(data stored in ACNUC7421 zone)

EMBL: CP000543

ID   CP000543; SV 1; circular; genomic DNA; STD; PRO; 31194 BP.
XX
AC   CP000543; AASQ01000000-AASQ01000056;
XX
PR   Project:PRJNA17187;
XX
DT   10-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Verminephrobacter eiseniae EF01-2 plasmid pVEIS01, complete sequence.
XX
KW   .
XX
OS   Verminephrobacter eiseniae EF01-2
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Verminephrobacter.
OG   Plasmid pVEIS01
XX
RN   [1]
RP   1-31194
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Chertkov O., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Stahl D., Richardson P.;
RT   "Complete sequence of plasmid pVEIS01 of Verminephrobacter eiseniae
RT   EF01-2";
RL   Unpublished.
XX
RN   [2]
RP   1-31194
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Chertkov O., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Stahl D., Richardson P.;
RT   ;
RL   Submitted (21-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 64862302d4a3b159277f710d67e8ee20.
DR   BioSample; SAMN02598379.
DR   EuropePMC; PMC2988606; 20935126.
DR   EuropePMC; PMC3067460; 21296948.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001428
CC   Source DNA and bacteria available from David Stahl
CC   (dastahl@u.washington.edu)
CC   Contacts: David Stahl (dastahl@u.washington.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   NOTE: There is a polymorphism related to the plasmid. The longest
CC   plasmid is 31194 bp, but some shorter forms are present as well.
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..31194
FT                   /organism="Verminephrobacter eiseniae EF01-2"
FT                   /plasmid="pVEIS01"
FT                   /strain="EF01-2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:391735"
FT   gene            130..1227
FT                   /locus_tag="Veis_5016"
FT   CDS_pept        130..1227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5016"
FT                   /product="Zeta toxin family protein"
FT                   /note="PFAM: Zeta toxin family protein; KEGG:
FT                   bch:Bcen2424_6819 zeta toxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5016"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60702"
FT                   /db_xref="GOA:A1WSU5"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSU5"
FT                   /protein_id="ABM60702.1"
FT                   /translation="MADYKPLTDKEIRDTAGAHYAERQAKSLPQEQPAIVLVGGQPGAG
FT                   KSAASSMVKAELAMQGGYVHVDADRMRERIRVGNSKPTSEQTQADAGRLVATLRDQAIQ
FT                   GRRNIVEEGTFRSPDGAGKFVQGLQERGYKVELFAMATSREESLLGIYQRHELQHAAGG
FT                   ANPRFVSEKYHDEAMQGFESTLARTAVQLDRVRVADRSGAVLYDSAIQTNKQPNALEAL
FT                   AAGRKLSDNKLAEVTKAWGAVEAVARQRGAPGGYLEAVSGHAQRLEDMQKERIHGHAMN
FT                   QLDANAATLARDARYAQHTGGELAKAAYFRGFHEKASEFKGIAPDFAKYDATVANRQTL
FT                   RQLPDVSDLAGRAMPRQRANDGNSL"
FT   gene            complement(1222..2355)
FT                   /locus_tag="Veis_5017"
FT   CDS_pept        complement(1222..2355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5017"
FT                   /product="Relaxase/mobilization nuclease family protein"
FT                   /note="PFAM: Relaxase/mobilization nuclease family protein;
FT                   KEGG: bbr:BB0493 plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5017"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60703"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSU6"
FT                   /protein_id="ABM60703.1"
FT                   /translation="MSAFDPLDGWFEKGFRVRSQKAARTAKRDQIRARSGTSPASTSGM
FT                   QFSANAKAKNTASVIRKAPEVMVKITGSSSGLATVKHHLDYISRNGEVELTNESGESIQ
FT                   GRDELRALREQMKASQVPDESNKREYLHVLFSMPAGTPEKAMREAVAQFCQEEFANRRY
FT                   VAAFHDDTDHTHMHVCVGTRDIDRADEPRLSPRKADLFRWRQGFADKLRENGIDAAASE
FT                   RRHRFNHRKPEHPVVRQIRADNPKSDAYNERRAKDKALDRTMKATARPETAFVGPLRPP
FT                   RVPKVHEALKSELQAALKAGARPTNPAEAKIAETKAKTLATWGQVAKNLEAAGQADLAK
FT                   SVAALMRDADKSTSSRTQELFDLAKARGKGKDTGQEL"
FT   gene            complement(2689..3975)
FT                   /locus_tag="Veis_5018"
FT   CDS_pept        complement(2689..3975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XFa0017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5018"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60704"
FT                   /db_xref="InterPro:IPR040677"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSU7"
FT                   /protein_id="ABM60704.1"
FT                   /translation="MATTPEASDADMRNRLRGEPGVTPEDTRSELLQDGQDKALRDNLR
FT                   GEPGVAPEDTHSELLAAKAKEERKEQEADSMRQEREATARAWSEEQAKARAARDVADHA
FT                   DLVALGKRGEGDSFYLRTAFHAAAAKGEEAKPVITTGEQAAAVNKGLQDQLEDDLRRRK
FT                   AREQEQAGQGLNSVDVRRSGKELERGDFIVPRRITQAYTEMDGKFYAKDSNRVMFEDKG
FT                   EKLVTSTTNKEAVADMVAYAKAKQWDSLKLSGSQEFRREAWLQAESQGIKTQGYTPKQA
FT                   DLAALETLRQERSTNAITPLQERKAERETVREETTPAAPRHDLNKNQAAMHVEASKFIA
FT                   TNMQALQKQPGMADKSVEDLTKLAYWRGIVAEENKLQPKPVQDEAIARFDKQAVDPQFL
FT                   KRLNQVTEPKIKDKTTERVQKRDTHEQSL"
FT   gene            complement(3988..6264)
FT                   /locus_tag="Veis_5019"
FT   CDS_pept        complement(3988..6264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5019"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein; SMART: phospholipase
FT                   D/Transphosphatidylase; KEGG: xcb:XC_2413 putative NTPase
FT                   VagA"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5019"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60705"
FT                   /db_xref="GOA:A1WSU8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSU8"
FT                   /protein_id="ABM60705.1"
FT                   /translation="MSKKKIAIAVLVLLLLAVASVFGMLYVTSGLLVKYLSLGDVTPHL
FT                   SLPFELAKFGAKKEKGFGVIALVASIGLPVLLFGLVGYAALTPKKRELHGSARFATRQE
FT                   LVKGGLLQPDQADDKYPSIVVGKQDKDFLLFRGQQFMFLAAPTRSGKGVGIVIPNLLHY
FT                   RDSVVVLDIKGENFEITSGFRAKCGQEVHKFAPDDENFQTACWNPLAYVRDDPRFRISD
FT                   LMGITNILYPPSDDVWASTAESLFLGLALYIMDTSKLHGSFNMATIKKMRVGLGCLKDE
FT                   EAFMAHVKERKPFEPLSEDCITHLRSFAQTSDKLRNSIGISFDQPLGIFSDPITAKATA
FT                   SNSFDMRDVRKKRMSIYVVVKPANIDKFGKFLNLFFQQLLVLNMDKLPQDDPSLKYQCL
FT                   LLLDEFPAMGRIAIIEKASAYMAGYNMRLLLVFQSKSQVKDRKLYDETGAQTMLTNMAL
FT                   QVVYAPRDDDDAKDYSEMIGYMTEKGLSKSRQLGAKSGRSESESDQRRAVMLPQEVKAI
FT                   GMAKEIISMENMPPALVDKIFWYQEPIFQARANLPQPAVPDQSELLNTIEPAPPSPVLH
FT                   FAGAVEEQALPTGATFEVGFSPKRNALEVVMSFVLGAKTELLVAAYSFTSKDIAFALVE
FT                   AKARGIDVRVVVDHAQNTDDQGGYKAVDYLSSQGIPVFRCENYAAMHHKFMVADGLHVQ
FT                   LGSFNYTSSANLRNAETAVAFRNAPELASVYRTEWLRLSTEPKASVETVMAVDRGLAIL
FT                   KEFGI"
FT   sig_peptide     complement(6193..6264)
FT                   /locus_tag="Veis_5019"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.687 at
FT                   residue 24"
FT   gene            complement(6261..7304)
FT                   /locus_tag="Veis_5020"
FT   CDS_pept        complement(6261..7304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5020"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   psp:PSPPH_B0036 conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5020"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60706"
FT                   /db_xref="GOA:A1WSU9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSU9"
FT                   /protein_id="ABM60706.1"
FT                   /translation="MSLTLLSEAVLKPISRVDRSLSVRELMRKFGISEALMANITEFAI
FT                   NRPGSYWIEDSAGWREVPNESLSLSNLQGLATAIAVFNQKKLDRDNPIASLTLPDGERC
FT                   QIVLPPACEDGTVSMTIRKPSTSRFSLANYADSGRLKPVLAGLSEEIQPWEAELLRLAQ
FT                   QGEFVRFFELAVEHHLNIVTVGGTGSGKTTFSKCLIDLYPASRRLFTIEDAHELTTPKH
FT                   PNSVHLFFSPTITAKAVLSSCMRMKPDHLFITELRGDETWDYLMALKSGHSGSVTSIHA
FT                   NDCRGALYKIGSYIKQSEVGQTLDFDYIMQEVVTTIDVVVFFEKTHLKELYFDPVKKLQ
FT                   LLRGRAS"
FT   gene            complement(7282..8634)
FT                   /locus_tag="Veis_5021"
FT   CDS_pept        complement(7282..8634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5021"
FT                   /product="conjugation TrbI family protein"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   xfa:XFa0014 conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60707"
FT                   /db_xref="GOA:A1WSV0"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSV0"
FT                   /protein_id="ABM60707.1"
FT                   /translation="MSETTDFTNVGALPTLDTEPEVLGEPTSKAKSKTNVGKFAILGLV
FT                   LVGFLFIVAGLLFYQKHKRANATVETPAKTAPVKPEFASKNAAVESDLIEKAKAEIKKK
FT                   EEEDQAQIKAVEEAQAQAKAQAAAEAAKRGQGGFGQADGQQRGGQYSGGQAQQGNQPPP
FT                   PPTPMERKMAGGVLLDSKGAKPKADAQLSEKEQQQREVQARMAAAGVTPGGGQGFNGGT
FT                   GLQLAPGGQGGGADGLAARLQPTVLQARWAGKLPNLDYLLKRGTTIPCALKTGIDTTLP
FT                   GFVICKVLNNVYSANGKVLLVERGADVFGEQQSQLKQGQERTFVVWTRIDNPNGVFANI
FT                   DSPATDQMGYSGIPGYVDTHFWQRFGGAIMLSLIKDFSQAYSQRVANSSNTGATAAQPY
FT                   SNTNQATQDMAAEALRNSINIPPTLVVLPATIVNVMVARDVSFENVFNVVE"
FT   gene            complement(8631..9428)
FT                   /locus_tag="Veis_5022"
FT   CDS_pept        complement(8631..9428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5022"
FT                   /product="Conjugal transfer protein TrbG/VirB9/CagX"
FT                   /note="PFAM: Conjugal transfer protein TrbG/VirB9/CagX;
FT                   KEGG: xfa:XFa0013 conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5022"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60708"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSV1"
