(data stored in ACNUC7421 zone)

EMBL: CP000545

ID   CP000545; SV 1; circular; genomic DNA; STD; PRO; 2284095 BP.
XX
AC   CP000545; AAHM02000000-AAHM02000002;
XX
PR   Project:PRJNA13943;
XX
DT   31-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Burkholderia mallei NCTC 10229 chromosome II, complete sequence.
XX
KW   .
XX
OS   Burkholderia mallei NCTC 10229
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; pseudomallei group.
XX
RN   [1]
RP   1-2284095
RA   DeShazer D., Woods D.E., Nierman W.C.;
RT   ;
RL   Submitted (05-JAN-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [2]
RC   Protein update by submitter
RP   1-2284095
RA   Brinkac L.M., Harkins D.M., Shrivastava S., Durkin A.S., Sutton G.;
RT   ;
RL   Submitted (21-OCT-2009) to the INSDC.
RL   The J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850,
RL   USA
XX
DR   MD5; f2063a4fd47c1462201e1e450601b2c0.
DR   BioSample; SAMN02604032.
DR   EnsemblGenomes-Gn; BMA10229_0003.
DR   EnsemblGenomes-Gn; BMA10229_0004.
DR   EnsemblGenomes-Gn; BMA10229_0005.
DR   EnsemblGenomes-Gn; BMA10229_0006.
DR   EnsemblGenomes-Gn; BMA10229_0007.
DR   EnsemblGenomes-Gn; BMA10229_0024.
DR   EnsemblGenomes-Gn; BMA10229_0453.
DR   EnsemblGenomes-Gn; BMA10229_0839.
DR   EnsemblGenomes-Gn; BMA10229_0925.
DR   EnsemblGenomes-Gn; BMA10229_0926.
DR   EnsemblGenomes-Gn; BMA10229_0927.
DR   EnsemblGenomes-Gn; BMA10229_0928.
DR   EnsemblGenomes-Gn; BMA10229_0929.
DR   EnsemblGenomes-Gn; BMA10229_1077.
DR   EnsemblGenomes-Gn; BMA10229_1713.
DR   EnsemblGenomes-Gn; EBG00001244925.
DR   EnsemblGenomes-Gn; EBG00001244926.
DR   EnsemblGenomes-Gn; EBG00001244927.
DR   EnsemblGenomes-Gn; EBG00001244928.
DR   EnsemblGenomes-Gn; EBG00001244929.
DR   EnsemblGenomes-Gn; EBG00001244930.
DR   EnsemblGenomes-Gn; EBG00001244931.
DR   EnsemblGenomes-Gn; EBG00001244932.
DR   EnsemblGenomes-Gn; EBG00001244933.
DR   EnsemblGenomes-Gn; EBG00001244934.
DR   EnsemblGenomes-Gn; EBG00001244935.
DR   EnsemblGenomes-Gn; EBG00001244936.
DR   EnsemblGenomes-Gn; EBG00001244937.
DR   EnsemblGenomes-Gn; EBG00001244938.
DR   EnsemblGenomes-Gn; EBG00001244939.
DR   EnsemblGenomes-Gn; EBG00001244940.
DR   EnsemblGenomes-Gn; EBG00001244941.
DR   EnsemblGenomes-Gn; EBG00001244942.
DR   EnsemblGenomes-Gn; EBG00001244943.
DR   EnsemblGenomes-Gn; EBG00001244944.
DR   EnsemblGenomes-Gn; EBG00001244945.
DR   EnsemblGenomes-Gn; EBG00001244946.
DR   EnsemblGenomes-Tr; BMA10229_0003-1.
DR   EnsemblGenomes-Tr; BMA10229_0004-1.
DR   EnsemblGenomes-Tr; BMA10229_0005-1.
DR   EnsemblGenomes-Tr; BMA10229_0006-1.
DR   EnsemblGenomes-Tr; BMA10229_0007-1.
DR   EnsemblGenomes-Tr; BMA10229_0024-1.
DR   EnsemblGenomes-Tr; BMA10229_0453-1.
DR   EnsemblGenomes-Tr; BMA10229_0839-1.
DR   EnsemblGenomes-Tr; BMA10229_0925-1.
DR   EnsemblGenomes-Tr; BMA10229_0926-1.
DR   EnsemblGenomes-Tr; BMA10229_0927-1.
DR   EnsemblGenomes-Tr; BMA10229_0928-1.
DR   EnsemblGenomes-Tr; BMA10229_0929-1.
DR   EnsemblGenomes-Tr; BMA10229_1077-1.
DR   EnsemblGenomes-Tr; BMA10229_1713-1.
DR   EnsemblGenomes-Tr; EBT00001590426.
DR   EnsemblGenomes-Tr; EBT00001590427.
DR   EnsemblGenomes-Tr; EBT00001590428.
DR   EnsemblGenomes-Tr; EBT00001590429.
DR   EnsemblGenomes-Tr; EBT00001590430.
DR   EnsemblGenomes-Tr; EBT00001590431.
DR   EnsemblGenomes-Tr; EBT00001590432.
DR   EnsemblGenomes-Tr; EBT00001590433.
DR   EnsemblGenomes-Tr; EBT00001590434.
DR   EnsemblGenomes-Tr; EBT00001590435.
DR   EnsemblGenomes-Tr; EBT00001590436.
DR   EnsemblGenomes-Tr; EBT00001590437.
DR   EnsemblGenomes-Tr; EBT00001590438.
DR   EnsemblGenomes-Tr; EBT00001590439.
DR   EnsemblGenomes-Tr; EBT00001590440.
DR   EnsemblGenomes-Tr; EBT00001590441.
DR   EnsemblGenomes-Tr; EBT00001590442.
DR   EnsemblGenomes-Tr; EBT00001590443.
DR   EnsemblGenomes-Tr; EBT00001590444.
DR   EnsemblGenomes-Tr; EBT00001590445.
DR   EnsemblGenomes-Tr; EBT00001590446.
DR   EnsemblGenomes-Tr; EBT00001590447.
DR   EuropePMC; PMC2168593; 17933898.
DR   EuropePMC; PMC2612704; 19038032.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP000545.
DR   SILVA-SSU; CP000545.
DR   StrainInfo; 341634; 0.
XX
CC   The bacteria and source DNA are available from David DeShazer
CC   (David.DeShazer@det.amedd.army.mil).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2284095
FT                   /organism="Burkholderia mallei NCTC 10229"
FT                   /chromosome="II"
FT                   /strain="NCTC 10229"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:412022"
FT   gene            5..76
FT                   /locus_tag="BMA10229_0001"
FT   CDS_pept        5..76
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0001"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99963"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW4"
FT                   /protein_id="ABM99963.1"
FT                   /translation="MAGKPTPGLDHYMRAVARAAIAK"
FT   gene            115..228
FT                   /locus_tag="BMA10229_0002"
FT   CDS_pept        115..228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0002"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99364"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW5"
FT                   /protein_id="ABM99364.1"
FT                   /translation="MSRANARLACRAGAPMRAAPSLRGGVKNSFKKRLHEA"
FT   gene            697..2184
FT                   /gene="rrsA"
FT                   /locus_tag="BMA10229_0003"
FT   rRNA            697..2184
FT                   /gene="rrsA"
FT                   /locus_tag="BMA10229_0003"
FT                   /product="16S ribosomal RNA"
FT   gene            2267..2343
FT                   /locus_tag="BMA10229_0004"
FT   tRNA            2267..2343
FT                   /locus_tag="BMA10229_0004"
FT                   /product="tRNA-Ile"
FT   gene            2378..2453
FT                   /locus_tag="BMA10229_0005"
FT   tRNA            2378..2453
FT                   /locus_tag="BMA10229_0005"
FT                   /product="tRNA-Ala"
FT   gene            2807..5688
FT                   /gene="rrlA"
FT                   /locus_tag="BMA10229_0006"
FT   rRNA            2807..5688
FT                   /gene="rrlA"
FT                   /locus_tag="BMA10229_0006"
FT                   /product="23S ribosomal RNA"
FT   gene            5870..5985
FT                   /gene="rrfA"
FT                   /locus_tag="BMA10229_0007"
FT   rRNA            5870..5985
FT                   /gene="rrfA"
FT                   /locus_tag="BMA10229_0007"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(6230..7063)
FT                   /locus_tag="BMA10229_0008"
FT   CDS_pept        complement(6230..7063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0008"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98740"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABM98740.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(7087..7350)
FT                   /locus_tag="BMA10229_0009"
FT   CDS_pept        complement(7087..7350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0009"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00122"
FT                   /db_xref="GOA:A2RVW7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW7"
FT                   /protein_id="ABN00122.1"
FT                   /translation="MKKRFTEQQIIGFLKEAETGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            complement(7496..7906)
FT                   /locus_tag="BMA10229_0010"
FT   CDS_pept        complement(7496..7906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0010"
FT                   /product="glcG protein"
FT                   /note="identified by match to protein family HMM PF03928"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99769"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW8"
FT                   /protein_id="ABM99769.1"
FT                   /translation="MRTKPVLTSDDVNKMAAAAEAFAAANQWAVTVAIFDDGAHLLHLH
FT                   RMDGAAPSTVEMAIGKGRTAALGRRESKVYEDIVLQGRISFLSVPLVGLVEGGVPIVVD
FT                   GETVGAIGVSGVKSEQDAAVARAGIAALTDAG"
FT   gene            complement(7966..9366)
FT                   /locus_tag="BMA10229_0011"
FT   CDS_pept        complement(7966..9366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0011"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98902"
FT                   /db_xref="GOA:A2RVW9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW9"
FT                   /protein_id="ABM98902.1"
FT                   /translation="MSAVAGCRRTSLVAQAGHWMQRHGALIRGIQWVVVLVYAFLILVP
FT                   AFTPLPDDTAHLWSNLTLAAQFVFWGIWWPFVLLSMVMLGRVWCGVLCPEGALSEFASK
FT                   FGRGRAIPRWMRWGGWPFVAFGLTTIYGQMVSVYQYPRAVLLVLGGSTLAAIVIGFLYG
FT                   REKRVWCRYLCPVNGVFSLLARLSPLRYKVDEDAWRRSYRKGEDGHRVIPINCAPLVPL
FT                   RNMKGAAACHMCGRCSGHRGAIELTARSPSEEVVALGDRQASSWDTALILYGLLGIAIG
FT                   AFHWTVSPWFVQIKQTLAGWLIDHDIMWPLDTNAPWFIFTHYPEHNDVFSWLDGSLVIA
FT                   YIVGTGLAYGTALAVLLAGAAAMLGRFERVRLHHLAQALIPLAGAGVFLGLSATTLSLL
FT                   RAEHVPLGWAPDVRIAILVGANLWSAWLAWLVTGRYASWPRRLLAMLWFGAALAVVDSA
FT                   WWLMFWGF"
FT   gene            complement(9363..10205)
FT                   /locus_tag="BMA10229_0012"
FT   CDS_pept        complement(9363..10205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0012"
FT                   /product="iron transporter, OFeT family"
FT                   /note="identified by match to protein family HMM PF03239"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98560"
FT                   /db_xref="GOA:A2RVX0"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVX0"
FT                   /protein_id="ABM98560.1"
FT                   /translation="MGQILFIVWRESVEALLVVGILYAWLKNGDDEARRGLPYLWAGVG
FT                   AGLLMAVGLGAALVGFTEVLSGDAQDYFQTAMVLIACVLIVQMVLWMKQHGRTLKRDME
FT                   RSLQKSTQDANWWGVAVLVALAIAREGSETAIFLYGLGFGQSGHVDGSQMLAVLIGLGL
FT                   AFLTFYVLQLGGKYFSWRHFFRVTEIMLLFLGAGLFQTGIDKLIDKEILPLGIAQLWDT
