTLSTLYALTLGSASVQLANRPSLTLLEAVYPVVAVLGVSIVVAALLTLVLRVAL
FT                   RLMSPTSENTAMLFLALVAAGTAVAAHMGGSAPLAALLGGMLLKQINPRPWAWPRQLGN
FT                   ASSLLTMLMFVLVSTVAAQADWNAPVAGVVLALIAVRLLAKASGVALGNVGSGASWQQA
FT                   LWVGCAMTPMSSIALLIASQFVLAAPAAAGQVIASVALPAILLMEMSGAIIATVAIYRA
FT                   GESSIPWAPLARGHNGDSHGS"
FT   gene            complement(655026..655433)
FT                   /locus_tag="Veis_0586"
FT   CDS_pept        complement(655026..655433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0586"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: pol:Bpro_4467 ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56369"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFG2"
FT                   /protein_id="ABM56369.1"
FT                   /translation="MPKYQFDVQVQPQYLPEESAPDTGVFCFAYTITVTNTGQVPAQLI
FT                   SRHWIINDSGGLAEEVKGLGVVGRQPLLKPGESFQYTSGCRLHTASGTMHGSFHCVAED
FT                   GALFVTPVPLFVLEAIDHGLPDAPSGGRVLH"
FT   gene            655513..656193
FT                   /locus_tag="Veis_0587"
FT   CDS_pept        655513..656193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0587"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   rfr:Rfer_0532 ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56370"
FT                   /db_xref="GOA:A1WFG3"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFG3"
FT                   /protein_id="ABM56370.1"
FT                   /translation="MSRKFRITPSILAADFARLGEELRAVIAAGADWIHFDVMDNHYVP
FT                   NLTVGPMVCQALKPHAQTASGAAVPIDVHLMVAPVDALAAAFADAGADGISFHPDASPH
FT                   VHRSIQAIRAKGIETGLVFNPAEPLDVLDWVIDDIDLILIMGVNPGFGGQGFIDSALRK
FT                   IEAARKRIAASGKDIRLQVDGGIKPDNIRRVADAGADTFVAGSAIFGQPDYRQAIAALR
FT                   GQLG"
FT   gene            656539..656742
FT                   /locus_tag="Veis_0588"
FT   CDS_pept        656539..656742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0588"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: pol:Bpro_2271 membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56371"
FT                   /db_xref="GOA:A1WFG4"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFG4"
FT                   /protein_id="ABM56371.1"
FT                   /translation="MPFFIGAVIIAHMLGAGQTLLDILALVYVMLRIAYVGLYVADMPT
FT                   ARSAVWAGGFLANSAIFLIGYR"
FT   gene            657040..658107
FT                   /locus_tag="Veis_0589"
FT   CDS_pept        657040..658107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0589"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: pol:Bpro_2272 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56372"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFG5"
FT                   /protein_id="ABM56372.1"
FT                   /translation="MSPVAMTLPAPGRRAFGTACALSAAVVFAPAVMRTRPGAAGLGRV
FT                   TVAVGGQGVLYHLPLALADCLGYFRAEGLEVVVRDFSAGAQARQAVLRGAADVYSGAFE
FT                   HIFRAQASGQACRALVLQGRAPQLALGVSLRALPGYRDPGDLAGRHIGVSSIGSSTHLA
FT                   ASLLLLRSGVALRHVAFVGVGSGAQALAALRSGQVQALCHADPIMTLLEQRQDTRIIGE
FT                   LRSLKAAQDMFGASMPAGSLCAPQAFIEQQPAQAQALVNGIVHALKWLHTAAPADLVKA
FT                   VPAAYLLGDQGLYLAAFSRVRETYSTHGLMPDDGPATALRVLTHVQPQWAGAKLDPECA
FT                   YTNEFVHRARQKYDV"
FT   gene            complement(658198..659745)
FT                   /locus_tag="Veis_0590"
FT   CDS_pept        complement(658198..659745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_0590"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Peptidoglycan-binding LysM; Lytic
FT                   transglycosylase, catalytic; MLTD_N domain protein; KEGG:
FT                   pol:Bpro_2278 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABM56373"
FT                   /db_xref="GOA:A1WFG6"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A1WFG6"
FT                   /protein_id="ABM56373.1"
FT                   /translation="MTFLPLVRWAGLAGLLWLTGCTIPQTAPPQTAASAGKASGQDIAP
FT                   RQSPDPASPATAANPPNTAHTAHTPDIPDEPLQPITAVQASSGEVASLSAPADLWDRIR
FT                   RGFAMPDLQHALVQEREQWYAARPDYMQRMTERSSKYLFHIVEEIERRGMPTELALLPY
FT                   IESAFNPQAISSAKAAGMWQFMPATGNYFDLKQNAFRDDRRDVLASTRAALDYLQKLYT
FT                   MFGDWHLALAAYNWGEGRVARAIARNQKQGLGTGYTDLSMPAETRLYVPKLQAVKNIVA
FT                   HPEAFDTELPLIENHPYFQTVDIPHDIDVALVATLAGVREADFRALNPSLHRPVILAAG
FT                   TPQILLPWDNAKLFQHNLQAHRAGQYASWTVWTVPATMSVAEAAQRTGMSESELRSLNQ
FT                   IPPRMRIKAGSALMVPRSGASQDVSSHLADNGQLGLTPEPVTRRTTVRAGKGDTVASIA
FT                   RRYKLAAASVARWNGVRAHAAFKTGQSVVVYLPVRQARGKRQATSARRPRVSTANAR"
FT   sig_pepti