FT                   /protein_id="ABM60708.1"
FT                   /translation="MKKLIALVLACVASLAHADDPRIRTEIYDKSVVYNVHTQIGRASL
FT                   IQLEEDESLVISPSSVLGIGDADAWNLGVRGNNIVLKPTQNMPQTNVVVVTNKRTYSFE
FT                   LQATAKDSMPTYILRFRYLDTEAAKAAAEAAAEAKRVQITAAARAEKTVINTDYVWRGD
FT                   NELLKPTAAYDDGRFTRLVYDHSGELPVFFKVLPDGTEALLNSNVDPDHKQTVVLHEVI
FT                   RTVRARMGDQVIEIINRAYTLPKFNETGTSVPGAVRVDKGTQP"
FT   sig_peptide     complement(9372..9428)
FT                   /locus_tag="Veis_5022"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            complement(9425..10141)
FT                   /locus_tag="Veis_5023"
FT   CDS_pept        complement(9425..10141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5023"
FT                   /product="VirB8 family protein"
FT                   /note="PFAM: VirB8 family protein; KEGG: bbr:BB4899
FT                   putative bacterial secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5023"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60709"
FT                   /db_xref="GOA:A1WSV2"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSV2"
FT                   /protein_id="ABM60709.1"
FT                   /translation="MTIKEKPTPKKAAKPARFPQNFAEAAADFEKSKIQEIKRSRKIAW
FT                   IIAMVSTAICSVSILAFLVALLTRTEPEPTILQVDKSTGATTVLRSVRDTKDQYDEVVN
FT                   KYWLAQYVRTCEGYDWFTISEQFEACKLMSDGDVAKEYSRKVQAPGSPLSVLKDKGKVV
FT                   VKITSIAFFGETAQVRFTSEKLSASGENVDNSPLQKWIATIAFQFKPGMMTEQQRLVNP
FT                   LGFKAATYRVDPEVIK"
FT   gene            complement(10145..11128)
FT                   /locus_tag="Veis_5024"
FT   CDS_pept        complement(10145..11128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5024"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /note="PFAM: TrbL/VirB6 plasmid conjugal transfer protein;
FT                   KEGG: xfa:XFa0011 conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5024"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60710"
FT                   /db_xref="GOA:A1WSV3"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSV3"
FT                   /protein_id="ABM60710.1"
FT                   /translation="MDEAAPITWLVGEINKIVSSGAGSAASAIATAVTPLAAVGFGIYI
FT                   ILICINYMRGAETEPVIDFGVRCAGFAVIIGLGLNAANYTSTVIPIVTGVGSDLASAVS
FT                   GGSASAGTLDQLALHYLKILDDGYESASSSGFPWNAGSMLLYFMKYTCILVGLIPFLVA
FT                   ATIAIIIADVGSVLVAMIGPLFFAFLIFPATRQYFSAWLNTALSYALIPVFVAVIATIS
FT                   VGLSKTMLSGSGSLDDVSLKAVFLASMGNLTLLFLLKQVSALASSLSAGGINASMPGSI
FT                   GTLVSAIKGSAKDIKAMQAGYRATKADGQAVGRWAANKFNSIRKAG"
FT   gene            complement(11420..12085)
FT                   /locus_tag="Veis_5025"
FT   CDS_pept        complement(11420..12085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5025"
FT                   /product="type IV secretion system family protein"
FT                   /note="PFAM: type IV secretion system family protein; KEGG:
FT                   bbr:BB0491 plasmid-related exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5025"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60711"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSV4"
FT                   /protein_id="ABM60711.1"
FT                   /translation="MDLKGILKTTRAASGALVVVFAGAAQAQIPVTDVAHISTSIKNQV
FT                   ESIAKWGLQFSQLQQQIQQYQQQYAAITGPRGMGALLDNSSLKAALPADWQQVLSDVKK
FT                   TSAYINERKKYPTLSALPKANALYDVIASQNAVMGDLYGKANNRLSLIQSLNAQIDSAN
FT                   DPAAKADLANRLISEQNAIQANQNLVTILQQKHRQEIEEAALQATKENTCKEFKRSGC"
FT   sig_peptide     complement(12002..12085)
FT                   /locus_tag="Veis_5025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(12088..14502)
FT                   /locus_tag="Veis_5026"
FT   CDS_pept        complement(12088..14502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5026"
FT                   /product="CagE, TrbE, VirB component of type IV transporter
FT                   system"
FT                   /note="PFAM: CagE, TrbE, VirB component of type IV
FT                   transporter system; KEGG: bxe:Bxe_A1756 putative type IV
FT                   secretion system protein VirB4/TraE"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5026"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60712"
FT                   /db_xref="GOA:A1WSV5"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSV5"
FT                   /protein_id="ABM60712.1"
FT                   /translation="MLSAILKKQFAGEEQLPPYNYHVRDTIVSLEDGRVAFILKAKSLP
FT                   FEVTSDKVLENQYDGLNGLLLSIAKSTGSRLAVWAHLDHYQTEFKTDYRFGYEWMRLFS
FT                   AKYMAKFEGTDIFENDFYLTFILKPGMNDNLEECIRELEEIQLSVTQTVAPYECEVLSM
FT                   YEHDGNQFSQFYEFIAYLYNGFWERVPVTSLPLFQAVQTSALHHGYKLLETRFPDGGNR
FT                   YSAFFDLKDFPDPTTRGKFNPLLELPFPFIMCLSFTFINTADSIRMINQSLNKMESAGD
FT                   EAVEQMDDMSLGKGAIMSGQVYFGELHGALAVYGKTEKQTEDRGATARTTLSGSCATQF
FT                   VPATISAPETFFSMFPGNVKRRPRPMPKTTRNLLGLFSMNTYSSGKQYGNPLGDGSAVM
FT                   PLQTTVHGVYHFNFHYSLPELDSRGEKRAGHTVILGATGAGKTTLQTTLLTFLGRLDNK
FT                   LFAVDKDGSMRGFIEAVGGTYFRLASGEPTGLNPFQLPDTPQNRNFLYDLVGACGRKAG
FT                   QEGTAEDTKDIKRAVDNVFELPFEQRRFGVLLQSIPDRGENCLARRLADWCYGEVDGRY
FT                   AYALDNPQNNFDWEGFKRVGFDVSDFLVAGHPATEPILAYLFHLKTLMQRDGALLATVV
FT                   EEFWLPLQYPTTADQILDSLKTGRRRGEFIVLVSQSPEDVIRSPLLPAVLQQTPTKIYL
FT                   PNPDAEYTTPDGGGYSRFGLTTKEFQKLKKLGLQSRMFMVKQGSQSSLAKLDLNGMGDD
FT                   IAVLAMDAEDFKYLDAAKAQAGTHPDQWVPLYKVLRKKGREKVSQPATVKE"
FT   gene            complement(14465..14848)
FT                   /locus_tag="Veis_5027"
FT   CDS_pept        complement(14465..14848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5027"
FT                   /product="type IV secretory pathway, VirB3 family protein"
FT                   /note="PFAM: type IV secretory pathway, VirB3 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5027"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60713"
FT                   /db_xref="GOA:A1WSV6"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSV6"
FT                   /protein_id="ABM60713.1"
FT                   /translation="MTDEQPPEKYISYNGLGRSPMIWGIPYMVGLAIMCLSLIGGLLLG
FT                   TFVGGLGWLFALIGVPVALFVKMLCANDDKAIQILMLEVKWSILKALSGNAKYHGGTMA
FT                   IAPTTYGRKLKNVKRYFKKTVRG"
FT   gene            complement(14853..15161)
FT                   /locus_tag="Veis_5028"
FT   CDS_pept        complement(14853..15161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5028"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60714"
FT                   /db_xref="GOA:A1WSV7"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSV7"
FT                   /protein_id="ABM60714.1"
FT                   /translation="MNRIFNPLIAQHRKVAAAVAIAAASSNALALGGLDKAKTAADDIK
FT                   TGLYALVGVVALTYLIYLGVMAFTEKKSWADFGWGVVYVSLVGGAVALGSWAWTLFA"
FT   sig_peptide     complement(15069..15161)
FT                   /locus_tag="Veis_5028"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 31"
FT   gene            complement(15164..15622)
FT                   /locus_tag="Veis_5029"
FT   CDS_pept        complement(15164..15622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5029"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60715"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSV8"
FT                   /protein_id="ABM60715.1"
FT                   /translation="MAVVVALSSAALADPPPAAQAQAAQPFQATKAVAAPAAATPQSIA
FT                   VQQRVDQLAILTQERNEILAKLNKLEANGDKAVLARIQADLQSIDREIARASRQPIYPT
FT                   SSVATTQVASAKPVSAAPTANQESQAQESEKVTYEGWDIFKNFGRKGN"
FT   sig_peptide     complement(15557..15622)
FT                   /locus_tag="Veis_5029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.576 at
FT                   residue 22"
FT   gene            complement(15680..16042)
FT                   /locus_tag="Veis_5030"
FT   CDS_pept        complement(15680..16042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5030"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60716"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSV9"
FT                   /protein_id="ABM60716.1"
FT                   /translation="MAENQFTKGDTLPPGIEADPLAKAFVYRMSRDALMIVTNLHRVRD
FT                   LPCMDMLAKIDAHLENPLHLLVKDGQKPHSGANFTPAGRGRCYGATLEGDRLTITAPAK
FT                   GKGKGKGVADALKPDA"
FT   gene            16427..16888
FT                   /locus_tag="Veis_5031"
FT   CDS_pept        16427..16888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60717"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSW0"
FT                   /protein_id="ABM60717.1"
FT                   /translation="MLVFIKGSRAKHERVKRHYGLVNQAHDQAVELGMLDKASIAVGKP
FT                   TKKALEALEDAGSTLALAHEFQARQRAIKTKEKALFEQGHELRNQKARAEQQQAQAAMA
FT                   QKQVQELRQQLEAEASAGRPRPTSWPPPTGRAGISPLTSCGRSVATAWS"
FT   gene            complement(16952..17269)
FT                   /locus_tag="Veis_5032"
FT   CDS_pept        complement(16952..17269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5032"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: stm:STM4529 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5032"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60718"
FT                   /db_xref="InterPro:IPR025528"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSW1"
FT                   /protein_id="ABM60718.1"
FT                   /translation="MKTKTVRYEVDLANLPPLTSAQQAEIKALAEMPDNAIDTSDIPPL
FT                   TDAFWKSAVRNPFYKPLKTSTTVRVDADVLAWLKAQGKGYQTRINAILRDAMIRSLHHE