FT                   SAILDDSSTFGSLVSTLTGYRAHPSLTNLVAYVAYWAIVYLLLKRAARRPAATAGRPA"
FT   gene            complement(10265..10594)
FT                   /locus_tag="BMA10229_0013"
FT   CDS_pept        complement(10265..10594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0013"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99919"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVX1"
FT                   /protein_id="ABM99919.1"
FT                   /translation="MTFPRAYAFAAAILVAGAAHAADLPTFRLEMADGKLNPARIEVPA
FT                   GQRIKIQIRNTGKGAVEFESVQLRKEKVLAPGGESFVVIAPLSPGEYKFFDDFHQQAQG
FT                   VIVAK"
FT   gene            complement(10654..11205)
FT                   /locus_tag="BMA10229_0014"
FT   CDS_pept        complement(10654..11205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0014"
FT                   /product="putative antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99302"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="InterPro:IPR038482"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVX2"
FT                   /protein_id="ABM99302.1"
FT                   /translation="MLRSSFVRSGVALAAACAALSATAAEYPIGKHQIQGGMEIGAVYL
FT                   QPITMDPEGMMRKASDSDIHLEADIHAVKNNPTGFAEGDWMPYLQVTYKLTKQGDAKWA
FT                   AQGDLMGMVASDGPHYGDNVKLNGPGKYHLTLVVKPPMQTGHMAFGRHVDKETGVGAWF
FT                   KPITLEYDFPFAGIGKKGGY"
FT   gene            complement(11429..13552)
FT                   /gene="uvrB"
FT                   /locus_tag="BMA10229_0015"
FT   CDS_pept        complement(11429..13552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="BMA10229_0015"
FT                   /product="excinuclease ABC, B subunit"
FT                   /EC_number="3.1.25.-"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM TIGR00631"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98791"
FT                   /db_xref="GOA:A2RVX3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVX3"
FT                   /protein_id="ABM98791.1"
FT                   /translation="MPVSARRLRIHMSEHHSDTRDDLDESKFVTFEGSPFQLYQPYPPS
FT                   GDQPTAIATLVEGVEDGLSFQTLLGVTGSGKTYTMANTIARLGRPAIVFAPNKTLAAQL
FT                   YAEFREFFPRNAVEYFVSYYDYYQPEAYVPQRDLFIEKDSSINEHIEQMRLSATKSLME
FT                   RRDVVIVATVSAIYGIGNPSEYHQMILTLRTGDKIGQREVIARLIAMQYTRNEQDFQRG
FT                   TFRVRGDTIDIFPAEHAEMAVRVELFDDEVDTLHLFDPLTGRVRQKIPRFTVYPSSHYV
FT                   TPRETVMRAVETIKDELRERLEFFHRDGKLVEAQRLEQRTRFDLEMLQELGFCKGIENY
FT                   SRHFSGAAPGEPPPTLVDYLPPDALMLLDESHVLIGQLNGMYNGDRARKENLVDYGFRL
FT                   PSALDNRPLKFPEFERKMRQVVFVSATPADYEQRVSGQTAEQVVRPTGLVDPQIEVRPA
FT                   STQVDDVLSEITERVKANERVLITVLTKRMAEQLTEFLADHGVKVRYLHSDIDTVERVE
FT                   IIRDLRLGTFDVLVGINLLREGLDIPEVSLVAILDADKEGFLRAERSLIQTIGRAARNV
FT                   NGKALLYADRITDSMRRAIDETERRRAKQIAYNEKMGITPRGVVKRIKDIIDGVYNADE
FT                   ARAELKEAQQRAKFEDMSEKQIAKEIKRLEKQMADYAKNLEFEKAAQTRDQLALLRERV
FT                   FGANVGDHVSGGE"
FT   gene            13807..15006
FT                   /gene="tyrB-2"
FT                   /locus_tag="BMA10229_0016"
FT   CDS_pept        13807..15006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrB-2"
FT                   /locus_tag="BMA10229_0016"
FT                   /product="aromatic-amino-acid transaminase"
FT                   /EC_number="2.6.1.57"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00374"
FT                   /db_xref="GOA:A2RVX4"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVX4"
FT                   /protein_id="ABN00374.1"
FT                   /translation="MSLFSAVELAPRDPILGLNEAFNADTRPTKVNLGVGVYTNEDGKI
FT                   PLLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVTAQALG
FT                   GTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDG
FT                   MLAALNGYEPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGES
FT                   IEADAAAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKRVI
FT                   RTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIERDF
FT                   SFINAQRGMFSYSGLTSAQVDRLREEFGIYAVSTGRICVAALNTRNLDVVANAIAAVLK
FT                   "
FT   gene            15120..16613
FT                   /locus_tag="BMA10229_0017"
FT   CDS_pept        15120..16613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0017"
FT                   /product="ISBma2, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99213"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVX5"
FT                   /protein_id="ABM99213.1"
FT                   /translation="MGGFLFFNGVMLKTPMPTQHELEMVTLEELVPKDHLLRQIDAAVD
FT                   FEFIRAKVAHLYCADNGRPALDPVVMFKLLFIGYLFGVRSERQLMREVQVNVAYRWFAR
FT                   FRLTDKVPDASTFSQNRRRRFTDTTVYQEIFDEIVRQAIKRGLVDGRVLYTDSTHLKAN
FT                   ANKGKFDVVKLEQTPAAYTEALNAAVDADRAAHGRKPLDRDDDEPPSSKDTKLSRTDPD
FT                   SGYMVRDDKPKGFFYLDHRTVDAKHAIITDTHVTPASVHDSQPYLDRLDRQRERFEFKV
FT                   EAVGLDAGYFTPAVCQGLEERGIAGVMGYRTPNHKPGMFYKRQFKYDAYRNEYVCPQGQ
FT                   ALPYSTTNRLGYREYKSNAQICGRCPVRSQCTNSAIAVKVVTRHVWERAKERVDARRLT
FT                   EWGQRIYARRKQTVERSFADAKQLHGHRYARMRGLRKVAEQCLLAAAAQNIKKIAMLLA
FT                   RKRKKGPAGPDWRFVRMLLRLVSGLRCSFDYPLAANPQS"
FT   gene            complement(16818..17606)
FT                   /gene="bdhA-2"
FT                   /locus_tag="BMA10229_0018"
FT   CDS_pept        complement(16818..17606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdhA-2"
FT                   /locus_tag="BMA10229_0018"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.30"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659; match to protein
FT                   family HMM TIGR01963"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98581"
FT                   /db_xref="GOA:A2RVX6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVX6"
FT                   /protein_id="ABM98581.1"
FT                   /translation="MTSNLNGKAAIVTGAASGIGKEIALELARAGAAVAIADLNQDGAN
FT                   AVAELIEQAGGRAIGVAMDVTNEDAVNAGIDKVAQTFSSVDILVSNAGIQIVNPIENYA
FT                   FADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHG
FT                   LLGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQT
FT                   VDGVFTTVEDVAKTVLFLSAFPSAALTGQSFVVSHGWFMQ"
FT   gene            17794..18765
FT                   /locus_tag="BMA10229_0019"
FT   CDS_pept        17794..18765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0019"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98445"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVX7"
FT                   /protein_id="ABM98445.1"
FT                   /translation="MNYRRLGRSGLQVSELSIGSWVTYGNQVDRRAARESLAAARDAGV
FT                   NFFDNAEVYAGGKSEEIMGHALKSLGWPRISYVVSTKFFWGLAEAPNQYHTLNRKYLLN
FT                   AIDASLQRLQLDYVDLVFCHRPDPNTPIEETVWAMSDIIARGKALYWGTSEWSADEIRA
FT                   AYEIADRHHLRKPTMEQPQYNLFHRKRVEQEYRRLYEDFGMGLTTWSPLASGLLTGKYR
FT                   HGVPAGSRAEIHGYDWLRAQLTDPAKNRVVEALGEIANDLGCTVGQLALAWVLKNPRVS
FT                   TVITGASRVEQIIENMRSLDVATQITPDMKQQIEQIVGDAYQ"
FT   gene            18914..19759
FT                   /locus_tag="BMA10229_0020"
FT   CDS_pept        18914..19759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04378"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00292"
FT                   /db_xref="GOA:A2RVX8"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVX8"
FT                   /protein_id="ABN00292.1"
FT                   /translation="MLSYRRGFHVGNHADVLKHTVVVQLLRYLNKKDKSYWYIDTHAGA
FT                   GVYSLFDGYAAKTGEFGTGIEKIWDATDLPEALSDYVDEVRALNRDGELRYYPGSPYLA
FT                   WRLMREQDRMRLFELHSTEIDVLRHNFRDAGRRAMIYAGDGFEGIKALLPPPPRRALVL
FT                   VDPSYEDKRDYAKTIACVEESLKRFATGCYAIWYPQVSRPESQKFPDHLKQLQPNNWLH
FT                   LSLTVSRPPSDGFGLFGSGMFILNPPYTLVDTMKEALPYLVEALGQDSGAKFAIEHRAN
FT                   "
FT   gene            complement(19772..20050)
FT                   /locus_tag="BMA10229_0021"
FT   CDS_pept        complement(19772..20050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00001"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVX9"
FT                   /protein_id="ABN00001.1"
FT                   /translation="MCVIATTAVAGSDSARAPLILDTQSGIHDGKSGIVLQNAPLSRAP
FT                   IVAPAQPAPMTELPFGSTMGSTAPMVVIPYIEVPGSAVPLKAPPPRQ"
FT   gene            20210..20473
FT                   /locus_tag="BMA10229_0022"
FT   CDS_pept        20210..20473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0022"
FT                   /product="Transposase subfamily"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99065"
FT                   /db_xref="GOA:A2RVY0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVY0"
FT                   /protein_id="ABM99065.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKDLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            20497..21330
FT                   /locus_tag="BMA10229_0023"
FT   CDS_pept        20497..21330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0023"
FT                   /product="IS1404 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99278"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABM99278.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(21610..21686)
FT                   /locus_tag="BMA10229_0024"
FT   tRNA            complement(21610..21686)
FT                   /locus_tag="BMA10229_0024"
FT                   /product="tRNA-Arg"
FT   gene            complement(21893..22177)
FT                   /locus_tag="BMA10229_0025"
FT   CDS_pept        complement(21893..22177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0025"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98794"
FT                   /db_xref="GOA:A2RVY2"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVY2"
FT                   /protein_id="ABM98794.1"