FT                   N"
FT   gene            complement(17244..17561)
FT                   /locus_tag="Veis_5033"
FT   CDS_pept        complement(17244..17561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5033"
FT                   /product="protein of unknown function DUF497"
FT                   /note="PFAM: protein of unknown function DUF497; KEGG:
FT                   stm:STM4528 putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5033"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60719"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="InterPro:IPR038573"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSW2"
FT                   /protein_id="ABM60719.1"
FT                   /translation="MKIRFEWDPVKALANVSKHRVSFETAVRAFADPFALAEQDRIEGG
FT                   EYRWQTLGLVDAHLLLLVAHTVWEEEAEKDGTTVEVIRIISARRAEPFERRRYENQDRS
FT                   L"
FT   gene            17804..18193
FT                   /locus_tag="Veis_5034"
FT   CDS_pept        17804..18193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5034"
FT                   /product="plasmid recombination enzyme"
FT                   /note="PFAM: plasmid recombination enzyme; KEGG:
FT                   spj:MGAS2096_Spy1143 plasmid recombination protein, Mob
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5034"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60720"
FT                   /db_xref="GOA:A1WSW3"
FT                   /db_xref="InterPro:IPR001668"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSW3"
FT                   /protein_id="ABM60720.1"
FT                   /translation="MHGVLRRAQGTAHQLWLGGQGRDAYFNDALKWLRERHGGANVVYA
FT                   GIHRDETTPHMYAYVVPLDEATGRLNARKWLGGAKALSEMQTEFAQVVGAQHGLERGNK
FT                   EAQALGLACSLGQLVPCGCTQLRKR"
FT   gene            complement(18393..19295)
FT                   /locus_tag="Veis_5035"
FT   CDS_pept        complement(18393..19295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpp:plpp0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5035"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60721"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSW4"
FT                   /protein_id="ABM60721.1"
FT                   /translation="MWPVITSLSSSPSCTVTHTFELRGLSRHKRFPPTGYPPPFIPRSA
FT                   HPSLSWVPCHFLRRRTQRGDDLLTHKEHSVNTAKPNTQSGSESSNAMQVSNSKQAEVNT
FT                   LRKAFVGQKYEVKFTDDSLGAVAFLQVTEAGAVYMIGFSGKRAKPDFHYRFRSTKHADR
FT                   YQDSWHKGLVSRATAKAERKAEKAAKLSQPHSLEVGDVLVSSWGYEQTNYDYYQVTRLV
FT                   GKQSVEIRELAQQAAETGFLQGECVPVQGRFKGEPMVKRVNENGTVKVRSWGVWAYKKE
FT                   SIKVAGFEIFKPDNYTAYA"
FT   gene            19603..19884
FT                   /locus_tag="Veis_5036"
FT   CDS_pept        19603..19884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XFa0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5036"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60722"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSW5"
FT                   /protein_id="ABM60722.1"
FT                   /translation="MKPKLYQADKVAEVAKTLAEAPALPPKFIPHSDTLAELSKHIKDM
FT                   HFRKNYDARQIANILKENGIKTTIKEVRNMLQIASKRAPKNGDKRSYN"
FT   gene            20213..20818
FT                   /locus_tag="Veis_5037"
FT   CDS_pept        20213..20818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5037"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein; KEGG: lpn:lpg2573
FT                   transposase (resolvase, DNA invertase)"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5037"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60723"
FT                   /db_xref="GOA:A1WSW6"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSW6"
FT                   /protein_id="ABM60723.1"
FT                   /translation="MDKSTNETNSLRLGYARVSTDDQDMALQLDALAKVQCDRVFSEKV
FT                   SSGKASRPQLEECLRTLRRGDVLTVWRLDRLGRSMAELVAIVNDLASRGVTFESLTEHI
FT                   DTSSASGKFTFHLFSALAEFERNTIRERTKAGLVAARARGRMGGRPTKVTPKAKREMKA
FT                   LYTSQDVSVKDICTRYSITRSTFYRAVLERDYTTNGDA"
FT   gene            20815..21681
FT                   /locus_tag="Veis_5038"
FT   CDS_pept        20815..21681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5038"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_0930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5038"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60724"
FT                   /db_xref="InterPro:IPR010751"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSW7"
FT                   /protein_id="ABM60724.1"
FT                   /translation="MSNLELSLDNLRARQEANAQKSLLRQLQLPLWAETQRGVPNSLLR
FT                   SALFAAIQRGKRPFLKRQLMASVENASITYTGIRLCQDYLTVWECLVHVAREQQLGNRC
FT                   EVTTYQLLKLLDKKDTGGNRQVLRRQLAELQATALEVRQGRYTYSGSLIDEAYHDEETG
FT                   RAIIVLNQRIVALYQGDGYTKVSWQIRRDLRTSLAKWLHGFYATHRQPFPYTVAKLHEL
FT                   CGSNAKSLKDFEEKTLATALEDLATVAKSHGEHFRYLVERCPGGKSLVHVTRNPDAKLP
FT                   LNPQICG"
FT   gene            22397..22705
FT                   /locus_tag="Veis_5039"
FT   CDS_pept        22397..22705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5039"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_6604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5039"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60725"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSW8"
FT                   /protein_id="ABM60725.1"
FT                   /translation="MAARATNTKTRKKPGEAPSTRWPPAGQTAAELAEQKKAIQAAPAE
FT                   RDQARSELATVKAKAEAAAQEAHRVAERLTKAQGERDQARTRCRRDPRRIGENQGPA"
FT   gene            22864..23502
FT                   /locus_tag="Veis_5040"
FT   CDS_pept        22864..23502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5040"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCVc0027 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5040"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60726"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSW9"
FT                   /protein_id="ABM60726.1"
FT                   /translation="MKLSRVLATFSVSFAATFSSAAHADDWGCEVLLCLSNPAGPMAVS
FT                   QCVPPIKRLYAAIFKWKPDPFPTCTMATSQNGTRSYASVEYNNYYEPCPAGTSALSSGS
FT                   NAVQGTPAQVQAQNNAGWWGNGPFTSFSVGIGDGAGLYPSEDKPLGKKVCVGNAVGTVN
FT                   VTVGSNWEDRTTYQVGVYDRVAFIDQSLNGFAIKVFINNNLYRTIRPQL"
FT   sig_peptide     22864..22938
FT                   /locus_tag="Veis_5040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            23502..23768
FT                   /locus_tag="Veis_5041"
FT   CDS_pept        23502..23768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60727"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSX0"
FT                   /protein_id="ABM60727.1"
FT                   /translation="MQLGEGNDAGIELKARDSINGRTQTFTVSTAGVDSVERGDGYADL
FT                   EASPETLEAYQAFEAARGVPLHDMLARLQRLLKGAEAWHKHNP"
FT   gene            23747..23959
FT                   /locus_tag="Veis_5042"
FT   CDS_pept        23747..23959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5042"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL2528 DNA cytosine methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5042"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60728"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSX1"
FT                   /protein_id="ABM60728.1"
FT                   /translation="MAQAQPLMNSPTPVEVWAARERSGLTQTEAAALVHGTLRAWQGWE
FT                   APEGEPAARRMHPGLWELFQIKTKA"
FT   gene            23962..24339
FT                   /locus_tag="Veis_5043"
FT   CDS_pept        23962..24339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5043"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60729"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSX2"
FT                   /protein_id="ABM60729.1"
FT                   /translation="MGGKTAIRRGGAVLASLLICVIEPAGAASLVGGQTDDSVCDLGSA
FT                   PQNARKLSAAGDFIRAQCKNGQVLVGSGIVPVGGFDSEVVRQARTFCRLVDIQTRRIQG
FT                   NMAGLVMEIDEVRCTIGKLPT"
FT   sig_peptide     23962..24045
FT                   /locus_tag="Veis_5043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.984 at
FT                   residue 28"
FT   gene            24397..24918
FT                   /locus_tag="Veis_5044"
FT   CDS_pept        24397..24918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5044"
FT                   /product="MobA/MobL protein"
FT                   /note="KEGG: nmu:Nmul_D2819 MobA/MobL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5044"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60730"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSX3"
FT                   /protein_id="ABM60730.1"
FT                   /translation="MAAIDDLSGEIHQAKRDQAEQDRQAQQRDQAERERIERMSAVELA
FT                   AEIERQRPPRALDLVERDQAVLKAEGERQALQNQHTEAGSASARDQAQAWREAHKVQAW
FT                   LHDKGIGHAPELRELEKQRAAQHTEWQRLGPRVLDAEQRASSARDMARLRIQPEQSPAL
FT                   AKVAELEKLR"
FT   gene            25015..25251
FT                   /locus_tag="Veis_5045"
FT   CDS_pept        25015..25251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5045"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60731"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSX4"
FT                   /protein_id="ABM60731.1"
FT                   /translation="MARKREMKASGWSDRGEQWKAAPENLRGLIDSYNAAPKEARTAIL
FT                   DRILSDSSRREQVRGLMAEQRENYRENDRGYSR"
FT   gene            25283..25561
FT                   /locus_tag="Veis_5046"
FT   CDS_pept        25283..25561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5046"
FT                   /product="protein of unknown function DUF497"
FT                   /note="PFAM: protein of unknown function DUF497; KEGG:
FT                   xfa:XF0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5046"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60732"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="InterPro:IPR038573"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSX5"
FT                   /protein_id="ABM60732.1"
FT                   /translation="MKLEWDADKAALNLQKHGISFEDAALVFYDDGRIESYDGREDYGE
FT                   DRWATIGLAVWSVLYVVYTVREEESIRIISARKAISHEQQQYREANS"
FT   gene            25581..25838
FT                   /locus_tag="Veis_5047"
FT   CDS_pept        25581..25838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF0532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5047"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60733"
FT                   /db_xref="InterPro:IPR025528"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSX6"
FT                   /protein_id="ABM60733.1"
FT                   /translation="MTDEQRARLAALASMPDDQIDTSDAPFRPDAVWAKAVDFPHGKKQ
FT                   ISLRIDEDVLNFFRQTGKRYQTRMNAVLRSYVEAHKAHAK"
FT   gene            26013..26834
FT                   /locus_tag="Veis_5048"
FT   CDS_pept        26013..26834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_0930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5048"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60734"
FT                   /db_xref="InterPro:IPR010751"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSX7"
FT                   /protein_id="ABM60734.1"
FT                   /translation="MATMARLDDLLARMGEIQEKTRQRAERERENAPAKVVQLPLWPEP
FT                   VRAVPNGFLRSALFGAIRKGRRRFVKGEQLAALDGIEIHYTGERLDQGDLDVYESVLHA
FT                   VRLQELGSQCRVTSYALLKLMGKTDTGKNRATLLTRIERLRANAIRIKQERYSFIGGLV
FT                   DEAYKDEETQEWVIVLNPKLRALYGADQFTPFPFKVETLLKLCGSEDASPTSGRQKLRK
FT                   ALDAVTEASAAHGEGFSYEIRGDLVHVEKKASGTQRLHLAKKAAQRRKPRA"
FT   gene            26993..27334
FT                   /locus_tag="Veis_5049"
FT   CDS_pept        26993..27334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5049"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60735"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSX8"
FT                   /protein_id="ABM60735.1"
FT                   /translation="MFDAQSPGPPLGGRAKGVAAARLALPQVRRKRCADNHRCAAPGAA
FT                   KPRFPGREDGRRLAEAVPRVRAWRGFERCKTAATIRGYAPDTPLQGPETGLEGAQWGLG
FT                   VGFVYVRGG"
FT   gene            27418..28212
FT                   /locus_tag="Veis_5050"
FT   CDS_pept        27418..28212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5050"
FT                   /product="Transposase and inactivated derivatives TnpA
FT                   family-like protein"
FT                   /note="KEGG: rme:Rmet_6188 transposase Tn3"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5050"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60736"
FT                   /db_xref="GOA:A1WSX9"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSX9"
FT                   /protein_id="ABM60736.1"
FT                   /translation="MGHHGQSQPSHWRSADRVAAPGLHRTAAHCGALRNGHAEVLGRLD
FT                   LAVGHLRLAPKQGTVTASLMLRKLGSYPRQNGLAVALRELGRIERTLFILDWLQSVELR
FT                   RRVHAGLNKGEARNALARAVFFNCLGEIRDRSFEQQRYRASGLNLVTAAIVLWNTVYLE
FT                   RAAHGLRGNGHVVDDALLQYLSPLGWEHINLTGDYLWRSSAKVGAGKFRPLRPLPPAWR
FT                   ALIFRFLRRPQHDLLTSQTCRHPLAGHGRAAGQRLRISGRQQ"
FT   gene            complement(28642..29070)
FT                   /locus_tag="Veis_5051"
FT   CDS_pept        complement(28642..29070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60737"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSY0"
FT                   /protein_id="ABM60737.1"
FT                   /translation="MNKRQLIAALVEKSGIKLTEDDPAFLLVDLNLLVLESRTSEAAIQ
FT                   LEAATEKFNAVTTRNVDDFVSVANEALSKFMQRTNEIKISLDNLAARPAQAGAVAASAS
FT                   PPAPTKSSRHGTLLWWLLPLVFGAGVLVGVGMAFAVLK"
FT   gene            complement(29071..29823)
FT                   /locus_tag="Veis_5052"
FT   CDS_pept        complement(29071..29823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5052"
FT                   /product="transfer origin protein, TraL"
FT                   /note="KEGG: net:Neut_2577 transfer origin protein, TraL"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5052"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60738"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSY1"
FT                   /protein_id="ABM60738.1"
FT                   /translation="MSAKPAKTAPKNSVHFTLQGKGGVGKSLVSSLLAQYFQSIEGCTV
FT                   KCVDTDPVNQTLANYKALNAQHVQLMNGSKINERNFDQLMERLMTEDGVFVVDNGASSF
FT                   VPLSNYLIENNAIAMLQEAGREVFIHSVLTGGQALMDTLAGFKILAEQADTRNMVIWLN
FT                   EYFGPIEASGKTFTEMKVYTDHADKVRGIVRIPERNQDTFGKDMELMTSKKLTFAEVLS
FT                   GTDFALMAKQRMKTVQRDLNEQLAAVGF"
FT   gene            complement(29836..30189)
FT                   /locus_tag="Veis_5053"
FT   CDS_pept        complement(29836..30189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5053"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60739"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSY2"
FT                   /protein_id="ABM60739.1"
FT                   /translation="MKPPQSLAGYIRQHLKELEERLEVGVRQEVIVAELEAHGYKTTLK
FT                   GFRNFLYRARIRAAQKTVAASAKPASQKEQKYAPSVAQKPDQKKQEIPPNPLTKKAGFE
FT                   FKGTNSVDENDLI"
FT   gene            30466..31047
FT                   /locus_tag="Veis_5054"
FT   CDS_pept        30466..31047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Veis_5054"
FT                   /product="mobilisation protein"
FT                   /note="PFAM: mobilisation protein; KEGG: xfa:XFa0048
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Veis_5054"
FT                   /db_xref="EnsemblGenomes-Tr:ABM60740"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:A1WSY3"
FT                   /protein_id="ABM60740.1"
FT                   /translation="MVIGRDMLRVDGVPPETKKQLQEAARQLYGKPNASLLVRTLIAGH
FT                   LSKSGATAQPLTAADAGDTVRVELRLPRAALEQVNDLAEGRFSARNYYLTNVILAHLGQ
FT                   PQLHGDEIEVLRRSNYELAKVGTNLNQVAKAFNTLVKMRGAEKIPEVGKKIASLRREIT
FT                   EHTGKVLRVLEAGTTVWEAKGRGQRQRKRK"
XX
SQ   Sequence 31194 BP; 6439 A; 9157 C; 9125 G; 6473 T; 0 other;
     cattcgctac tgcgaaagcc gcctggccgc gctcgatgag ctgcaagaag ccttgcaacc        60
     caccgacatg gccacgattg aacgcatcct caccaagggc gagcctgcat tcaaggttca       120
     gtgatcacca tggccgacta caaaccactg actgataaag agatcaggga tacggcaggc       180
     gcgcactacg cagagcggca agcgaaatca ctcccccaag aacaacccgc catcgttttg       240
     gtgggtggac agccaggcgc aggaaagagc gcggcgtcgt ccatggtgaa agccgaactg       300
     gccatgcagg gcggttacgt ccacgtcgat gctgaccgga tgcgcgagcg catccgtgtt       360
     gggaacagca agccgacttc ggagcaaaca caggcagacg cgggccgact ggtggccacg       420
     ttgcgcgacc aggccattca gggccgacgc aacatcgttg aagagggcac ctttcgcagc       480
     ccggacggcg cgggcaaatt cgtgcagggt ctccaggagc gcggctacaa ggtcgagttg       540
     tttgcgatgg ccacgtcccg cgaggaaagt ttgctgggca tctaccagcg ccacgagctg       600
     caacatgcag ccggtggggc caacccgcgc tttgtcagcg agaagtacca cgacgaagcc       660
     atgcagggct ttgaaagcac gttggccagg acagcggtgc agctcgatcg cgtccgcgtt       720
     gccgaccgca gcggcgcggt gctgtacgac agcgccattc aaaccaacaa gcagcccaac       780
     gccttggaag cgctggccgc tggccgcaag ctcagcgaca acaagttggc agaagtcacc       840
     aaggcatggg gcgcagtcga ggccgtggca cgccagcgcg gcgcaccagg tggctaccta       900
     gaggccgtca gcggccacgc gcagcgcttg gaagacatgc agaaagagcg gattcatggc       960
     cacgccatga accagctcga cgcgaacgcg gccacgcttg cgcgggatgc caggtatgcc      1020
     cagcacaccg ggggcgaact ggccaaagcc gcgtactttc gcggctttca tgagaaggca      1080
     tcggagttca aggggatagc gccggacttt gcgaagtacg acgcaaccgt ggcaaaccgg      1140
     cagacgttgc gccagttgcc agacgtgagc gacttggcag ggcgggcaat gccaagacag      1200
     cgggccaacg atggcaattc gctatagctc ttgcccggtg tccttgccct tgcctcgggc      1260
     cttggccagg tcgaacagct cttgggtgcg agaactggtg gacttgtcgg catcccgcat      1320
     gagtgccgcc accgacttgg ccaagtcagc ttgtccagca gcctcaaggt tcttggccac      1380
     ttggccccac gtcgccaacg tcttggcttt ggtttctgca atcttggcct cagccggatt      1440
     ggtaggccgt gccccggcct tcaaagcggc ctgtagctcg cttttcaggg cttcatgcac      1500
     cttgggcaca cgtgggggcc tcagagggcc tacaaaggcc gtttccggcc tcgctgtggc      1560
     cttcatggtg cggtctagcg ccttgtcttt ggcgcggcgc tcgttgtagg catccgactt      1620
     cgggttgtcg gcgcggatct gccgcaccac cgggtgttcc ggcttgcggt gattgaagcg      1680
     gtgccgccgc tcgcttgcag ccgcatcgat gccgttctcg cgcagcttgt ccgcgaaccc      1740
     ttgccgccac ctgaacaaat cagccttgcg cgggcttagt cggggttcgt cggcacggtc      1800
     aatgtctcgg gtgcccacgc aaacgtgcat gtgggtgtgg tcggtgtcgt catggaaggc      1860
     tgcgacgtac cggcgattgg cgaattcctc ttggcagaac tgcgccacgg cttcgcgcat      1920
     ggccttttcc ggcgtgcccg ccggcatcga gaacagcaca tgcaggtact cgcgcttgtt      1980
     gctctcgtct gggacttgcg aggctttcat ttgctcgcgc agcgctcgca actcgtcgcg      2040
     gccttggatg ctctcgccgg actcgttggt taactcgacc tcgccattgc ggctgatgta      2100
     gtccaggtga tgtttcaccg tggccaggcc ggaactgctg cccgtgatct tcaccatgac      2160
     ctcgggcgct ttgcgaatca cgctcgccgt gttcttggcc tttgcattgg ccgagaactg      2220
     catgccgctg gtggaagcgg gggaggtgcc cgaccgggcg cgtatctggt cacgcttggc      2280
     cgtccttgcg gccttttgcg accgcacacg gaagcccttt tcaaaccagc cgtccagcgg      2340
     atcaaaggcg ctcatgggtc acactgtggc caggcgcaag aactgtgcag ttcgcggtac      2400
     accgcgttgc tgcacgttgg ctcatagagc caggcgcaca ccgcagccat gcagaccgcg      2460