FT                   /translation="MALSKGPGQEFSFLLGTPIIFAAGLLELPKLFHAPDQLADALLGG
FT                   VLTAIAAYLSVRFLMRYFEGRGRLASFGLYCVLAGLFCLGWFMFHAQPV"
FT   gene            complement(22199..23032)
FT                   /locus_tag="BMA10229_0026"
FT   CDS_pept        complement(22199..23032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0026"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99795"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABM99795.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(23056..23319)
FT                   /locus_tag="BMA10229_0027"
FT   CDS_pept        complement(23056..23319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0027"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00280"
FT                   /db_xref="GOA:A2RVY0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVY0"
FT                   /protein_id="ABN00280.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKDLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            complement(23385..23795)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0028"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(23996..24910)
FT                   /gene="glsA"
FT                   /locus_tag="BMA10229_0029"
FT   CDS_pept        complement(23996..24910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="BMA10229_0029"
FT                   /product="glutaminase A"
FT                   /EC_number="3.5.1.2"
FT                   /note="identified by match to protein family HMM PF04960"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99312"
FT                   /db_xref="GOA:A2RVY6"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVY6"
FT                   /protein_id="ABM99312.1"
FT                   /translation="MDYQPILERIHTELAPWIGAGRVADYIPELAKVPAERFGMAVVTL
FT                   DGRIHTVGDARERFSIQSISKLFACTLAFQLLGDALWERVGREPSGNAFNSLVQLESER
FT                   GIPRNPFINAGALIVTDVLCRRFVGAETALVQFMRRLTGVAELDYDLRVASSELAHAER
FT                   NRAMAHFMASFGNLHMPPETVIDAYCRQCAIEMNCIELATAALFLANAGVAPVSGERIL
FT                   DASSAKRLSALMLTCGTYDAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWSPGLDA
FT                   NGNSVAGVQALEQLTTLTGRSIF"
FT   gene            24955..25308
FT                   /locus_tag="BMA10229_0030"
FT   CDS_pept        24955..25308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0030"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00061"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVY7"
FT                   /protein_id="ABN00061.1"
FT                   /translation="MEPSRRRFVKHRLAAATVAVVVAVAAAKETKETKETKETKETKET
FT                   KETKETDKVGKVGKAAIVQTAAVRSEPCAMRAAMRARRRARVRRRRAGHFEAAPHGPPT
FT                   GDFGGRGCDRCVG"
FT   gene            25431..26141
FT                   /locus_tag="BMA10229_0031"
FT   CDS_pept        25431..26141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0031"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99616"
FT                   /db_xref="GOA:A2RVY8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVY8"
FT                   /protein_id="ABM99616.1"
FT                   /translation="MSFRILLVEDDNRLSTLIAGYLRKHEYLVDTVLNGDDAVDAILTG
FT                   RPDLVILDVNLPGKDGFEICREAREHYDGVIIMVTARDEPFDELLGLEFGADDYVHKPV
FT                   EPRILLARIKAQLRRAPVRQADGALAQPESYTFGKFTIDRANRTVSLPDGTTPELTSAE
FT                   FDLLWVLVCHAGEVVSRDDLMLQLRGVEFDGLDRTIDGRISKLRRKLRDDASCPQRIKT
FT                   IRSKGYQFSKNAWE"
FT   gene            complement(26186..26344)
FT                   /locus_tag="BMA10229_0032"
FT   CDS_pept        complement(26186..26344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00092"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVY9"
FT                   /protein_id="ABN00092.1"
FT                   /translation="MRRRTASRSPRHVTPPGTGQAFAVADAARAISHHEMRDVIARRTP
FT                   ARIARTG"
FT   gene            26343..27644
FT                   /locus_tag="BMA10229_0033"
FT   CDS_pept        26343..27644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0033"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98703"
FT                   /db_xref="GOA:A2RVZ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVZ0"
FT                   /protein_id="ABM98703.1"
FT                   /translation="MAKPLGVRRGFTGRNAAPAHVPRAGRPRTPALMPMPAADRRRSGR
FT                   FPPADRRRRFPDIRDPNMNSTQAHRLSPFRYLKWRWLHFRRSWTDTRADRIPSWSRLYL
FT                   RTYLHLVGLVLVTVGGTIAVLCSALGPRTVWRALDALPGGALPLAAFVLAVPALAGYRW
FT                   MRPVWSDLVMVRARAIDFTGGRFNTRARESRSVIIGPLARTLNALAMRMERLIATQRDL
FT                   TNGISHELRTPLARVRFALESLREPGSAAEYQNAIDSIEQDVSELDELIDMSLTYARLE
FT                   YSSLQSNLEQTALVAWFDKQVADAALLYPSKAIEARVALPAELRVKMDKRLMSYAMRNL
FT                   LRNASKHARGRISVGLRIRHGNIEIDVEDDGPGVPPDERERIFDAFVRLDRHTAGYGLG
FT                   LAITRLVLQAHNGRVAVVDPLRLPGARFEMSWPV"
FT   gene            complement(27981..30812)
FT                   /locus_tag="BMA10229_0034"
FT   CDS_pept        complement(27981..30812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0034"
FT                   /product="outer membrane protein, OMP85 family"
FT                   /note="identified by match to protein family HMM PF01734;
FT                   match to protein family HMM PF07244"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99168"
FT                   /db_xref="GOA:A2RVZ1"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVZ1"
FT                   /protein_id="ABM99168.1"
FT                   /translation="MLASSARAGFRVPGFVAALLFVCAATGRPAPAAAADTATVATAAA
FT                   SAAGAPASTTLPPAATPTRVASSAVAASSSASSPASSSASSSASSSASSSASSSASSSA
FT                   SSSASSSASSFASSSASAATPANAAAAWSWTAARRADAPDSSSVSNAVSNSGSNVAGAA
FT                   AAHGPHAPHTVPDAGAGAPSAPTPPAATPAAAGASASTAAAPTPAATDTLVCMPDGGGP
FT                   HRPAIGLVLSGGGARGYAHLGVLKVLEANRIPVDCIAATSMGAVVGGLYATGMTAQDMQ
FT                   RRLSQVNLADIAFDVTERSDLPQKKREDERLYIDSLTIGFDSKGFKAPVGLVQGNRLQA
FT                   LLANWTAAVPTNQPFDRLPIPFRAIATDLQTGQKVVLDHGSLPLAIRASMALPGLFSPA
FT                   EIDGRALVDGGLVGNLPVDAARAMGADVVIAVDIGSPLRPLDALASPADVMQQMIGILI
FT                   RQNVAEQRKQLTANDILLQPDLGKQTFTDFQNANQAIAAGEAAAVAALPRLARYALSPE
FT                   QYEAYRAAHARPQQPIRITSIEIRTNGASVPKQIVRNALHVKPGDVYDPQAVSADLLSL
FT                   TTSGNFENVTQQIINEGDEHRLVIDAQEKYWGPNFLLFGLGMSSSSTDEGGFRLHLGYR
FT                   RPWLTPSGLEFRADTTLGSDMQSVHVELRQPLSNKTGYYVAPYADYKRRFANLYNGESD
FT                   VKVTQYRIQTSRAGLDLGLPLARLGDFRIGLAYTHLSAAPSYSLLLDSWVDDDGNSLSF
FT                   PSWYARQVSARARLVIDQLDDPLFPRKGYFAEFRAERSLATSEDKFTDVYGKLMVAERF
FT                   GRHSVSASVEAGKSFGGVNLSNPFGYTLGGFQHLSAYAADQLSGDALLYGQVTYMNQLA
FT                   TFNASPIKALYLGASAEVGNVWSLDPAFPSGPLKQSYTFFTSLITSFGPVYVGMAFAPG
FT                   GRRNIYFQLGRTY"
FT   gene            31031..32179
FT                   /locus_tag="BMA10229_0035"
FT   CDS_pept        31031..32179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0035"
FT                   /product="putative rod shape-determining protein MreB"
FT                   /note="identified by match to protein family HMM PF06723;
FT                   match to protein family HMM TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99924"
FT                   /db_xref="GOA:A2RVZ2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVZ2"
FT                   /protein_id="ABM99924.1"
FT                   /translation="MLVAGNRPGGRPATHPRNPSTRFNRGFTMAAPFLGRFFAHNVAVD
FT                   PGTASTLIYVRNRGVVLNQPSVVCFRKRGGPAERARVEAVGEQAKALLGRSPEHLEAVR
FT                   PLRHGVVANYHAAEQMMRQFVGMSHARSLFGRRVEFTICVPSNATAVEQRAIREAALAA
FT                   GASRVSLISEPLAAALGAGLPVSEAVGSMVVDIGGGTTEVAVIALGGIVYREAIRVGGD
FT                   QFDAAIVNHVRNLYGVLLGEHTAEHVKKTIGTASCRVPRESIHAIGRSVADGLPRTIEL
FT                   SNHDIADALAAPLNQVVSAVKSALENAPPELITDIADRGLVLTGGGALLANLGKRLHDE
FT                   TGLAARVADDPLTCAVRGAGEAMGRGGFDAGDEDAGDFGMNR"
FT   gene            complement(32231..32455)
FT                   /locus_tag="BMA10229_0036"
FT   CDS_pept        complement(32231..32455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0036"
FT                   /product="cytochrome c4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99288"
FT                   /db_xref="GOA:A2RVZ3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVZ3"
FT                   /protein_id="ABM99288.1"
FT                   /translation="MTYVTYAACASCHRQNGQGAGTFPRLAGQHADYLRRQIDVFKNGT
FT                   RANAPVMSAVAHTLDGDPAKAVAAWLQSR"
FT   gene            32562..33266
FT                   /locus_tag="BMA10229_0037"
FT   CDS_pept        32562..33266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0037"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00037"
FT                   /db_xref="GOA:A2RVZ4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVZ4"
FT                   /protein_id="ABN00037.1"
FT                   /translation="MRGLSRGSRRDARPACEPGAQPRPPRPDRPPSRCRHIDMDIQKIE
FT                   ARLEFLREAERLKSVLRSAHTSTGRAESTAEHSWRLCLMAITLADELPGLDMLKVLKMC
FT                   VIHDLGEALRGDVPAIRADAHPDKSAHERADLLTLTRMLDAPLRDEILSLWDEYERAAS
FT                   QEAQAVKALDKLETILQHAQGENPPDFDYAFNLTYGSRYTSAAPLFRAVREIVDAQTRS
FT                   RIDARGEPPPAR"
FT   gene            33367..35697
FT                   /locus_tag="BMA10229_0038"
FT   CDS_pept        33367..35697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0038"
FT                   /product="amylo-alpha-1,6-glucosidase"
FT                   /EC_number="3.2.1.33"
FT                   /note="identified by match to protein family HMM PF06202"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00495"
FT                   /db_xref="GOA:A2RVZ5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVZ5"
FT                   /protein_id="ABN00495.1"