     acacccagca ctgccacaag gcccttggtt gcgccgcgca tcacttgcac caggtggcca      2520
     gcagcagggc ggcagaccac gcagagagaa ccacccaaac caggttgcga tcaaaccagt      2580
     tgaagaacaa gccttcggcc tcgatggggt tgcccatcaa atctttgccg atcacgactt      2640
     ttcgggtgaa gaagatgcgt tcagtcagtg ggtgcatggc gggcctcatt aaagcgattg      2700
     ctcgtgtgta tcgcgctttt gcacgcgctc agtggtcttg tccttaatct tcggctccgt      2760
     cacctgattc aggcgcttca agaactgcgg gtcaaccgct tgtttgtcga agcgggcgat      2820
     ggcctcatcc tgcaccggct tgggctgcaa cttgttctct tcggccacga tgccgcgcca      2880
     gtacgccagc ttggtcaagt cttccacgga cttgtcggcc atgcccggct gcttttgcag      2940
     cgcctgcatg ttggtggcga tgaacttgct ggcctcaacg tgcatggccg cttggttctt      3000
     gttcaggtca tggcggggtg cggcaggcgt ggtttcttcg cgcacggttt cgcgctctgc      3060
     cttgcgctct tgcagcgggg tgatggcgtt ggtggagcgc tcttgtcgca gagtctccag      3120
     cgcggccaaa tccgcttgct tgggcgtata gccctgcgtc ttgatacctt gcgactcagc      3180
     ttgcaaccag gcttcgcgcc tgaactcctg cgagccggac agcttgagac tgtcccactg      3240
     cttcgctttg gcgtaggcca ccatatcggc cacggcttct ttgttggtgg tggacgtgac      3300
     cagcttttcg cccttgtcct cgaacatcac gcggttcgag tccttggcgt aaaacttgcc      3360
     gtccatctcg gtgtatgcct gcgtgatgcg gcgcggcacg atgaaatccc cgcgctcgag      3420
     ctccttgcct gagcgccgca cgtccaccga gttcaagccc tggccagctt gctcctgttc      3480
     acgcgccttg cggcggcgca aatcgtcttc gagctggtct tgcaagccct tgttcacggc      3540
     ggcggcttgc tccccggtcg taatcaccgg cttggcttct tcacctttgg cggctgcggc      3600
     atggaaggcc gtccgcaggt aaaacgaatc gccttcaccc cgtttgccaa gcgccaccag      3660
     gtcggcatgg tcggccacgt cgcgggcagc tcgcgccttg gcttgttcct cagaccaggc      3720
     gcgggccgta gcctcgcgct cttgccgcat cgaatcggcc tcttgctctt tgcgctcttc      3780
     cttggccttc gcggccagca gctcgctatg cgtgtcttcg ggtgccacgc caggctcgcc      3840
     gcgcaggttg tcgcgcaacg ccttgtcttg gccatcttgc aacagctcgc ttcgggtgtc      3900
     ctcgggtgtc acaccaggtt caccgcgcag gcggtttctc atgtcggcat cggatgcttc      3960
     gggggtagtc gccatgttgc agtctcctta aattccaaat tccttgagga tggccaagcc      4020
     acggtcaacg gccatgaccg tttcaaccga ggctttgggt tcagtggaca gtcgcagcca      4080
     ctcagtccgg tacacgctgg ccagctcggg cgcgttgcgg aatgccaccg ccgtttcggc      4140
     gttgcgcaga ttcgcggaag acgtgtagtt gaagctcccg agctgcacat gcaggccgtc      4200
     agccaccatg aacttgtggt gcatcgccgc gtagttctcg caccggaaaa ccgggatgcc      4260
     ttgcgacgac aggtaatcga cggccttata gccgccctga tcgtcggtgt tttgcgcgtg      4320
     atcgaccacc acgcgaacat caatgccgcg tgccttggcc tcaaccaacg caaaggcaat      4380
     gtccttgctg gtgaacgagt acgcagccac cagaagttcc gtctttgcgc cgagcacaaa      4440
     cgacatgacc acctcaagcg cgttgcgctt cggtgagaag ccaacttcaa acgtcgcccc      4500
     ggtgggcaac gcttgctctt caaccgcacc cgcgaaatgc aggacagggg agggcggtgc      4560
     aggctcaatc gtgttgagca gctcgctttg gtcaggcacc gcaggttgcg ggaggtttgc      4620
     ccgagcctga aaaatcggct cttgatacca aaagattttg tccaccagcg ccgggggcat      4680
     gttctccatg ctgatgatct ctttggccat gcctatggcc ttcacttcct ggggcagcat      4740
     cacagcccgg cgctgatcgc tttccgactc gctgcggccc gacttcgcgc cgagctggcg      4800
     agacttcgac aagccctttt cggtcatgta gccgatcatc tcgctgtagt ccttcgcgtc      4860
     gtcatcgtcg cggggggcat agacaacctg caacgccatg ttggtcaaca tggtttgagc      4920
     gccggtttcg tcgtacagct tgcggtcttt gacctggctc ttgctctgaa aaaccagcag      4980
     caagcgcatg ttgtacccgg ccatgtacgc cgatgccttc tcaatgatgg cgatgcgccc      5040
     catcgccggg aactcatcga gcagcaacag gcattggtat ttcaggctgg ggtcatcctg      5100
     cggcagcttg tccatgttca gcacgagaag ctgttggaaa aacaggttca agaacttgcc      5160
     gaacttgtca atgttggcgg gcttgaccac cacgtagatg ctcatgcgct ttttgcgcac      5220
     gtcgcgcata tcgaagctat tcgaggccgt ggcctttgca gtgattgggt cactgaaaat      5280
     gcccaacggc tgatcgaacg aaatgccaat gctgttgcgc agcttgtcgc tggtctgcgc      5340
     gaagctgcgc aggtgggtta tgcagtcctc agaaagcggc tcgaacggct tacgttcctt      5400
     gacgtgagcc atgaaggctt cttcgtcctt caaacagccc aggccgacac gcattttctt      5460
     gatcgtggcc atgttgaaac tgccgtgcag cttcgacgtg tccatgatgt agagcgccag      5520
     gccgaggaac aggctttcag ccgtggaggc ccacacgtca tcacttggcg ggtacaggat      5580
     gttggttatg cccatcaagt cgctgatgcg aaagcgcggg tcatcgcgca cgtaggccag      5640
     cgggttccag caggcagttt gaaagttctc gtcatcaggc gcgaacttat ggacttcctg      5700
     cccgcacttc gcacggaagc ccgaagtaat ctcgaagttc tcgcccttga tgtccagcac      5760
     caccaccgaa tcccggtagt ggagcaggtt gggaatcacg atgccaacgc ccttgccgga      5820
     gcgtgtcggc gcagccagga acatgaattg ctggccacgg aacagcaaaa aatccttgtc      5880
     ttgcttgccc accacgatgg aggggtactt gtcgtccgcc tggtcgggtt gaagcaaccc      5940
     acccttgacc agctcttgcc gcgtggcaaa ccgcgccgag ccgtgcaact cccgcttttt      6000
     tggggtaagc gccgcgtagc cgaccaggcc gaacagcagc accggcaggc cgatgctggc      6060
     caccagcgcg ataacgccaa agcccttttc cttcttcgcg ccgaacttcg ccagctcgaa      6120
     gggcaaggac agatgcgggg tcacgtcgcc caggctcagg tacttcacca gcaggcccga      6180
     ggtcacgtag agcatcccaa agacggatgc cacggccaac agcagcagca ccaggacggc      6240
     gatggctatt tttttcttgc tcatgacgcg cggcctcgca gcagttggag tttcttcacg      6300
     gggtcaaagt acagctcttt gaggtgggtt ttctcgaaga aaaccaccac atcaatggtc      6360
     gtgaccacct cttgcatgat gtagtcgaaa tccagcgttt ggccgacttc cgattgcttg      6420
     atgtacgagc cgattttgta gagcgcaccc cggcaatcgt tcgcgtggat agaggtcaca      6480
     gagccgctat gcccggactt caacgccata aggtagtccc atgtttcatc cccgcgcagc      6540
     tcagtgatga acaggtgatc gggcttcatt cgcatgcagc tcgacaacac tgctttggcg      6600
     gtgatggtcg ggctgaaaaa caggtgtacc gagttcggat gcttgggcgt ggtcagctcg      6660
     tgggcatcct caatcgtgaa caggcggcgc gaggccgggt agaggtcaat caggcacttg      6720
     gaaaacgtcg ttttgccgga gccggtgccg cccacggtga cgatgttcaa gtgatgctct      6780
     accgccagct caaagaagcg cacaaactcg ccttgttggg ccaaccggag caattcagcc      6840
     tcccagggct gaatttcttc cgacaagcca gccaacacgg gcttgagccg cccggaatcc      6900
     gcgtagttgg ccaacgaaaa ccggctggtc gaaggcttgc gaatcgtcat gctcacggtg      6960
     ccgtcttcgc acgccggagg caacacgatt tggcaacgct ccccatcggg cagcgtcagc      7020
     gaggcaatgg ggttgtcgcg gtcgagcttc ttttggttga acacggctat ggccgtggcc      7080
     aacccttgca ggttcgacag cgacaacgat tcattgggca cctcacgcca gcccgccgaa      7140
     tcctcaatcc agtagctgcc tggcctgttg atagcaaact cggtgatgtt tgccatcaag      7200
     gcttcggaga taccgaattt gcgcatcagc tcccgcaccg aaagggagcg gtcaacccgg      7260
     cttatcggct tgagcacagc ctcactcaac aacgttaaag acattttcaa agctcacgtc      7320
     acgcgccacc atgacgttta caatcgtcgc gggaagcacc accaaagtgg gtgggatgtt      7380
     gatcgaattg cgcaacgcct cagcggccat atcttgggtg gcctgattgg tgtttgagta      7440
     cggctgtgca gccgtcgcgc ccgtgttgct gctattcgcc acgcgctgcg agtaggcttg      7500
     tgaaaagtcc ttaatcaggc tcagcatgat tgcgccgccg aaccgctgcc aaaagtgggt      7560
     gtcaacgtag ccgggaatac cgctgtagcc catttggtca gtcgccgggc tgtcgatgtt      7620
     ggcaaacacc ccgttggggt tgtcgatgcg cgtccagaca acgaaggttc gttcctggcc      7680
     ttgcttgagc tgcgattgct gctcaccgaa cacgtctgcc ccgcgctcga ccaacaacac      7740
     cttgccattg gccgagtaca cgttgttgag caccttgcaa atgacgaagc cgggcagcgt      7800
     cgtatcaatg ccggttttca gcgcgcaagg aatcgtggtg ccgcgcttca acaggtagtc      7860
     taggttgggc agcttgcccg cccagcgggc ttgcaagacc gtaggttgca gccgggccgc      7920
     aagcccatca gcgcccccgc cctggccacc aggcgcgagc tgcaggccag ttccaccatt      7980
     gaagccctgg ccaccgcccg gagtcacgcc agccgccgcc atacgggctt gcacttcgcg      8040
     ttgctgctgt tccttttcgg acaactgcgc atcagccttg ggcttcgcgc ccttgctgtc      8100
     caggagcacg ccgcccgcca tcttgcgttc catcggcgtg ggtgggggag gtggctggtt      8160
     gccctgctgc gcctggccac cgctgtactg cccgccgcgt tgttgcccgt cagcctggcc      8220
     aaaaccgcct tggccgcgtt ttgcggcctc ggctgcggcc tgggccttcg cttgcgcctg      8280
     agcctcttct acggccttga tttgggcttg atcttcctct tccttcttct tgatttcggc      8340
     ctttgccttc tcaattaaat cactctcgac cgccgcattc ttcgacgcaa attcaggctt      8400
     caccggcgca gtcttggccg gtgtctccac ggttgcattc gcccgcttgt gcttttggta      8460
     gaacaaaagc ccggccacga taaacaggaa ccccacaagc accaggccaa ggatggcgaa      8520
     tttgcccaca ttcgttttgg actttgcttt gctggtcggc tcgcccaaaa cctcgggttc      8580
     agtgtccaac gtgggcaatg cgcccacgtt tgtgaaatcg gtagtctcgc tcatggttgg      8640
     gtgcccttat ctacacgcac agcgcccgga acgctggtgc cggtttcgtt gaatttgggt      8700
     agcgtgtacg cccggttaat aatttcaatg acctgatcgc ccatccgtgc ccgcacggtg      8760
     cgaatcacct catgcagaac cacggtttgt ttatggtcag ggtccacgtt gctattcaac      8820
     aaagcctcag tgccatcagg cagaaccttg aagaacaccg gcaactcgcc ggagtggtca      8880
     tacaccaggc gcgtgaatcg cccatcgtca taagcggctg tgggcttcaa caactcgtta      8940
     tcaccgcgcc aaacgtaatc cgtgttgatt accgttttct cagctcgcgc agcggcggta      9000
     atctgcaccc gtttggcttc ggctgccgcc tcggccgcag ccttggccgc ttcggtatcc      9060
     agataccgga aacgcagaat ataggtaggc attgagtcct tggccgtagc ctgcaactcg      9120
     aatgaatacg tgcgcttatt cgtcaccacg accacgtttg tttgtggcat gttctgcgtg      9180
     ggcttcaaaa caatgttgtt gccgcgcacg cccaaattcc aagcgtcagc gtcaccaatg      9240
     cccagcaccg aagagggcga aatcaccaag gattcgtctt cttcgagctg gattagggaa      9300
     gcgcggccaa tttgagtgtg cacgttgtac accaccgact tgtcgtaaat ctcagtgcga      9360
     atgcgcgggt catccgcatg ggccaaactg gcgacacagg ccagcaccag ggcgattagt      9420
     tttttcattt aatcacctcg gggtcaacgc ggtaagttgc ggccttgaat ccgagcggat      9480
     tcacaagccg ttgttgctca gtcatcatgc cgggcttgaa ttggaatgca atggtggcaa      9540
     tccacttctg caggggcgag ttatcgacgt tctcaccgct cgcactcagc ttttccgagg      9600
     tgaaacgcac ttgggcggtt tcaccgaaaa acgcaatgga ggtgattttc acaaccacct      9660