FT                   /translation="MPRQADPASPRAPQAAASASSSARCAAPGAAPPQSAQPPQSPQSP
FT                   QSPQPAPPTPAFIAPEPDAQKAVRGSQFVLKAGDAFVVSDALGDIAGRDDGLFVDDMRV
FT                   LSQWRLTFGGRAPSLLSGATSADNASFTAHLTNRPLPPLGGRETPEGVIHIERMRVLAD
FT                   NVLHEALTLTNYGTCDAEVPLSVSFGADFKDMFEVRGSRRERRGAVAPPCVEAGAVRLR
FT                   YDGLDAVERSVRIGFEPKPDTLAVDRADYTLTIAAQACVSLYLTVEARVGAAHAGGDAF
FT                   ARRPCVATGRGALRKALADVHRAMRERRRTIARVHTSNPLFNAWLDRSLADLGLLTTSL
FT                   ETGPYPYAGIPWFSTPFGRDAVITSLQMLWLQPSLARGVLRFLAEHQARETSAFRDAEP
FT                   GKIMHEFRKSEMAATGEVPFALYYGGVDTTPLFVVLAGAYLEYTGDESLIDELWPALER
FT                   AAQWVSTVCERNPRGLLDYQRTSARGLANQGWKDSQDSVFHADGRFPSGPIALVEVQAY
FT                   ACAAFDAMATFSRRRGHAADTVRYAQRAKRLREQVEALFWMPEAGFYGIAVDGHGELCR
FT                   VLASNAAHLLAFGLPEQSRGESVARVLGSTLFRTGWGVRTLAAGQPRFNPMAYHNGSIW
FT                   PHDNALAARGLARYGDKRAVLDLLRALFEAAVSFDMRLPELFCGFPRRRGEPPTAYPVA
FT                   CLPQAWAAGAPFMMLQACLGISVDAARGEVRVERPELPEGVDWLRVDDLRVGGDSVSLT
FT                   FRRVEGQVVAAAEPGGARVVAVL"
FT   gene            35793..36056
FT                   /locus_tag="BMA10229_0039"
FT   CDS_pept        35793..36056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99195"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVZ6"
FT                   /protein_id="ABM99195.1"
FT                   /translation="MTNQKPDDARPHDDEPKLEQLEAAVDHLHDSIQSQSIAAGAAKGI
FT                   LFSLIETLGALVGDPDLPEHARSGYEALRDKANELKANLENR"
FT   gene            complement(36292..36534)
FT                   /locus_tag="BMA10229_0040"
FT   CDS_pept        complement(36292..36534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0040"
FT                   /product="epi-isozizaene synthase"
FT                   /EC_number="4.2.3.-"
FT                   /note="identified by similarity to SP:Q9K499"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99535"
FT                   /db_xref="GOA:A2RVZ7"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVZ7"
FT                   /protein_id="ABM99535.1"
FT                   /translation="MHHERISLRAAMREMRALASAQVERFPAGQAEPLRFVAASGAPPE
FT                   IAAAARHCAANMGNWISSVYWFHHESDRYGTARDF"
FT   gene            complement(36534..37394)
FT                   /locus_tag="BMA10229_0041"
FT   CDS_pept        complement(36534..37394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0041"
FT                   /product="putative lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00209"
FT                   /db_xref="GOA:A2RVZ8"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVZ8"
FT                   /protein_id="ABN00209.1"
FT                   /translation="MRRRIDDHLRMDAARSNAASPHARRRRPPCPPRPRRCRRLVGEAC
FT                   RIASIERSFERRFDPHRRALHAHCVRWIGEQSLAPAGSPPADLRALRYPDLVAGYYVGA
FT                   PPAVLEAIAGLSVWFFVWDDRHDEDARRLRRAAWARLRDALCAVLASPRARVADAEPIV
FT                   GALSDCIVLGIRARLGDAWNRRFTGHLRQMIDAYDDEFRARLAARIPTRDAYMRLRERT
FT                   FGCEARLDCLELAAGRALPDAVRAAPPYRLAGPARRSNSPRFTTISVRCARSAKPKKST
FT                   ISAFR"
FT   gene            complement(37397..37645)
FT                   /locus_tag="BMA10229_0042"
FT   CDS_pept        complement(37397..37645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0042"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98893"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVZ9"
FT                   /protein_id="ABM98893.1"
FT                   /translation="MIAAPWLRMGSSIERAARAGTLYRHDERIPPESTRVARKFLAAPT
FT                   RAARRARGVIREPPAHPPVRGATPAGERRVRRGAFDR"
FT   gene            37644..38120
FT                   /locus_tag="BMA10229_0043"
FT   CDS_pept        37644..38120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0043"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99510"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW00"
FT                   /protein_id="ABM99510.1"
FT                   /translation="MPTAVKPIPEGMHSLTPHLICDGAAAAIEFYKKAFDAVEISRLPS
FT                   RDAGRLMHAAVRIGDSTLMLVDEMGQCGALSPKALKGSPVFIHLYVPDVDAVIARAVEA
FT                   GAKLTMPPADMFWGDRYGQLEDPFGHRWSVATHRQDLTPEQIREGMASCVPPAQ"
FT   gene            38167..39078
FT                   /locus_tag="BMA10229_0044"
FT   CDS_pept        38167..39078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0044"
FT                   /product="putative glutathione S-transferase"
FT                   /note="identified by match to protein family HMM PF00043;
FT                   match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99880"
FT                   /db_xref="GOA:A2RW01"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW01"
FT                   /protein_id="ABM99880.1"
FT                   /translation="MCAYVHVCVCVRMRAPARAVRAVRVAGAARMRRRSAMGRRAMVRR
FT                   GGGRRPSFGRPPIACEPARAAVACGVRVSRAPRQSRRNTMSLKFYGHPFSLYCQKVLIA
FT                   LYEYDVPFEWCLLAGDTPQASAEFAARWPLKHMPMLVDGERTIVESTILIEYLGLRRPA
FT                   SVRLVPADAGVALDARMMDRFFDCYVSTPVQKIVFDALRPQAERDARGVADARRMLDTS
FT                   YAWLERTLDGRDWAAGGAFTLADCAAAPSLFYADWAHPIDSALQRVTAYRERLLARPSF
FT                   ARAVDEARPYRHLFPLGAPERD"
FT   gene            39119..39829
FT                   /locus_tag="BMA10229_0045"
FT   CDS_pept        39119..39829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05988"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98591"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW02"
FT                   /protein_id="ABM98591.1"
FT                   /translation="MTERSMQTPAAELVKRNTTRRPNESEAYRRARDALLVEEIELRRH
FT                   VERVAALRRALPPGGEVTGGYRFEGERGPCDFAQLFGDRQTLVVYSYMFGPQRERPCPM
FT                   CTSLLGAWNGEARDLEQRVALAVVARSPLERLVAFKRERGWRDLKLYCDLDGRYSRDYH
FT                   AIGADGDEVPAINVFTRRDGTIRHFWSGEMGGWSADPGQDPRGAPDPMPLWTILDMTPE
FT                   GRGIDWYPSLDYPD"
FT   gene            40044..40175
FT                   /locus_tag="BMA10229_0046"
FT   CDS_pept        40044..40175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0046"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98851"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW03"
FT                   /protein_id="ABM98851.1"
FT                   /translation="MENCCVENALWRIVAAGSLPADSAADGAREARGEPISAAMPHF"
FT   gene            41153..41269
FT                   /locus_tag="BMA10229_0047"
FT   CDS_pept        41153..41269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0047"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00440"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW04"
FT                   /protein_id="ABN00440.1"
FT                   /translation="MISERGRRGATRAARSVDVNRSARSAPCGACDTHAGGD"
FT   gene            41377..41502
FT                   /locus_tag="BMA10229_0048"
FT   CDS_pept        41377..41502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99815"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW05"
FT                   /protein_id="ABM99815.1"
FT                   /translation="MSRNERSNSFGPIGPADVGPTTTNNDEQQPTTDNRRVTSDE"
FT   gene            complement(41737..43116)
FT                   /locus_tag="BMA10229_0049"
FT   CDS_pept        complement(41737..43116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0049"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99109"
FT                   /db_xref="GOA:A2RW06"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW06"
FT                   /protein_id="ABM99109.1"
FT                   /translation="MTGARGFARRLNASLRGRLLMWLLPAACVVGVLASTGTYWGALRE
FT                   LDDLLDDQMRSMSKQIQVDDAGKLSIEGRDRLAKRHPADYDSDDVLLQVWRGGKLEFTT
FT                   DPATQLPPPAAAGFVTLDAGGQRWHTYVRESAGTTIRVAQPRQARWEAIAGIAVHLLWP
FT                   VLSLLPLLAIGLWLGIGYGLRPLGAIAAGLKRRHANRLDPLDITTVPTEAQPLASEIND
FT                   LLARLDRSFTLQRHFIADAAHELRTPIMGLSIQTQLLQRTASADERARILAQIQAGTTR
FT                   LSHLAEQLLTLARLEPEARSAPFAELDLAALGRSVVAERARIAAAQHVDLGALGTAPVR
FT                   VAGNADTLRVLLNNLVDNAIRYAGAGARVDVDARIDAGGTPVLEVRDNGPGIPAADRER
FT                   VWERFYRGGGAQLVSASGSGLGLSIVKRIAEQHHADVSLEAGADGRGLTVTVRFGAARQ
FT                   A"
FT   gene            complement(43113..43775)
FT                   /locus_tag="BMA10229_0050"
FT   CDS_pept        complement(43113..43775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0050"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00443"
FT                   /db_xref="GOA:A2RW07"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW07"
FT                   /protein_id="ABN00443.1"
FT                   /translation="MRVLLVEDDPLIGSGLEQGLKQEGFAVDWAQNADAATLALRTTSY
FT                   GLLLLDLGLPDKDGLAVLAALRRRDDALPVIVVTARDALPDRIAGLDCGADDYLVKPFA
FT                   LEELLARIRAVNRRQAGRAQTVLAVGALRLDPARHQVWRGDEEVALSPKEFVLLHELMR
FT                   EPGAVISREQFEERLYSWGEEIESNAVQVHIHNLRKKLGHDTILTVRGVGYRIGDGA"
FT   gene            43936..44796
FT                   /locus_tag="BMA10229_0051"
FT   CDS_pept        43936..44796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0051"
FT                   /product="phosphosugar-binding transcriptional regulator,
FT                   RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00220"
FT                   /db_xref="GOA:A2RW08"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW08"
FT                   /protein_id="ABN00220.1"
FT                   /translation="MPADFDELASLIRAQFSELSPQFQVGAAFLLDHPDKVAVSSMRKV
FT                   AQRANVQPASLVRLAQQFGFPGWNELRDLFVARVRTRPQPLTQRARSLVKPNAKASLAA
FT                   DLLAAQRHNLEASAAQNARALAEAAKLIRKAAHVHVAGFRSCYPVAFGFVYGYRLFRPT
FT                   VSLLTGVAGSLDMELRTIAKNSVTVVVSFAPYSAEATRVAQAARAQGGRIVAITDSAVS
FT                   PIALHADAQLIFTHDSPSFFPSLVAAHALVETLVAQLLALEGGEAIAALEQAEAELHAK
FT                   GAYVV"
FT   gene            45182..45451
FT                   /locus_tag="BMA10229_0052"
FT   CDS_pept        45182..45451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99753"
FT                   /db_xref="InterPro:IPR019226"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW09"
FT                   /protein_id="ABM99753.1"
FT                   /translation="MTTYRDTHTTSFRIGDVVTLKTGGPRMTVTYAGPVVFDTGEWVIC
FT                   QWFDENGEFRQEMFPNETVVLEPRTISAGLARMRSLSVRGGMQA"
FT   gene            complement(45668..46006)
FT                   /locus_tag="BMA10229_0053"
FT   CDS_pept        complement(45668..46006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0053"
FT                   /product="putative immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98921"
FT                   /db_xref="GOA:A2RW10"
FT                   /db_xref="InterPro:IPR016410"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW10"
FT                   /protein_id="ABM98921.1"
FT                   /translation="MQMEILIQIVGSVVAIALYFLPAIVADRRHRDDKLTIALFNALFN
FT                   ALFGWTGIGWLLTLYWSLQPNATDDFVSDVRLKRRALSMKTFSTGLVERVQRRIAAQEQ
FT                   WADKQGTR"
FT   gene            complement(46096..46563)
FT                   /locus_tag="BMA10229_0054"
FT   CDS_pept        complement(46096..46563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0054"
FT                   /product="rhodanese-like domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00215"
FT                   /db_xref="GOA:A2RW11"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW11"
FT                   /protein_id="ABN00215.1"
FT                   /translation="MSHVTEIPAADSAAAVAHFAASLAFETDCRDVHDALACGAPDFVL
FT                   LDVRGPEQYAAAHVPGALNLPHRKIIESKLSEFARDTCFVVYCAGPHCNGAARAALRLA
FT                   RLGRPVKLMLGGVTGWLDEGFALARGNGASRRQGGLRQRTAGNDPLRNRNN"
FT   gene            46670..47626
FT                   /locus_tag="BMA10229_0055"
FT   CDS_pept        46670..47626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0055"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99895"
FT                   /db_xref="GOA:A2RW12"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW12"
FT                   /protein_id="ABM99895.1"
FT                   /translation="MHPHLVVALAYDRLCTFEFGCVVELFALPRPELGVDWYRFAVCAS
FT                   EPGPVRAAGGIKVQAPYRLALMDRADTIVIPGWRDPDETPPEPLLKKLRAAHRRGARLC
FT                   SICSGVFVLAAAGVLDGATVTTHWRYAERLQARYPALRVNPDALYVDAGQIVTSAGSAA
FT                   GLDMLMHLVRRDHGSAIANRVAQRLVLPPHRDGGQAQFVPRPLPSVGGDRLAKLIDWMR
FT                   AHAGQPHTLASLAARAAMSPRTLQRQFRDATGLGPYEWLIRERVGLAKEMIERDPALPV
FT                   ARVAALAGFGSEESLRRHFRRIAATSPAAYRRSFDAG"
FT   gene            47885..48109
FT                   /locus_tag="BMA10229_0056"
FT   CDS_pept        47885..48109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0056"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98671"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW13"
FT                   /protein_id="ABM98671.1"
FT                   /translation="MHGLREYTSRACRNTHAANEHVAGMRPRASTSRIARRERMRRCEA
FT                   RRAARLTDRDCAHLDMRDERYARRARMTP"
FT   gene            48194..48658
FT                   /locus_tag="BMA10229_0057"
FT   CDS_pept        48194..48658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98710"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW14"
FT                   /protein_id="ABM98710.1"
FT                   /translation="MNALAGKARGLSLSVANAHIAAAHVEKMPEANTHAAAAHVADAHD
FT                   TNAFSNARPPRMLTVSIRLERTRAYSNPPDEHAPPTLEQQASLATRPAANKPSRSCAFP
FT                   MHRRNGIPAAIGNAGCAGRAAIRAFGVRLRTAQRPLELHRTTPNAFPMRA"
FT   gene            48722..50173
FT                   /locus_tag="BMA10229_0058"
FT   CDS_pept        48722..50173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0058"
FT                   /product="peptidase, M20/M25/M40 family"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00434"
FT                   /db_xref="GOA:A2RW15"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW15"
FT                   /protein_id="ABN00434.1"
FT                   /translation="MTTAIAAAIDHDRLADFIERKWNNEILHALTDYIAVPAKSPAFDP
FT                   DWAKHGYIERVVVDAAQWAERQPVKGLRVEVVRLAGHTPVIFFETPATRAGSVDTILLY
FT                   GHLDKQPEFDGWRADLGPWTPKFEGGKLYGRGGADDGYAIYASLAALGALDAQGIGRPR
FT                   CVGLIETCEESGSYDLLPYVDALRARLGDVSLVVCLDSGAGNYDQLWLTTSLRGLVSGD
FT                   LQVEVLEEGVHSGVYGGIAPSSFRVMRQLFERLEDAATGNLLPPSFHCEVPASRLRETQ
FT                   AAASILGDAVWKGLPWACGQDGKPVLPTTADPREALLNSTWRPSLSVTGAQGLPALENA
FT                   GNVLRPRTAFKLSLRLPPLVDAAQAVQQLKALLELDPPYNAKVTFKPDAGAATGWNAPD
FT                   VAPWLGAALDDASRRHFGANCAYMGLGGTIPLMNVLQEGFPCAQFMVCGVLGPKSNAHG
FT                   PNEFLHVPYAKKLTAAVADVIAAAH"
FT   gene            50170..50286
FT                   /locus_tag="BMA10229_0059"
FT   CDS_pept        50170..50286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0059"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99970"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW16"
FT                   /protein_id="ABM99970.1"
FT                   /translation="MIRVATGMSVAMTIAWPPASGGAVVGARLGAARRRGLR"
FT   gene            50283..50651
FT                   /locus_tag="BMA10229_0060"
FT   CDS_pept        50283..50651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04993"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99475"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW17"
FT                   /protein_id="ABM99475.1"
FT                   /translation="MNWKAEKRRADELAEQLDALGPIGVARFFSGASLRLDGVLFGFVH
FT                   AGSLFLRVDDDTRAAFERAGMRPFSYSGRTRTVVVGGYYETPADVLEDVGMLRDWCRDA
FT                   HRAALRAGAGARRAKRKA"
FT   gene            50887..51756
FT                   /locus_tag="BMA10229_0061"
FT   CDS_pept        50887..51756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0061"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF07298"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98699"
FT                   /db_xref="GOA:A2RW18"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW18"
FT                   /protein_id="ABM98699.1"
FT                   /translation="MGARAHACAAVGDVRYRRLSTRMRAMHRAPVPFAHRLPALLRERR
FT                   KRCRRAWPSRRRGARSAMVRRMRTLAARGVRCMAAACAGSADNKISPPGDMFMLVLILG
FT                   LVIFLGTHSIRLVAGDWRAAQIATLGEPRWKGIYALASVIGFALIIWGYGLARADTASL
FT                   WFPPLGIRHLTGLLTAIAFVLLVAAYVPGTRIKALVGHPMLAGVMVWAGAHLLANGTLH
FT                   AELLFAAFFVWAFVDFIASRARDRRDGVRYPAGSLARDGVAIAVGLLVWALFAFVLHGW
FT                   LIGVRPFA"
FT   gene            51814..52014
FT                   /locus_tag="BMA10229_0062"
FT   CDS_pept        51814..52014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0062"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00158"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW19"
FT                   /protein_id="ABN00158.1"
FT                   /translation="MTRRWIFSPRNRQTAKTAKTESLDRIFRQPIDSQARSAERRRTRR
FT                   SALVDTKSTHRKFRVWKPNDR"
FT   gene            52033..52299
FT                   /pseudo
FT                   /locus_tag="BMA10229_0063"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            52542..52853
FT                   /locus_tag="BMA10229_0064"
FT   CDS_pept        52542..52853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99180"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW21"
FT                   /protein_id="ABM99180.1"
FT                   /translation="MLEQWHLLDADPTVFIFCERPGYVQVDGHQHLADFWGCYINLNDL
FT                   VILNDSLFIDDTTKARHDLEGQALSIPRVASAELAATRTWIDNRHHTLPCVVATVPSD"
FT   gene            53470..55206
FT                   /locus_tag="BMA10229_0065"
FT   CDS_pept        53470..55206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0065"
FT                   /product="family S15 non-peptidase"
FT                   /note="identified by match to protein family HMM PF02129;
FT                   match to protein family HMM PF08530"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99425"
FT                   /db_xref="GOA:A2RW22"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW22"
FT                   /protein_id="ABM99425.1"
FT                   /translation="MAEVGAQFERSPTGLPYPKLATLYPGHDGPIVDNGMILPWLSMRS
FT                   PLKSNVMVQTPFDTDQDGKLDRIALRIVQPAEVAEGLKTPVIVRPSVYYADPTYATQTR
FT                   APFLGEAEYLRMGYTIVYADSIGTNQSDGCWSVMDRTEREAMASVVRWLTNDPGAPGFD
FT                   AQGKQVAASWSTGHVAMEGISYGGTLPTMVAATGVPGLEAIVPVEGISSGYDYFRYNGV
FT                   IADIDNTVSLGSYMKSQQAFARSSICEPARVAAVTASDDATYAYNDFWKVRNTVSLVDR
FT                   IQAATLIAQGQADNNVKTKNATQLYDALYRAKKPVQLWLHSRNHDDPAWQKEWQKQIAM
FT                   WYSRYLFGVNNGVETQPTYVRETPTGDIPVGATLPPDPNDTSDTLIGHCHSGHNPRDCI
FT                   PTGELFIKEDAWPKTVDTFYHLRGDGRVGGLLTPSPADGAQAASVDLSNATAVTYETKS
FT                   LANVTRYAGAIRVAMRGRFAPAVSNIKATLSVDGHDVTYGWANPRFYKGLDVAQLIVPN
FT                   TDYDFTLEMMPRDFTVLPGSKVMLKLEGYQGTSLVTLDLSHTVLAMPVVPKAHVAAVMV
FT                   GK"
FT   gene            55367..56557
FT                   /locus_tag="BMA10229_0066"
FT   CDS_pept        55367..56557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99900"
FT                   /db_xref="GOA:A2RW23"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW23"
FT                   /protein_id="ABM99900.2"
FT                   /translation="MAKRIPIGTTVAALATVTLVACGGDDPSSGAVSAGNSPAIVPSVP
FT                   AATPATPTATAAESEQDVFARTAPADKVLDDSNIYDTTKDGSIALSKVNEDSSVKRHTI
FT                   TINGKVLPYVARAGHLVAYRQNGAGKKAEAAIFYTAYTRDALPKEHRPVTFLWNGGPGS
FT                   ASIWLHMGSWGPKRLKSDAPNMADPTKQPDSFPFEDNAISLLDQSDIVFVDPPGTGLST
FT                   AIAPLKNGDLWGTDDDAQVVADFITSYTNKYNRQSSPKYLYGESYGGIRTPIVANLLEQ
FT                   AGTSGYVPDPSGKPARVLDGFILNSPLVDYNSNCDMMGGRVTCEGYIPSYAMTADYFKK
FT                   SVKRGTRTQEQYLGELRTLARTTFQTTYGTYFTNGKPNSQWNAYVTCPLQTGPAGV"
FT   gene            56588..56851
FT                   /locus_tag="BMA10229_0067"