     tgcctttgtc cttcaacacc gacaggggcg agccaggcgc ttgcaccttg cgcgaatatt      9720
     ccttggccac atcgccatca gacatgagct tgcacgcctc gaattgctca gaaatggtga      9780
     accagtcgta accttcacag gtgcggacgt attgggccaa ccaatacttg tttaccacct      9840
     cgtcgtattg gtctttggtg tcgcgcaccg agcgcaaaac agttgttgcg cccgtgctct      9900
     tgtcaacctg caaaatcgtg ggttcaggtt ccgtgcgcgt cagcagtgcg accaggaacg      9960
     caagaataga cacgctgcaa atggccgtgg acaccatggc aataatccac gctattttgc     10020
     gggagcgctt aatttcctga atcttggact tctcaaaatc tgccgcagct tccgcaaagt     10080
     tttgtggaaa ccgggcaggc tttgcggcct ttttgggcgt aggtttctct ttgatggtca     10140
     tggtttagcc tgctttcctg atcgaattga atttgtttgc cgcccagcgg ccaactgctt     10200
     ggccatcggc tttggtggcg cgataaccgg cctgcatggc ctttatgtcc tttgcggagc     10260
     ctttgatggc acttaccagc gtgcctatgc tccccggcat tgaggcattg ataccgcccg     10320
     cgctcaggga cgacgccagg gcactcacct gtttcaaaag gaatagcagc gtcagattgc     10380
     ccattgatgc aaggaacacc gctttcaacg acacgtcatc aagcgagcca ctgccggaaa     10440
     gcatggtttt tgaaagaccc acggatatgg tggcaatcac cgccacgaac acgggaatca     10500
     gggcatagct caacgctgtg ttgagccagg ccgagaaata ttgccgtgtc gcgggaaata     10560
     tcaggaaggc gaaaaacagc ggcccgatca tggcgaccaa gacagagcca acatcagcaa     10620
     tgatgattgc aatcgttgct gcaaccagga acggaatcag gccgaccagg atgcatgtgt     10680
     atttcatgaa atacaggagc atggaacccg cattccatgg aaatccgctg ctgctggccg     10740
     attcgtagcc atcatcaaga atcttcaggt agtggagggc gagttggtct aacgtgccag     10800
     cggaggcgct gccaccgctg accgccgaag ccaaatcact gcctacgcca gtcacgatag     10860
     gaataaccgt gctggtgtag ttcgcggcat tcaagcccag gccaataatc acagcgaaac     10920
     ccgcgcaccg aacgccaaaa tcaattacag gctcagtctc tgcgccgcgc atgtaattga     10980
     tgcagatcag gatgatgtaa ataccgaagc caaccgcagc caggggcgtt accgccgtgg     11040
     caatggctga tgcggcggaa ccagcgccag aactcacaat cttgtttatt tcaccgacaa     11100
     gccaagtaat tggcgctgct tcatccatgg tattatctct tgaacttgtt gttatctaaa     11160
     caggcatggt ctgtcccggc agtggttgga ggcttgctag cccagcactt tgataacggg     11220
     cgcgagaagg ctttagccgc caaataagca gaccacgcgg cagcagcgtt ctgcactcgg     11280
     gcgtcagatt gatacttggc tgggttggac ctgtgcatgt cgagaatttt tctagtctcg     11340
     tccatgtcgt gcatgtaatc ggccaccgaa gggactttct cacttgagca accggcaacg     11400
     attaaaatgg cgctgacgat cagcagcctg agcgcttgaa ttctttgcat gtgttctcct     11460
     tggttgcctg taatgcagct tcctcaatct cttgacggtg cttttgttga agaatggtca     11520
     ccagattttg gttagcctga atagcgtttt gctcgctgat aaggcggtta gccaaatcgg     11580
     ctttagcagc cgggtcgttg gctgaatcaa tctgcgcatt cagggactga ataaggctca     11640
     atcggttatt ggccttgccg tataagtcgc ccatcactgc gttctgcgaa gcaatcacgt     11700
     catacagtgc attcgctttg ggcaaagcgc tcaatgtcgg gtatttcttg cgctcattga     11760
     tgtaggcact ggtcttcttt acgtcactga gaacctgttg ccagtcagcg ggcaatgcag     11820
     ctttcagcga cgagttatcc agcaaagcac ccatgccacg cgggccagtg atggccgcgt     11880
     actgttgctg atactgctga atttgttgct gcaattggct gaactgcagg ccccacttgg     11940
     caatgctttc gacctggttt ttaatgctgg tcgaaatgtg ggcaacgtca gtcactggaa     12000
     tctgcgcttg cgcagctcca gcgaagacga caaccaaagc gccactggcc gctctggttg     12060
     tcttcaaaat acctttcaga tccatggtca ttccttcacg gttgcgggtt gagaaacttt     12120
     ttcgcggcct tttttgcgga gcaccttgta gaggggcacc cactggtcag gatgcgtgcc     12180
     agcttgcgcc ttggcagcat ccagatactt gaagtcttcg gcatccattg ccagcacggc     12240
     aatgtcatca cccatgccgt tcaaatccag cttggccaag ctggattgcg aaccttgctt     12300
     gaccataaac atgcggcttt gcagcccaag tttcttgagc ttttgaaact ctttggtggt     12360
     caagccgaag cgcgaataac caccgccgtc tggcgtggtg tattccgcgt cagggttggg     12420
     caaataaatc ttggtcggtg tctgttgcag caccgcaggc agcagcgggc ttctaatcac     12480
     gtcctcgggg gactgcgaca ccaacacaat gaattcaccc cggcgacggc ctgttttcag     12540
     ggaatcaaga atctggtctg ccgtggtggg gtattgcaac ggcaaccaga actcttcaac     12600
     gaccgtggcc agcaacgcgc cgtcgcgctg catcaaggtc ttgaggtgga acaggtaagc     12660
     caaaattggc tcagtggctg ggtggccagc caccaagaaa tccgacacgt caaagccaac     12720
     gcgcttgaac ccttcccaat cgaagttgtt ttgcgggttg tccagggcgt aggcataacg     12780
     tccgtccacc tcgccatagc accagtcagc caggcggcgg gccaagcagt tttcgccacg     12840
     gtcggggatg ctttgcagaa gcaccccgaa gcgccgttgc tcaaacggca gctcaaacac     12900
     gttgtccacc gcccgtttaa tgtccttggt gtcctctgcc gtgccctctt ggccagcctt     12960
     gcggccacac gcgcccacca ggtcatagag gaagttgcgg ttctgcggtg tgtcgggcag     13020
     ttggaaggga ttcaagcccg taggctcgcc gctggccagc cggaagtacg tcccgcccac     13080
     ggcttcgatg aagccgcgca tagagccgtc cttgtccacg gcaaacagct tgttgtccag     13140
     ccttcccagg aaggtcaaga gcgtggtttg cagcgtggtc ttaccggcac cagtcgcgcc     13200
     caaaatgacc gtgtggccag cgcgtttttc gccgcgtgaa tccagctcag gcagcgagta     13260
     gtgaaagttg aagtggtaca cgccatgcac ggttgtttgc agcggcatga ccgccgaacc     13320
     gtcgcccaaa ggattgccgt attgcttgcc cgagctgtag gtgttcatgc tgaacaaacc     13380
     caacaaattc cgggttgttt tgggcatcgg acgcgggcgg cgtttgacgt tgcccgggaa     13440
     catcgagaag aacgtttccg gcgctgaaat ggtggcgggc acaaactgag tcgcgcatga     13500
     accactgagc gtagtccggg ccgtcgcgcc ccggtcttcg gtttgctttt cggtcttacc     13560
     atacacggcc aacgcgccgt gcagttcacc gaaatacacc tggccggaca tgatcgcgcc     13620
     tttgcccagg ctcatatcgt ccatttgctc caccgcctca tcaccagccg attccatttt     13680
     gttcagcgac tggttaatca ttcggatgga gtcagccgta ttaatgaagg tgaacgacaa     13740
     gcacatgatg aagggaaacg gcagctccag cagcgggttg aatttccccc gcgtcgtggg     13800
     atccgggaag tccttcaaat cgaaaaacgc gctgtagcgg ttgccaccgt ccgggaaccg     13860
     cgtttcaagc agcttgtagc catggtgcaa agcgcttgtt tgcactgcct gaaacagcgg     13920
     gagcgaggtc acggggacgc gctcccaaaa gccgttgtac aggtacgcaa tgaactcgta     13980
     gaactgactg aactggttgc catcgtgctc gtacatcgac agcacttcgc attcataggg     14040
     cgcaacggtt tgcgtcacac tgagctgaat ttcttccagc tcacgaatgc actcttccag     14100
     gttgtcattc atgcccggtt tcaggatgaa ggtcagataa aaatcgttct cgaaaatatc     14160
     tgtgccttca aacttggcca tgtacttggc actgaaaagg cgcatccatt cgtagccaaa     14220
     tcggtagtcc gttttgaact ccgtttggta gtggtcgagg tgtgcccaca ctgccaggcg     14280
     cgagccggtg gacttggcta tgctcaggag cagcccgttc aacccatcgt attggttctc     14340
     caataccttg tcgctggtca cttcaaaggg caggctcttt gccttgagaa tgaacgccac     14400
     gcgcccatcc tcaagagaca caatcgtgtc tctgacgtgg tagttatacg ggggcagttg     14460
     ttcctcaccc gcgaactgtt tttttaaaat agcgcttaac atttttgagc ttgcgaccgt     14520
     aggttgttgg ggcaatggcc atagtcccgc cgtgatattt ggcgttgcca ctgagcgctt     14580
     taagaatgct ccattttact tcgagcatca gaatttggat tgccttgtcg tcattggcgc     14640
     aaagcatctt gacgaacaag gcaactggca ccccgataag ggcaaacagc cagcccaggc     14700
     caccaacgaa ggtgccgagc aataaaccgc cgatcagcga taaacacatg atcgccaggc     14760
     cgaccatgta cggaatgccc cagatcattg ggctacgccc aagaccgttg tagctgatgt     14820
     acttttctgg tggctgttcg tctgtcatgg catcaggcga acagtgtcca agcccaggag     14880
     ccgagcgcaa cagcgccgcc caccagagag acgtacacca cgccccaccc aaaatctgcc     14940
     caagattttt tctcggtgaa tgccatcaca ccgagataaa tcaggtaagt cagggcgacg     15000
     acaccgacta gggcataaag cccggtctta atgtcgtcag cagcggtttt cgccttatcc     15060
     aggccaccca atgcgagagc gttggacgac gcggcagcaa tcgccacagc cgcagccacc     15120
     ttacggtgct gggcaatcag cgggttgaaa atgcggttca tggctaattt cctttacggc     15180
     caaagttttt gaaaatatcc caaccctcgt aagtgacttt ttcactttcc tgagcctgag     15240
     attcttggtt tgccgttggt gcggcagaca cgggtttagc gcttgcaacc tgagtagttg     15300
     caacgctaga agtcgggtaa atgggttgcc gcgatgcacg cgcaatttcg cggtcgatgg     15360
     attgcaaatc ggcttggatt cgtgccaaaa ctgccttatc gccgttggct tccaacttgt     15420
     tgagtttggc caatatctcg ttgcgctctt gcgtcaagat cgccaattgg tcaacacgct     15480
     gttgcacggc gattgattga ggcgtggcgg cggcgggtgc tgcgacggcc tttgtcgctt     15540
     ggaaaggttg cgcagcttga gcctgagcgg ctggtggggg gtcagccagg gccgcgctgc     15600
     ttagggcaac tacaacggcc aaaaggccaa ggcttttagc gcttggccat gatgcgaaaa     15660
     acgaccgttt tcagcatggc taggcatccg gcttgagcgc gtccgcaacg cccttgccct     15720
     tgcccttgcc cttggcaggg gccgtaatcg tgagcctgtc gccctcaagc gtggccccgt     15780
     agcacctccc tctacctgct ggcgtgaaat tcgcgcctga gtgcggtttc tggccgtcct     15840
     tcaccagtag gtgcaatggg ttctctaggt gcgcgtcgat cttggccagc atgtccatgc     15900
     aaggcaagtc gcggactcgg tgcaggttgg tgacgatcat caaggcatca cggctcatgc     15960
     gatagacaaa cgctttggcc agcgggtcgg cttcgatgcc tgggggcagg gtgtccccct     16020
     tggtaaactg gttctcagcc atccatgact ccacacagtc ggggatggtt aggcgggctt     16080
     ggtgttagcg caccagtgcc cgccgccttg tttctgcttc atcgcacctc gtcgcggtcg     16140
     tgcaatttgg caagatagcg gtttgctttt tccttgtcgg tttcgagtgc gattgagccg     16200
     ataaaataca gcaaaacagc accgaaaaag acaagtccaa gaagcagcat aagaaagctc     16260
     atgttttcac ctctgttgga ttgcactctg tcgcaaattc tagcgctttc ccggctcact     16320
     cacgaattag cctggtgcgc tggccacggg ccacaaaaac ggtgtcacct ttggcgatgg     16380
     ctcgggcgca gtcgtcggcc tcggcaacca gcgcaatgat ggttccttgc ttgtcttcat     16440
     caagggcagc agggccaagc atgagcgggt gaagcgccat tacggcctgg tcaaccaggc     16500
     acacgaccag gcggtagagc tggggatgct ggacaaggcc agcattgcgg tcggcaaacc     16560
     cacgaaaaag gccctagaag cgcttgagga cgcaggcagc accctagccc tagcccatga     16620
     gttccaagcc cgccagcggg ccattaagac gaaggaaaag gcattgttcg agcaggggca     16680
     cgagctgcgc aaccagaagg cgcgggcaga gcagcagcag gcccaggccg cgatggcgca     16740
     aaagcaggtg caggagctgc ggcagcagct cgaagccgag gcaagcgcag ggcggccaag     16800
     gccgacgagc tggccgccac ctaccgggcg ggcagggatc agtccattga cgagctgcgg     16860