FT   CDS_pept        56588..56851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0067"
FT                   /product="Transposase subfamily"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00601"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABN00601.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            56875..57708
FT                   /locus_tag="BMA10229_0068"
FT   CDS_pept        56875..57708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0068"
FT                   /product="IS1404 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98900"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABM98900.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(57719..58288)
FT                   /locus_tag="BMA10229_0069"
FT   CDS_pept        complement(57719..58288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0069"
FT                   /product="subfamily M9A unassigned peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99701"
FT                   /db_xref="InterPro:IPR013661"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW26"
FT                   /protein_id="ABM99701.1"
FT                   /translation="MHTKQARMPRIPQNLPLSPDQAKYDLPLSKYDRATLMEPLRRKQS
FT                   AKPDRRTRPGADCRDMSIMTQYHGTALADYIANLPDYECHYGLFSIDRAMAAQIFNSEN
FT                   VWAVASRLTQEINRYDATNITLVNLLIYLRAAYFQYDAAQLADPIPGLVVWLRPYILQS
FT                   LSGDALYLENSRAPSDLPPSIGPMGF"
FT   gene            58623..59261
FT                   /pseudo
FT                   /locus_tag="BMA10229_0070"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(59541..60875)
FT                   /locus_tag="BMA10229_0071"
FT   CDS_pept        complement(59541..60875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06224"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99035"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW28"
FT                   /protein_id="ABM99035.1"
FT                   /translation="MIVRRPRGNASRRAARHADSRYSGASVSCVHSPPLVSAPLSIASA
FT                   RALHLAAQGLLTPPRRKAVKADVLAAVRRMGQLQIDTIHVVARSPYLVLFSRLGAYAPQ
FT                   WLDEHLADAKLFEYWSHEACFLPIEDFGLMRHKMLNPVGMGWKYAAEWHAQHRDAIDAL
FT                   LAHVRARGPVRSADFARGAGKGNGWWDWKPEKRHLEVLFSTGQLMVAERRNFQRVYDVA
FT                   ERVLPDWDDARDLPPRAAVVPRLVGNTCRALGIVRADWIADYYRLPKRSYRDELHALAD
FT                   AGELLPVAVDGWHADAFVHRELAPLVDAARDGALRPTVTTLLSPFDPVVWDRRRASALF
FT                   DFDYTIECYTPAHKRRYGYFCLPILHRGRLVGRVDAKAHRTQRVFELKAVHIEPGVRLG
FT                   AGLAADVGRAIRKLADWHETPVVEAGHAPKEIARAIGADRVAKPR"
FT   gene            complement(60948..61136)
FT                   /locus_tag="BMA10229_0072"
FT   CDS_pept        complement(60948..61136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99647"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW29"
FT                   /protein_id="ABM99647.1"
FT                   /translation="MRGALRAAAGHGQPELSRRKSVAPKKSADIHSGPAESRMDVRLNC
FT                   SGRLDGGEASGLAPCVP"
FT   gene            complement(61187..62584)
FT                   /locus_tag="BMA10229_0073"
FT   CDS_pept        complement(61187..62584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0073"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00586"
FT                   /db_xref="GOA:A2RW30"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW30"
FT                   /protein_id="ABN00586.1"
FT                   /translation="MPSALYAFIAPLIVACALFMESVDANIIVTALPAMARDFGQNPVT
FT                   LNIAITSYVVGLGVFIPICGWLADRFGARTVFRTAIGIFVAGSLLCAASNNLELFTFAR
FT                   FVQGVGGAMMVPVGRIIIFRAVPRTELVRAMNYLSVPALFRPAAGPLLGGFITTYLHWR
FT                   LIFFINVPIGILGIYLANRHIANTHELDPGPLDGFGFVLSAAGAALLLMGLTLLDGALV
FT                   TRGAALAMGATGAALLGGYVLYARRVERPVLDLRFLRIPTYHASVVGGSLFRIGLGAVP
FT                   FLLPLALQEGLGMSAFHSGAITCASAVGGALTRMLAPRTLKRFGFRTVLMYNAAFSGLA
FT                   IAAYGVFHPGMSTLAIWLIVLVGGIFPALQFTSLNSMIYAEIAARDAGRATSLGSVVQQ
FT                   MSLGLGVTVAALVLHVSHWAQGHPAMVWSDFWPAFVVVGLCSFASIPITRRLSPNAGDE
FT                   VARGKRG"
FT   gene            complement(62661..63107)
FT                   /locus_tag="BMA10229_0074"
FT   CDS_pept        complement(62661..63107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0074"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00559"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW31"
FT                   /protein_id="ABN00559.1"
FT                   /translation="MTVGRGMRRVAHAPARTRHAAPGEAGAAAPARRAGTALRDRWPAA
FT                   GRVGRRRGRFVPIPRKPAERAARCFFGIACTPARSADPRRWKTAVIVRASGSPEIGAAH
FT                   RARIDASGTRAARARRAQTRAAPTTPPRHRAPRPDRTRRANGNA"
FT   gene            63229..64956
FT                   /locus_tag="BMA10229_0075"
FT   CDS_pept        63229..64956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0075"
FT                   /product="alpha,alpha-trehalase"
FT                   /EC_number="3.2.1.28"
FT                   /note="identified by match to protein family HMM PF01204"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98730"
FT                   /db_xref="GOA:A2RW32"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="InterPro:IPR023720"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW32"
FT                   /protein_id="ABM98730.1"
FT                   /translation="MPFISKTGGGDMVTPRHRPLHVENPFYRRLLNAPAWVALVAAAGI
FT                   GCTSATLARADSSPAHASTAAAVASAASAPGAASIPPPPSQLYGDLFVAVQTAQIFADQ
FT                   KTFVDSTPNADPATIVQLYQQQKGQPGFSLKAFVAQYFTPPSDESVTPPPNQTLREHID
FT                   WLWPKLTRTTTTAPPYSSLIALPKPYVVPGGRFREGYYWDTYFTMLGLQEAGREDLVDN
FT                   MLDNFAYLIDTVGHVPNGNRSYYVSRSQPPFFAYMVTLAAKAEGNRVYQKYLPALRKEY
FT                   AYWMQGERTTPRGQATRNVVAMPDGSVLNRYWDASDTPRDESYLEDVKTAQQASGRPAA
FT                   EVWRDLRAAAESGWDFSSRWFGDNRTLATIRTTAIVPVDLNSLMFNLETTIVKGCAVTR
FT                   DFACVAEFAGRAGKRAVAINRYLWNRNGYYGDYDWKLGKPRDNLSAAALYPLFAGVAWP
FT                   ERAKQTAKNVQKALLKPGGLATTTYDTAQQWDAPNGWAPLHWIALVGLRHYGEKSLADD
FT                   IGTRFLADVKGVYAAQGKLVEKYIVEGTGGGGGGEYPLQDGFGWTNGVTLKLLDLYGG"
FT   gene            65357..66169
FT                   /locus_tag="BMA10229_0076"
FT   CDS_pept        65357..66169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0076"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98777"
FT                   /db_xref="GOA:A2RW33"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW33"
FT                   /protein_id="ABM98777.1"
FT                   /translation="MPLFPTSHVGVRRRRSTSRAAPPRATVIVGDATRRWEARIVNTYR
FT                   LERASAWSGLVFLLVFGLGWLVLARFFPPISPDAAAAGVAAIYRARRLSLMLASVLMMS
FT                   SIVFLMPVSALFGLLIQKIERRVGILTLMMGFTLTTNLVVTFYTALSFSLAAFRAQRSP
FT                   ELVQFANDLGFLQFMGGISMFVMAWFVSAYAILVESPRENPVLPRWVGYVSLWMGLLYL
FT                   PELLIYFFRTGPFAWDGIVGFWIPAALFVVYFLFSPVVLVPAVRRHFR"
FT   gene            66198..66827
FT                   /locus_tag="BMA10229_0077"
FT   CDS_pept        66198..66827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0077"
FT                   /product="cytochrome c oxidase, subunit III family"
FT                   /note="identified by match to protein family HMM PF00510"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00247"
FT                   /db_xref="GOA:A2RW34"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW34"
FT                   /protein_id="ABN00247.1"
FT                   /translation="MRPGAPFDAAGDMSRIASRIAAASAAPARVPGEAELWIFILGDML
FT                   VFAVFFTILSAHHVLHPALFDAGRRQLNLAFGLVNTLALLTSSAFVVLGLGEAKAARLA
FT                   AAKRRFVVAAALGALFVAIKCAEYAQKIAAGANPLVNDFYMYYFVFTGVHLLHVAVGLI
FT                   ALALMIRRCVRPAAEPRDVGFLEGAAVYWHMVDVLWVVLFLLIYLI"
FT   gene            66849..67151
FT                   /locus_tag="BMA10229_0078"
FT   CDS_pept        66849..67151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0078"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00064"
FT                   /db_xref="GOA:A2RW35"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW35"
FT                   /protein_id="ABN00064.1"
FT                   /translation="MTIDSARARALTVKIMRVWAALVLATVGSWTESLRAASPAIVAAV
FT                   VGLAALKVALIVFCYMEVGRAPRWLKLVCGAWIGIVFGIVAACHLLPRDVLRLIG"
FT   gene            complement(67243..68202)
FT                   /locus_tag="BMA10229_0079"
FT   CDS_pept        complement(67243..68202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0079"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99275"
FT                   /db_xref="GOA:A2RW36"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW36"
FT                   /protein_id="ABM99275.1"
FT                   /translation="MRSHTASVRSIERRRTTAARFFVMSDIAVQEDAAVAASARPASRA
FT                   NPGGTARDAQTIDVVWCGHARRAADADPRFAPRLGVAEMLASARGTAECGRIATSLLRL
FT                   MGFATFAYFALEFTRDDAECLYLHEAFTPAAYRGDYVRRRHHDVDPRMLGTRASSMPVV
FT                   WDLRQLAREHAARGCDALDGFLRVMHDDDMCSGVMYSMPVPGTRVHAFASFTAPRRSRD
FT                   WISSATLEQVLSLGLSVHRFAAPQLIASARERAAERLTPFERELLVGIAEGASDKEIGR
FT                   RLDTSAHNVDYHLRKLRKRFGVANRIQLTYFASARGLI"
FT   gene            complement(68266..68451)
FT                   /locus_tag="BMA10229_0080"
FT   CDS_pept        complement(68266..68451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99839"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW37"
FT                   /protein_id="ABM99839.1"
FT                   /translation="MWVGDMRVCDVRVCNVRVDDERVCGAHVRGRTHAFPAAGPRDGAL
FT                   HAADAARKIQAQAPRT"
FT   gene            68657..69481
FT                   /locus_tag="BMA10229_0081"
FT   CDS_pept        68657..69481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0081"
FT                   /product="autoinducer-binding transcriptional regulator,
FT                   LuxR family"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF03472"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99484"