     ccgcagcgtg gccacggcct ggagttagcc gcgcacgcgg ccttgcttgg cccgctccca     16920
     ggcttcggca agcgtgatct gcatttctgg ttcagttctc atggtgcagc gagcggatca     16980
     tggcgtcccg caggatggca ttgatgcgtg tctggtagcc cttgccctgt gcctttagcc     17040
     aagccagaac gtcggcgtca acccgtaccg tggtggaggt cttcaacggc ttgtaaaagg     17100
     gattgcgcac ggcgcttttc cagaacgcat cggtcagtgg cgggatgtcg ctggtgtcga     17160
     tcgcgttgtc tggcatctcg gccagcgctt tgatttctgc ctgctgcgcc gacgtcagcg     17220
     gcggcaggtt ggctaggtca acttcatagc gaacggtctt ggttttcata gcggcgtctc     17280
     tcaaacggtt cggcgcgacg cgccgagatg atgcgaatga cttcgacggt ggttccgtcc     17340
     ttttcggcct cttcctccca aaccgtgtgg gccaccagta gcaacagatg agcatccacc     17400
     aagcccaggg tctgccagcg gtactcgcca ccctcaatgc ggtcttgctc cgccagggcg     17460
     aacggatcag cgaaggcgcg gacggctgtc tcaaagctca cacggtgctt gctgacattg     17520
     gccagagcct tcaccgggtc ccattcaaac cggattttca tacaatcatg ttactacaaa     17580
     tttgaattta cgcgcgagac tctttcctac ggcgcagatc tccgtgaccc aacagggcag     17640
     cgtcctggtc ttcctggtcg gcaacaaccg ttgccgagaa cgccgacagg tgcagtttgt     17700
     cgcgacgctc gccccaggcc acgcggtcat tcacaacata ggccgacacg gtgccagggc     17760
     cgttgagctt cacgaccgaa acccaccact cggccacaag gtcatgcacg gcgtactgcg     17820
     ccgtgcgcag ggaacagccc atcaactttg gctgggaggg caagggcggg atgcctactt     17880
     caacgacgct ttgaagtggc tgcgagagcg ccacggcggc gccaacgtgg tctatgccgg     17940
     catccaccgg gacgagacga cgccgcacat gtacgcctac gtggtgccgc tcgatgaggc     18000
     caccgggcgg ctgaatgccc gcaagtggct gggcggggcc aaggccctga gcgagatgca     18060
     gaccgagttc gctcaggtcg tgggggcaca gcacggcctg gagcgcggca acaaggaagc     18120
     gcaagccctc ggtttggcct gttcgctcgg ccagcttgtc ccctgcggct gcacccagct     18180
     ccgtaagcgc tgacctggtg ccccaatcct tgccgtctgt gagcgcggcc accgctgcgc     18240
     cacctacaac gccaccaagg gccagcgtag agggatgacg cgcccacgtt caccgctgaa     18300
     acatgaacca cggtgccgcg cttgatgttg gcttctgtga gggcttcacc cctgccgtat     18360
     tatgatatta tcgcgtttaa tgtgtctgaa aatcaagcgt aagcggtgta attgtcaggc     18420
     ttgaaaatct cgaatcctgc caccttgatg gattctttct tgtaagccca cacgccccag     18480
     ctacgaacct tcacggtgcc gttttcgttg acacgcttca ccatcggttc acccttgaaa     18540
     cggccctgca ctggcacgca ttcaccttgc aaaaagcctg tctccgctgc ctgctgggcc     18600
     agctcgcgga tttctaccga ctgcttgccc accaagcgcg tgacctggta gtagtcgtaa     18660
     ttggtctgtt catatcccca agatgacacc aaaacgtcac caacttccaa agagtgaggt     18720
     tgtgacagct tcgcggcctt ctctgccttg cgctcggcct tggcagtggc acggctcaca     18780
     agccctttat gccaagagtc ttggtagcga tcggcgtgct tggtggagcg gaagcggtag     18840
     tgaaaatcag gctttgcacg tttgccagaa aagccaatca tgtacaccgc cccggcctct     18900
     gtgacttgca aaaatgccac cgctcccaat gaatcatcgg tgaatttcac ctcgtatttc     18960
     tgacccacaa aggctttgcg aagtgtgtta acttcggcct gttttgaatt agaaacttgc     19020
     atcgcgttgc tagattctga gccggattgt gtatttggtt ttgcagtgtt cacgctatgc     19080
     tccttgtggg ttaagaggtc atcgcctcgc tgagttcgtc gccgtaaaaa gtggcatgga     19140
     acccacgaaa gagagggatg tgcggaacgt ggaataaatg gaggggggta gcccgtaggg     19200
     gggaaccgtt tatgccgcga aagtccgcgc agctcgaacg tgtgggttac ggtgcaactt     19260
     ggcgacgaac tcagcgaggt gatgaccggc cacaccggcg tgaacctcgg caacaaagca     19320
     ggctacgcct gctcacttct gtggccgcac ggccacgcaa gcgaagcgag aagccgcagg     19380
     gcggcagggt agggcgcgta cccgcgcctt acccgcattc agggggtggc cgtgcggcca     19440
     tgggggatgt gctcgcacgt ccccctagag cctcgccccg actgaagccc gaatgggtcg     19500
     agacagcttt gctggctcga tgcgtagcac gatggcggga taggctgcct tgcagccgta     19560
     gcgtcaatta aaatgaccac ttcttgagag gaaaacgcca aagtgaagcc caaactctat     19620
     caagccgaca aggttgctga agttgccaag acattggccg aagcgcctgc cctaccacct     19680
     aagttcatac cccacagcga cacccttgca gagctgtcta agcacatcaa agacatgcac     19740
     tttcgcaaga actacgacgc tcgccagata gccaacatct tgaaggaaaa cggcatcaaa     19800
     acgacgataa aagaggtgcg taacatgctc caaattgcaa gcaaaagagc accaaaaaat     19860
     ggtgataaaa gaagctataa ttaggccact ttcctaggcg ttttacgatg aaaaagcaca     19920
     caaaaacgag tctcctggtg gtcgcgctgc tggccgtcat cacagtaggt tccctgagcg     19980
     cttgccagtc gcgcccgcaa ctcaagcagg ttgcggctga cgcacccgac aagccaatca     20040
     acaccccgga agccgccgac cagctcaaga agaagtacga aaaatgaggc tggagaggga     20100
     tttgtacgaa aaacggtcgt ttttcgcatc atggccaagc gctaaaagcc ttggcctttt     20160
     tttggccttt tgtgtatcta aacaagtatc tttttcaatg cataataaac gtatggataa     20220
     aagcacaaac gaaaccaaca gcctgcgcct gggctatgcc cgcgtgtcca ccgacgacca     20280
     ggacatggcc ttgcagctcg acgcgctggc caaggtgcag tgcgaccgtg tgttttcgga     20340
     gaaggtcagc tcaggcaagg ccagccgccc gcagctcgaa gagtgcttgc gcacccttcg     20400
     ccgtggcgac gtgctcacgg tgtggcgctt agaccgcctt ggccgcagca tggccgagct     20460
     ggtggccatc gtgaacgacc tggcttcgcg tggcgtgacg ttcgagagct tgaccgagca     20520
     catcgacaca tcgagcgcat cgggcaagtt cacgtttcac ctgttttctg cgctggccga     20580
     gttcgagcgc aacaccatca gggagcgcac caaagcgggc cttgtggctg cacgcgcacg     20640
     cggacgcatg ggcggcagac cgaccaaggt cacgcccaag gccaagcggg aaatgaaggc     20700
     gctctacacg tcgcaagacg tgtcagtgaa ggacatttgc accaggtaca gcattacgcg     20760
     ctcgaccttc tacagggcgg ttcttgaacg cgactacaca accaatgggg acgcatgagc     20820
     aacttagaac tgtcattgga caaccttcgc gccaggcagg aggccaacgc acaaaaaagc     20880
     ctcttgcggc agcttcaatt gccgctttgg gcggagacgc agcgcggagt gccaaacagc     20940
     ttgcttcggt cggccctctt tgccgcgata cagcgcggca agcgcccttt cctcaagcgc     21000
     cagttgatgg ccagcgttga aaacgcttcc atcacgtaca ccggcattcg cttgtgccag     21060
     gactatttga cggtgtggga atgcctcgtt cacgtcgcac gcgaacagca gttgggcaac     21120
     cgctgcgaag tcacaaccta ccagctcttg aagctcctgg acaaaaagga caccgggggc     21180
     aatcggcagg tactgcgacg gcagcttgcc gagctgcaag cgaccgccct agaggttcgc     21240
     caagggcgct acacgtactc gggcagcttg atcgacgagg cgtatcacga tgaggaaacg     21300
     ggccgcgcca tcatcgtttt gaatcaacgc atcgttgccc tgtaccaagg cgatggatac     21360
     acaaaggttt cttggcagat caggcgcgac ttgcgcacct ccctagccaa gtggctgcat     21420
     gggttctatg cgacccaccg ccagcccttc ccctacaccg tggccaagct gcatgagctg     21480
     tgcggcagca acgcaaagtc actaaaggac ttcgaggaaa agacgctggc cacggccttg     21540
     gaagacttgg ccaccgtcgc caagagccac ggcgagcact tccgctacct ggttgagcgc     21600
     tgtcccggcg gcaagtcgct tgtacacgtc acccgcaatc cagacgccaa gctaccgttg     21660
     aaccctcaaa tctgtggata acttgccata atctgttgat aacttgccat aatctgtgga     21720
     taaattaccg tcgtagcatc cgcgctttta ccgtcgtagc atccgcgcgt accgtcgtag     21780
     catccgcact tttaccgtcg tagcatccgc gcttttaccg tcgtagcatc cgcagaattt     21840
     cgggcttgaa gtcggttttt tacgttatga atcaacgact tacaagcctg tggataactc     21900
     cctaatcttc tttaatactt cttttaatac tacgcgcgcg ggttacgcac aaacccccgt     21960
     ggacgttgaa ccccctttca agtgtccccc cttcaggggg gaagaaacgt gggctacgcc     22020
     caccccccag ggggcgaaac gccccctcta aacgcgctta ggcgcgtttc tcaccccaaa     22080
     aagtccaaaa gacagtaaat cgaggccccc cgctgggggg caccacaaag ggccgctttg     22140
     cggcttctcc ccccggcgtc ccgcccgcgc cctaggggcg ctccttggcg aggggcatgc     22200
     tgcccctcgg ctcccctgtg ggctgcgccc ccctactgtc ggctgaacgc cgacagaggc     22260
     accccctgca tctgctcatg aatggaaaag ggggcctctc ctcgaaacac catcgcagaa     22320
     cccaccagaa cggcgtttga gcggtttttt agagctgccc agggggtagt ggcttgccaa     22380
     ggccaccacg ggcgctatgg ccgcaagggc gacaaacacc aaaacacgca agaaaccggg     22440
     cgaggctcca tcgaccaggt ggccaccggc tggccagacc gccgcagagc tggccgagca     22500
     gaagaaagcc atccaggccg ctcccgccga acgcgaccag gcgcggtccg agctggcgac     22560
     cgtgaaggcc aaggccgaag ccgccgccca ggaggcccac cgcgtggccg agcggctgac     22620
     aaaagcccag ggcgagcgcg accaggcgcg aacccgatgc cgccgcgacc cgcgaagaat     22680
     tggcgaaaat caggggccag cttgaggcat ccgaagccta caaggccgag tttctgggga     22740
     tgctcagcaa gggcgatcag tcacaagcca agaaggggct aaccaccaag aaaggcgcgt     22800
     gaaacggata agtcttgcct gatttttcag gcaaaatatc accattttta gagaggaaaa     22860
     aagatgaaac tttcgcgtgt tttagctaca ttttccgtgt cgtttgccgc cactttttcg     22920
     agtgcagcac acgcggacga ttggggttgt gaggtgcttt tgtgcctctc taaccctgct     22980
     ggcccaatgg ccgtttctca gtgtgttccg cccatcaagc ggctgtatgc agccatcttc     23040
     aagtggaagc ctgacccctt cccaacgtgc accatggcca ccagccagaa cggcacgcgc     23100
     agctatgcca gcgtcgagta caacaactac tacgaaccct gccctgcagg tacaagcgcc     23160
     ctttcctcgg gcagcaatgc cgtgcaaggc acacccgcgc aagtccaggc acagaacaac     23220
     gccggatggt ggggcaatgg cccctttacg agcttttccg tgggcattgg tgacggtgct     23280
     ggcctctacc cgagcgagga caagccacta ggcaaaaagg tctgtgtggg caacgctgtt     23340
     ggcactgtga atgtcaccgt gggcagcaat tgggaggacc gcaccaccta ccaagtgggc     23400
     gtttacgacc gcgtggcctt cattgaccaa tccttgaatg gcttcgccat caaggtgttc     23460
     attaacaaca atttgtaccg cacgattcgc cctcaacttt aatgcagctc ggtgaaggca     23520
     acgacgccgg catcgaactg aaggcccgcg actccatcaa cggccgcacc cagaccttca     23580
     ccgtcagcac tgccggcgtg gacagcgtcg agcgtggcga cggctacgcg gacctggaag     23640
     cctcgccaga aacgctggag gcctatcaag cgtttgaggc tgcgcgcggc gtgccgctac     23700
     acgacatgct ggctcgactc cagcgcctgc tgaagggggc cgaggcatgg cacaagcaca     23760
     acccctgatg aatagcccga cgccggtcga ggtctgggcc gcccgggaga ggtccggcct     23820
     gacccagacg gaagctgccg ccctggtgca tggcaccctg cgggcttggc agggctggga     23880
     ggcaccagaa ggcgagccgg ccgcgcgccg catgcatccc gggctctggg agctgttcca     23940
     gatcaagacc aaggcgtgac gatgggcgga aaaacagcaa tcaggcgagg aggtgccgtg     24000
     ttggccagcc tgttgatttg cgtaattgaa ccggccggcg cggcctccct ggtcggcggt     24060