FT                   /db_xref="GOA:A2RW38"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW38"
FT                   /protein_id="ABM99484.1"
FT                   /translation="MTIADSAPRIEWFSHAELAASRGGFAPRDTQPSVSSFAAPPDGPR
FT                   RATFDVADCDARLRAAGFTTLCYGAFELIGQQMLAAYLLRDFAPASFLRAYVEGRLFEV
FT                   DPRFAEWRQGVSPIAWRLDELDAHARRTGERRMHALVNSLRAHAMHSGVIFCWPVPHLD
FT                   LRVAVSLASEAHDGSLDDRVIGCALALSLDVHRAAQPHLDARVGGARTFVLERDEAAVL
FT                   ERLVHGLSDQEIANALSTSLHRVGAQIRTLEKRFNARNRAQLAYLAARRLRG"
FT   gene            69699..71669
FT                   /gene="asnB_1"
FT                   /locus_tag="BMA10229_0082"
FT   CDS_pept        69699..71669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB_1"
FT                   /locus_tag="BMA10229_0082"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="identified by similarity to SP:P54420; match to
FT                   protein family HMM PF00310; match to protein family HMM
FT                   PF00733; match to protein family HMM TIGR01536"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98868"
FT                   /db_xref="GOA:A2RW39"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW39"
FT                   /protein_id="ABM98868.1"
FT                   /translation="MCGITGFVGPVACAPQTARATLARMTDSLAHRGPDDTGLWIDHDA
FT                   GVALGHRRLSIVDLSEHGHQPMLSACGRYAMTFNGEIYNFRQLRSELEREHRAPEWRGH
FT                   SDSEVLLAAFCAWGVDRALQKAVGMFALALWNRESRVLTLARDRIGEKPLYYGRIGGSF
FT                   VFGSELKALRRFPGFDAHPIDRDALCLYLRHASVPAPYTIYEGIRKLPPGTYAQLEDLA
FT                   EAPAPRRYWSLERAIAAGRANPFDGDANAAVAQLDYVLRDAIAEQSVADVPLGAFLSGG
FT                   VDSSVIVALMQTQTAQPVQTFTIGFHEAGYDEAGYAKAVARHLGTSHTELYVKPADVLA
FT                   TVPRMPCVYDEPFADSSQIPTLLVSELTRRHVKVSLSGDGGDELFGGYTRYFLTPRLWG
FT                   RLRRVPAAVRMRIAAALHALRPDHADQIASLVQGAWSASAQRDASPRVGDRLHKLANVM
FT                   TADSRASLYRLLMSSVHHPERFTLAGHEPQTLIDTPGAWPAGLSFAEQAMAVDTLTYLP
FT                   TDILTKVDRAAMAVSLETRMPFLDHRVVEFAWRLPEALRIPDGQDKWLLRKLLYRYVPR
FT                   PLIDRPKQGFCAPVGAWLRGELSDWAAELLRPARLRDEGYLDAARVERLWRQHQSGRMN
FT                   WQHPLWTVLMFQAWLERQRAE"
FT   gene            complement(71721..71936)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0083"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(72289..72702)
FT                   /locus_tag="BMA10229_0084"
FT   CDS_pept        complement(72289..72702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0084"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00332"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW41"
FT                   /protein_id="ABN00332.1"
FT                   /translation="MCVAGALARTSRAQRHKREHASSTGRARHGPSRTGRPRGRPERVV
FT                   PNGPSRTGRSGPVVPAVDPASNRNALRPSAPRRPRPSPALHPLAPARYVAVRTDVTRTS
FT                   VLRNTLQTVSDCYIRGATAHRRPHPENALNSWH"
FT   gene            complement(72810..75041)
FT                   /gene="iorB"
FT                   /locus_tag="BMA10229_0085"
FT   CDS_pept        complement(72810..75041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iorB"
FT                   /locus_tag="BMA10229_0085"
FT                   /product="isoquinoline 1-oxidoreductase, beta subunit"
FT                   /EC_number="1.3.99.16"
FT                   /note="identified by match to protein family HMM PF02738;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99590"
FT                   /db_xref="GOA:A2RW42"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW42"
FT                   /protein_id="ABM99590.1"
FT                   /translation="MTTDLDLPDAVRASRRTFLKAAGAAAAVGLTIGFEWLDASRPALG
FT                   ATAPAAPAGDAAGAFAPNAFLRVAPDNSVTVIAKHVEMGQGAYTGIATIVAEELDANWR
FT                   DVRVESAPADASRYANLQFGKLQGTGGSSAMANSWMQLREAGAKARAMLVSAAAAQWNV
FT                   PAAELTTGDGVVRHAASRREATYGSLATAAAALPVPEQVALKSPSDFRLIGKPVPRVDA
FT                   RAKSDGTAQFTIDVSMPGMLVALLQRPPVFGGKVKSFDASAAKAVPGVVSVVQVERSVA
FT                   VVAKGFWAAKQGRDALKVEWDESGAEKRSSDAIMREYRQLAERPGASARRDGDAEHALA
FT                   GAAKRLRASYEFPYPAHAPMEPLDAVVKLSADRCEIWAGDQFQTIDQGNAARVAGLDPS
FT                   QVQIHTLYAGGSFGRRANAWSDYVVEAVSIAKALGANGTPVKLQWTREDDIHGGLYRPM
FT                   YFHRLDAALSKDGKLVGWRHRIVGQSILAGTPFEAVMVKNGIDQTSVEGAANLPYAIPN
FT                   VSVELTTTRSAVPVLWWRVVGSSHTAYAVEAFIDEAAHAAGKDPYLFRRDLLAHAPRLK
FT                   GVLELAAEKAGWDPGKPLPKGRGRGIAVAEAFKSYVAQVAEVSVDEHGAVKVERVVCAL
FT                   DCGTAINPDVIAAQMEGGIGFGLGAVLHGAITLKDGKVEQNNFDGYRVLRIAEMPKVEV
FT                   YIVPSGEAPTGVGEPGVAPIGPAVANAIFAATGKRHYALPFPAAGEATA"
FT   gene            complement(75044..75505)
FT                   /gene="iorA"
FT                   /locus_tag="BMA10229_0086"
FT   CDS_pept        complement(75044..75505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iorA"
FT                   /locus_tag="BMA10229_0086"
FT                   /product="isoquinoline 1-oxidoreductase, alpha subunit"
FT                   /EC_number="1.3.99.16"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF01799"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99152"
FT                   /db_xref="GOA:A2RW43"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW43"
FT                   /protein_id="ABM99152.1"
FT                   /translation="MSTSFVLNGKNLTLDADPAMPLLWAIREDAGLHGTKFGCGAAQCG
FT                   ACTVHLEGQAVRSCVLPLAAVAGKRVTTIEGLASRPAKAVQAAWVKLQVPQCGYCQSGQ
FT                   IMSATALLEQNPAPTDADIDAAMNDNICRCATYTRIRAAIHEAAATLKA"
FT   gene            75706..76689
FT                   /locus_tag="BMA10229_0088"
FT   CDS_pept        75706..76689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0088"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF06719"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00139"
FT                   /db_xref="GOA:A2RW44"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW44"
FT                   /protein_id="ABN00139.1"
FT                   /translation="MPMDQRHTRLESAAHAPPRPDAQTLAPREAARRELAALIERFAPA
FT                   DGAHPSAIPALSFFRCSSPVDLGCSVTRAAFVFAAQGAKRVTVAGQAYEYDHQQCLVTS
FT                   VDLPMLSQVTRASAGAPYLCVKVALDVQRIAELSAEMRMPPPEAVPTGEGIVVGALSEP
FT                   LFDAALRLVRLLDTPADIPILAPLIEKELLYRLLTSGLGARLRHIAVAGSQTYRIARAI
FT                   EWLRHHYTEPLRVETLAQQVNMSVSSLHHHFKHVTTLSPLQYQKQLRLHEARRLLLGQH
FT                   GDVGSVALRVGYDSPSQFSREYSRLFGAPPLRDVVQRRRNGTGVQE"
FT   gene            complement(76680..76892)
FT                   /locus_tag="BMA10229_0087"
FT   CDS_pept        complement(76680..76892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0087"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98680"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW45"
FT                   /protein_id="ABM98680.1"
FT                   /translation="MPCLRGRGRHIGMFRTRAHVPMRACADASLRAGAKRMRRACLVAR
FT                   RAGLTETGVCRHPPATTRRARARHS"
FT   gene            76910..77308
FT                   /locus_tag="BMA10229_0089"
FT   CDS_pept        76910..77308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99090"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW46"
FT                   /protein_id="ABM99090.1"
FT                   /translation="MNMNADGETAVGVVREFWRLMGTNDFHAVAAVLAEDFVLDWPQSN
FT                   ERIRGARNFAVLNSEYPAHGPWTFAIGRLVGGEGQAVSDVSVTDGVQQARAISFFTVVH
FT                   RKITRIVEFWPEPYAAPYDRSHLVERID"
FT   gene            complement(77740..78096)
FT                   /locus_tag="BMA10229_0090"
FT   CDS_pept        complement(77740..78096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99078"
FT                   /db_xref="InterPro:IPR021947"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW47"
FT                   /protein_id="ABM99078.1"
FT                   /translation="MRLTIRINGSDAPAQQFAVLWLDTDEQLWSREAHQGIDLPAWGKV
FT                   KDVEGAVALCSADSGEALCRLQGLSFSNVRRLSEDEEHGNAVLGGKNPQGAWRLQAVDS
FT                   ASIQPEHREFTIVR"
FT   gene            78501..79739
FT                   /locus_tag="BMA10229_0091"
FT   CDS_pept        78501..79739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0091"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98488"
FT                   /db_xref="GOA:A2RW48"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW48"
FT                   /protein_id="ABM98488.1"
FT                   /translation="MSAIYETAVQPARGATARDAHLIASDAEAIDAARALAARLAEGAA
FT                   ERDRERRLPYEEIDWFSQSGLWAITVPKAYGGAGVSHVTLTEVVKIVAAADPSLGQLPQ
FT                   NHFGLVDVIALTGTDEQKRLFFGEILKGKRFGNGFSEKGTKNVLDLKTKVIRDGDGYRV
FT                   DGTKFYSTGALFAHYVPVLGIDDARRGWLAYVPKGTPGLAVIDDWSGFGQRTTASGTVR
FT                   LDNVRVPASHVFAAHRVSDQPTLNGPLSQILQAAIDAGIAHAALDDTLRFVRERSRPWI
FT                   DSGVERAADDPLTIRETGRLVIQLHAADALLERAARTLDALAAQSELSEDDVARASVAV
FT                   GEAKVLTTEIALLASEKLFELAGTQATLAEHGLDRHWRNARTHTLHDPVRWKYHLVGNY
FT                   YLNGVAPARHAWN"
FT   gene            79744..80958
FT                   /locus_tag="BMA10229_0092"
FT   CDS_pept        79744..80958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0092"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00348"
FT                   /db_xref="GOA:A2RW49"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW49"
FT                   /protein_id="ABN00348.1"
FT                   /translation="MNAFMQPAVARAARRIANDAQALGAARAFAVAIAPDAAARDRECR
FT                   LPRAELDAYSATGLWGIAVPREFGGAAVSAATLAEVTAIVSEADPAIGQIPQNHFFMLE
FT                   VLRVNGTRAQQRFYFERALAGERFGNALSERGTKHARDYRATITPDGAGFRLNGRKFYS
FT                   TGALFAHWIAVVAKAPDDRLHVAFTPAHAPGLTVEDDWNGFGQRTTGSGTTRLDDVYVD
FT                   ASAVVPYSDAFDAKPTPVGPLGQLLHAGVDLGIARAAFADACRFVRERARPWVDSGVAR
FT                   ASDDPLALEIFGKLAVELDAAGALTERAGLRVDAAIDDANERTVAAASIAVAKARAATT