     caaaccgacg actccgtgtg cgacctgggc agcgcgccac agaacgcccg gaagctgtcg     24120
     gcagcgggtg acttcatccg ggcgcagtgc aaaaacggtc aagtactggt gggctccggc     24180
     atcgtgccgg tcggtggatt tgactcggag gtcgtgcgcc aggcgcgcac cttctgccgc     24240
     ctggtggaca ttcagacccg gcgcatacag ggcaacatgg ccggcctcgt catggagatt     24300
     gacgaggtac ggtgcaccat cgggaagctg ccgacatgag aaaagcgctg ctggctggcc     24360
     tcctggccgt tgtggcggca aacgtggttg ccgctgatgg cggccatcga tgatctgtcc     24420
     ggcgaaattc accaggccaa acgcgaccag gccgagcagg accgccaggc gcaacagcgc     24480
     gaccaggccg aacgggagcg catcgagcgc atgagcgctg tcgagcttgc cgccgagatc     24540
     gagcggcagc ggccgccgcg tgcgcttgac ctggtagagc gtgaccaggc cgttttgaag     24600
     gccgaaggcg agcgccaggc gctccagaac cagcacaccg aagcaggcag cgcctcagcc     24660
     cgcgaccagg cgcaggcatg gcgcgaagcg cacaaggtac aggcgtggct tcacgacaag     24720
     ggcatcggcc acgcgcccga actgcgcgag ctggagaaac agcgcgcagc gcagcacacc     24780
     gaatggcagc gcctcgggcc tcgcgtcctc gatgccgagc agcgggccag cagcgcccgc     24840
     gacatggccc gcctacgcat ccagcccgaa cagtccccgg cgctggccaa ggtggccgag     24900
     ctggagaagc tacgctaggc caaggcccgg caggaactgg agcaaaagca gcgccaggac     24960
     gccgagaaac gggcagagcg agagcggcag aaggtgcccg aggacttcgc cgcgatggcc     25020
     cgcaagcgcg agatgaaggc cagcggctgg agtgatcggg gcgagcagtg gaaggccgcg     25080
     ccggagaact tgcgcgggct gatcgacagc tacaacgccg cgcccaaaga ggctcgcact     25140
     gccatcctcg accgcatcct gagcgacagc agcaggcgcg agcaggtgcg cggccttatg     25200
     gccgagcagc gggagaacta ccgagagaac gataggggat attctcgttg aatgtatatt     25260
     caaatataga tacaatgacg gcatgaagct tgaatgggat gccgacaagg ctgcactgaa     25320
     tctgcaaaaa cacggcatct ctttcgagga cgccgcactt gtcttttatg acgatgggcg     25380
     catcgagtcc tacgacggac gcgaggacta cggggaagat cgctgggcaa cgattgggtt     25440
     ggctgtctgg tctgttttgt acgtggtcta caccgttcga gaagaggaat ccatccgcat     25500
     catttctgcc cgaaaggcca tttctcatga gcaacagcaa tatcgtgaag cgaactcttg     25560
     atctgaaaaa tccccctgtc gtgacggacg agcagcgggc acggctggct gcgttggcat     25620
     ctatgcctga tgaccagatc gacacgagtg acgcgccatt tcgaccggat gccgtttggg     25680
     cgaaagcggt agatttcccg catggaaaga agcagatttc gctgcgcatt gacgaggacg     25740
     ttttgaactt ctttcgccaa acgggaaagc gttatcagac caggatgaat gcagttttgc     25800
     gttcctacgt tgaggcgcac aaggcgcacg cgaaatgaga accggggaag aaatggccct     25860
     cacgctagca gcactgcgcg acagcttcgg cgtggacgta gccccggccc agcacctgca     25920
     cggccaggaa ctggcggcat ggcaggaaca ggccgagaat gccgttttcg agcgcgagca     25980
     cgccgagctg cgggcgcagc ggtctgagtt gaatggcgac gatggcaagg cttgatgatc     26040
     tgcttgcccg catgggcgag attcaggaaa agacccgcca gcgggccgag cgggagcgcg     26100
     agaacgcccc ggccaaggtg gttcagttgc cgctatggcc ggagcctgtc cgggcagtgc     26160
     cgaacggctt tctacggtcg gcactgttcg gcgcgatccg caaggggcgg cggcgcttcg     26220
     tcaagggcga gcagctcgcg gccctcgatg gcatcgagat ccactacacg ggcgaacgcc     26280
     tcgaccaagg tgacctcgac gtgtacgaaa gcgtgctgca cgccgtgcgc cttcaggagc     26340
     tgggcagtca atgccgcgtc acgtcctacg ccttattgaa gctcatgggc aagacggaca     26400
     ctggcaagaa ccgggcgacg ctgctaactc gcatcgagcg cttgcgggcc aatgccatcc     26460
     gcataaagca agagcggtac agcttcatcg gcggactggt cgatgaggcc tacaaggacg     26520
     aggaaacgca ggaatgggtg attgtgctga accccaagct gcgggctttg tacggggccg     26580
     accagttcac accattcccg tttaaggtcg aaaccttgct caagctgtgt ggcagtgagg     26640
     acgcgagtcc gaccagcggg cggcagaagc tgcggaaggc gttggatgct gtgacagagg     26700
     ccagcgcagc ccacggcgag gggttcagct acgagattcg cggcgacctg gtgcacgtcg     26760
     aaaagaaggc cagcggaacg cagcggctgc acttggccaa gaaggcagcg cagcgacgaa     26820
     agccccgcgc ttgatccggt acgccatacc gttccagcag ctacgctatc cacaggccga     26880
     ataggccgaa aagccgcgcc aatgctgggt ttcagccgtc ggcggaaact aagctaatcc     26940
     tttcttaatc cttttttaat ccacgagtgc gcgtgcgcag cgctcaccgc gtgtgttcga     27000
     cgcgcaatca ccaggccccc cgctgggggg cagagcaaag ggcgtagccg ctgcgcgtct     27060
     cgctctcccc caggtgaggc gcaagcgctg tgccgataac caccgctgcg cagcaccagg     27120
     cgcagcaaaa ccccgctttc cagggcgcga agacgggcgg cggcttgcag aggctgtgcc     27180
     ccgcgttcgt gcctggcgcg gttttgagcg ctgcaaaaca gccgccacca tcaggggcta     27240
     cgcccccgat acccccctgc aagggccgga aacgggccta gaaggcgctc aatggggctt     27300
     gggtgtgggg tttgtgtatg tccgaggggg ttaaaacgcg cctacgggcc gttttgaggc     27360
     ttttcagggt atggggcagc gcccatgtcg ccttccaatg cggcccgtgc ccagctcatg     27420
     gggcaccacg gccagtcgca gccctcgcac tggcgcagtg ctgaccgcgt tgctgcgccc     27480
     ggcctgcacc gaactgccgc ccactgcggc gccctgagaa atggacacgc cgaggttctt     27540
     ggccgactcg atcttgctgt cggtcatctt cggcttgcgc ccaagcaggg cacagtgacg     27600
     gcctcgctga tgctgcgcaa gctcggcagc tatccgcgtc agaacggcct ggccgtggcg     27660
     ctgcgcgagc tgggccgtat cgagcgcacg ctgttcatcc tggactggct gcaaagcgtc     27720
     gagttgcgcc gccgggtgca tgccgggctg aacaaggggg aagcgcgcaa cgcgctggcc     27780
     cgcgccgtgt tcttcaactg cctgggcgaa atccgcgacc gcagtttcga gcagcagcgc     27840
     taccgtgcca gcggcctcaa tctggtgacg gcggccatcg tgttgtggaa cacggtctat     27900
     ctggagcggg cagcgcatgg gctgcgtggc aacggtcatg tcgtagatga tgcgctgttg     27960
     cagtacctgt cgccgttggg ctgggagcac atcaacctga ccggcgatta cctctggcgc     28020
     agcagcgcca aggtcggcgc gggcaagttc cgaccgctac gaccactgcc accggcttgg     28080
     cgtgctttaa ttttccgttt tctgagacga ccccaacatg acctactcac ttcccaaacg     28140
     tgccgccatc cacttgctgg ccatggccgt gctgctggcc agcggctgcg catcagtggc     28200
     cgtcagcaat gacgctatcg agcagaacac cgcccaagcc ctcggcctgg ccaaaggcac     28260
     gttctcacca tcagcgaccg cgtggacgat ggcgtgaagg ccagttacag cgtcaagacc     28320
     aacaccggca agcagtacgc ttgctacgtc accggaggcg tttccattgt tggccgcgtg     28380
     gtgtctgacc cgatgtgtac ggaagtcgga aaggcgggca agcaggcgac gacaggtgcc     28440
     acgagcaacg cctcttgcaa cgcccttttg aaggctgcgg gcaagtgcca ataacgcggc     28500
     cacgttgacc acgaaaaagc ccggctctgc tgggcttttt ttcgtctgaa aagctcaaag     28560
     gccaaaaggc ccgcacgcac aaaggcagta tgaggttact agcgctgtca gtgaggtttg     28620
     ccagtagccc cattctatgc cctatttcag cactgcgaaa gccatcccga ccccgaccag     28680
     gacaccggcc ccaaaaacca acggcaagag ccaccaaagc agcgtgccgt gacggcttga     28740
     ttttgtcggt gccggtgggc ttgcggatgc tgcaacggca cccgcttgag ctggccttgc     28800
     ggccaggttg tccagcgaga tttttatctc gttggtgcgc tgcatgaact tcgacagcgc     28860
     ctcattggcc actgaaacga aatcatccac gttgcgcgtc gtcacagcgt tgaatttttc     28920
     ggttgcagct tcgagctgaa ttgctgcctc actcgttcga ctttcgagca ccaagagatt     28980
     cagatcgacc aggagaaagg ccgggtcgtc ctcagtcaac ttgatgcccg atttttcaac     29040
     gagcgccgcg attaactggc gcttgttcac ttagaacccc accgccgcca actgctcgtt     29100
     gaggtcgcgt tgcacggtct tcatgcgttg cttggccatc aacgcaaagt ccgtaccgct     29160
     cagaacttcg gcaaacgtga gctttttgga tgtcatcagc tccatatctt tgccgaacgt     29220
     gtcttggttg cgttcaggaa ttcgcacgat gccgcgaacc ttgtcagcgt ggtcggtgta     29280
     caccttcatc tccgtgaaag tcttcccgct ggcctcaatc ggcccgaaat actcattgag     29340
     ccagataacc atgtttctgg tgtccgcttg ttcagccagg attttgaagc cggccagcgt     29400
     atccatcaac gcttggccac cagtcaaaac actgtgaatg aatacctcgc gcccagcctc     29460
     ttggagcatg gcaatcgcgt tgttttcaat caggtaattt gacaaaggca cgaagctaga     29520
     cgcgccgtta tcaaccacaa aaacaccgtc ttctgtcatc aatcgttcca tcaactgatc     29580
     gaagtttcgt tcattgattt tggaaccatt catgagctgg acgtgctgcg cattaagcgc     29640
     tttgtagttc gccagggttt ggttaactgg gtcggtatcg acgcacttaa ccgtgcatcc     29700
     ttcaatactt tggaagtatt gagcgagcag ggaggaaacc aaagatttac ccacgccacc     29760
     tttgccttgc agggtgaagt gaacagagtt cttcggagcg gttttagctg gttttgctga     29820
     cattgaacaa cctcatcaaa tcaaatcgtt ttcatcaacg gaattggttc ctttgaactc     29880
     gaaccctgct ttttttgtga gtggattcgg tggaatttcc tgtttctttt ggtctggttt     29940
     ttgtgctacg gatggtgcat atttttgctc cttttgtgat gcgggtttag cggatgctgc     30000
     gacggtcttt tgtgcggcac ggatgcgggc gcggtagagg aagttgcgga agcccttcag     30060
     cgtcgttttg tagccgtgtg cttccagctc ggccacgatg acctcttgac gcacgcccac     30120
     ctctagccgt tcttccagct ctttgaggtg ctgccgtatg tacccggcga ggctttgggg     30180
     tggtttcatg gtgttgtcct tgttcaaggc tcacattatg gtgtcttttt ggttgtcctg     30240
     caagtttttg atgattttgt ggtgtcttta tggtgattga aacacttttt tggtggcgtt     30300
     ttggtgatct tttggggttt aatgggtagt gaggaggaga aagacaaggg gaaatggtgt     30360
     agcattttct aatgcaggat aggctatcgc cggtagttgt tgctacaact agcacgctta     30420
     acggcgtggt gatgttttgg tttcccccat ttaattggtg atgttatggt gataggacgc     30480
     gacatgctca gggtggacgg cgtaccaccc gagacgaaga agcagcttca agaagcggcc     30540
     aggcagctct acggcaagcc gaatgcgtcc ctactcgtgc gcaccctgat tgcgggccac     30600
     ctgtcaaaat ccggggcgac ggcacagcca ctgacggcag cggatgccgg ggacactgtg     30660
     cgcgttgagc ttcgcttgcc gcgtgcagct ttggagcaag tcaacgactt ggccgagggg     30720
     cgtttttctg ccagaaatta ctacctcacc aatgtgattc tggcccacct cgggcaacct     30780
     caattgcatg gtgatgaaat tgaggttttg cgccgctcaa attacgagct ggcaaaggtc     30840
     ggcaccaacc ttaaccaggt ggcgaaggca tttaatacgc tggtgaaaat gcggggggct     30900
     gaaaagatcc ccgaagtggg caagaaaatt gcctcacttc gccgcgagat aacggagcac     30960
     actggcaagg tgcttcgggt gctagaggcg ggcactacgg tatgggaagc caaggggcgc     31020
     ggccaacggc agcgcaagcg caaatagttt gaaagggcac atcatgttag acttgggtat     31080
     caatagcggc agcatcagct acgaagtggc cttagaagtt cttggccaga gccgccaacc     31140
     cttcatgcag gccattcacg aagagcggca gaagcccgca ccgtcgcagg tgtt           31194
//

If you have problems or comments...

PBIL Back to PBIL home page