FT                   EIALAASSRLLELAGTQGALAEHALDRHWRNARTHTLHDPVRWKYIAIGDYAVNDTLPP
FT                   RHGAL"
FT   gene            81046..82449
FT                   /locus_tag="BMA10229_0093"
FT   CDS_pept        81046..82449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P54995; similarity to
FT                   RF:NP_860746.1"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99353"
FT                   /db_xref="GOA:A2RW50"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW50"
FT                   /protein_id="ABM99353.1"
FT                   /translation="MTRQIRFNAFDMNCVGHQSPGLWAHPRDESWRYRELSYWTGLARL
FT                   LERGKFDGLFIADVLGIYDVYQGSGEAAIRQGAQVPVNDPILLVSAMAAATRHLGFGIT
FT                   CSLSYEHPYPFARRMSTLDHLTGGRVGWNVVTSYLDSAARNLGLPRQANHDERYAIADE
FT                   YLEVCYKLWEGSWEDGAVVRDAARRVFAEPSKVHPIDHRGRYYDVPGIHLCEPSPQRTP
FT                   VLYQAGASRRGKDFAAQHAECIFVAAPSRTILKAFVADIRARVKRFGRDPRDVLIFNLH
FT                   TVITGRTSADAHAKHADYRRYASDEGALALMSGWTGIDLSKYALDEPLEHVESNAIQSA
FT                   VEALSSADPTRKWTVREIARWGGIGGLGPVSVGDAREIADDLQSWVDETDVDGFNLAYA
FT                   VTPETFVDVVELVVPELQRRGAYQTDYAPGTLREKLHRAGPRLAAPHPAARYRVGGEPA
FT                   AAGRLAAQQ"
FT   gene            82534..82653
FT                   /pseudo
FT                   /locus_tag="BMA10229_0094"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(82725..84053)
FT                   /gene="rstB"
FT                   /locus_tag="BMA10229_0095"
FT   CDS_pept        complement(82725..84053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rstB"
FT                   /locus_tag="BMA10229_0095"
FT                   /product="sensor histidine kinase RstB"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by similarity to SP:P18392; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00008"
FT                   /db_xref="GOA:A2RW52"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW52"
FT                   /protein_id="ABN00008.1"
FT                   /translation="MLRSLVRLYLVVVVCASAAILFINTSFTRFFYERISSAARETLST
FT                   YAFVLNDYLERHPGASRQPALRELAKHGNEGFGFMSIDDARKLLSAEQQRDLDRGEIAI
FT                   SYDGKDYFMPLVDGTVLHARPDEPPSLDIQIYAYLTVALATLLAVALWIHYHWRDLRKL
FT                   EAAARAFGDGRLSTRAELSRKSNIYELSQQFNDMAERIEASIQQQREMMHGISHELKTP
FT                   LARLEFGLALLSSPDAPERMRERQAALRRDVRELDELVTELLTIGRLEQGERHLALMQV
FT                   MVAELIDSVAASVAHEIADRRLTLDVSARGAPACHVCDAKLVARALLNLIRNGMRYAST
FT                   TISLRASLGEAGALVLSVDDDGPGIAAADRDRVFEPFHRLDSSRDRQTGGFGLGLTIVR
FT                   SVALAHGGDVRLDDTPLGGARFAITLPALEAPGREQDARGAAA"
FT   gene            complement(84054..84776)
FT                   /gene="rstA"
FT                   /locus_tag="BMA10229_0096"
FT   CDS_pept        complement(84054..84776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rstA"
FT                   /locus_tag="BMA10229_0096"
FT                   /product="transcriptional regulatory protein RstA"
FT                   /note="identified by similarity to SP:P52108; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99319"
FT                   /db_xref="GOA:A2RW53"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW53"
FT                   /protein_id="ABM99319.1"
FT                   /translation="MNEVPLKYRVLLIEDDDRLAQLIREYLDSYEFSVTVVRRGDLAVR
FT                   AVREHQPALVILDLMLPHLDGMEVYRRIRAFSNVPVLILTARSDVYDQVAGLETDADDY
FT                   VTKPIEPRVLVARARALLRRVQPGASVEAPASETLVFGELAISPPNRTVTWRGEPVDLK
FT                   TAEFNLLLILARAAGTVLSRDDILKQLRGIEFDGIDRSVDSGISKLRRRFEDASSEPHK
FT                   IKTIWGRGYLFSPSAWDD"
FT   gene            85017..85763
FT                   /locus_tag="BMA10229_0097"
FT   CDS_pept        85017..85763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06629"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99679"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW54"
FT                   /protein_id="ABM99679.1"
FT                   /translation="MPFAGFVSITAAQAENVYTLSLGAGFAPRYAGSSQYRAVVAPSFS
FT                   AEFDNGIFVGPLGGVGYRLKLPGQAFVAAAVSYDDGRADEDRFDRPGSNYLKGMGNVPG
FT                   SVIVAVQAGVVLYGGSVLSVSVDTPVTHTSRGVSGHVDLAVPVFNAGRHEIVLTGSVHA
FT                   ASGRYTQTFYGVTDAQAAATRFAPYSTKGGIDSASMSVAWTYTFSKHWSVDTTLGLTRL
FT                   VGRYGNSPIVQRKTQYFGLSALTYRF"
FT   gene            85787..86974
FT                   /locus_tag="BMA10229_0098"
FT   CDS_pept        85787..86974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0098"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01370;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00135"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW55"
FT                   /protein_id="ABN00135.1"
FT                   /translation="MLIWKTALSLTWKAGLVSPASAPAAAAHVDRVVLTGATGFIGGAV
FT                   LVSLVNAGLLDRVVCIVRACDRAHALARLRAAALRSGLAPYWAERLSEANVIAGELGGA
FT                   LADADAAHIALASHVIHCAGVASLADARIVNETNVGATLRFARRFAGSRRLQRFVHVGA
FT                   AFACGLRARGTIREDDTLARGREIDFAPYTRGKRDAEAQLRALGLPLVVVRPSCVVGHT
FT                   LLGTQPSASTFWMFRIVHAARRFTARPMARIDVIAVDDCARALMLLALKPSLAHDTYHV
FT                   SAGDEAPTVTQIVRAMDEAVGLDDEPRYALCSPAEFPSIARDVLGRRDAPRERVIRRAL
FT                   QSYAAFAELDHVFDNARVRREIDFEPLPFVDYVNECMRTSRGIDVLAQMPRTAAR"
FT   gene            complement(87018..87455)
FT                   /gene="hpaR"
FT                   /locus_tag="BMA10229_0099"
FT   CDS_pept        complement(87018..87455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaR"
FT                   /locus_tag="BMA10229_0099"
FT                   /product="homoprotocatechuate degradative operon repressor"
FT                   /note="identified by match to protein family HMM PF01047;
FT                   match to protein family HMM TIGR02337"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98667"
FT                   /db_xref="GOA:A2RW56"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012712"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW56"
FT                   /protein_id="ABM98667.1"
FT                   /translation="MNRTFDHRNLAMLLLEARETLMGRFRPILKEFALTEQQWRIIRVL
FT                   DGEPSHELEAGQIAKRCCILSPSLTGVLERMERDGLIRRTRAQEDQRRLIVSLTPQSRQ
FT                   LVTQISPRIDEQYRLIEQRFGADALGEVYAALDKLIDVGGS"
FT   gene            87612..88310
FT                   /locus_tag="BMA10229_0100"
FT   CDS_pept        87612..88310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0100"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase, N-terminal subunit"
FT                   /EC_number="4.1.1.68"
FT                   /EC_number="5.3.3.10"
FT                   /note="identified by match to protein family HMM PF01557;
FT                   match to protein family HMM TIGR02305"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98568"
FT                   /db_xref="GOA:A2RW57"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012686"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW57"
FT                   /protein_id="ABM98568.1"
FT                   /translation="MNRMELSLVERGERVATVPIGTVYGALLNDRGALAALGDAVHAPP
FT                   YHKPPRASVLYVKPANTHAGDGAAVVVPAGVDALEIGATLGVVFARRTTRVPAEQAFDF
FT                   VKGFTLASDVSIPHPDYYRPAVRFKCRDGFCPLGPAIVARASIGDADALAVTVRIDGER
FT                   RYEASTANLIRPVARLIADVSAFMSFDAGDVLLVGVGPNAPRAAAGSTIEIDAPGIGTL
FT                   RHTLVAEDAQ"
FT   gene            88307..89071
FT                   /locus_tag="BMA10229_0101"
FT   CDS_pept        88307..89071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0101"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase, C-terminal subunit"
FT                   /EC_number="4.1.1.68"
FT                   /EC_number="5.3.3.10"
FT                   /note="identified by match to protein family HMM PF01557;
FT                   match to protein family HMM TIGR02303"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99215"
FT                   /db_xref="GOA:A2RW58"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012684"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW58"
FT                   /protein_id="ABM99215.1"
FT                   /translation="MRTARVVFNGALHAAEPAGDALVRLDTGRVLAETEVSWLPPVVPR
FT                   TAFALGLNYADHAKELAFSAPAEPLIFLKGPNTFIGHRAQTVRPADATHMHYECELAVV
FT                   IGREARRVTRARALDHVLGYTIGNDYAIRDYLENFYRPNLRVKNRDTCTPLGPWLVSRD
FT                   EVGDASDLALRTTVNGVETQRGNTRDMIFDVASLIEYISGFMTLSPGDLILTGTPEGLA
FT                   DTQPGDEVVTEIEGIGRLVNTIVGEADYYRAG"
FT   gene            89095..90558
FT                   /gene="hpaE"
FT                   /locus_tag="BMA10229_0102"
FT   CDS_pept        89095..90558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaE"
FT                   /locus_tag="BMA10229_0102"
FT                   /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.60"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR02299"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00598"
FT                   /db_xref="GOA:A2RW59"
FT                   /db_xref="InterPro:IPR011985"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW59"
FT                   /protein_id="ABN00598.1"
FT                   /translation="MGIKHWIGGREVDSPETFTTFNPATGQPIAEVASGGAQEIDAAVR
FT                   AAKDAFPKWAGTPAKERAKLMRRLGELIERNVPALADLETRDTGLPISQTRKQLIPRAS
FT                   ENFHFFAEVCTRMNGRSYPVDDQMLNYTLYQPVGVCALVSPWNVPFMTATWKTAPCLAL
FT                   GNTAVLKMSELSPLTADQLGRLALEAGIPAGVLNVVQGYGATAGDALVRHPDVRAVSFT
FT                   GGTVTGKRIMERAGLKKYSMELGGKSPVLIFDDADFDRALDASLFTIFSINGERCTAGS
FT                   RIFVQRTIYDRFVAEFARRANNLIVGDPADESTQVGSMITRAHWEKVTGYVRLGVEEGA
FT                   RLVAGGPDKPANLPAHLANGNFVRPSVFADVDNRMRIAQEEIFGPVACLIPFDGEEDGL
FT                   RLANDTAYGLASYLWTRDVGRAHRLARGIEAGMVFVNSQNVRDLRQPFGGVKESGTGRE
FT                   GGEYSFEVFAEIKNVCLSMGSHHIPRWGV"
FT   gene            90628..91476
FT                   /gene="hpaD"
FT                   /locus_tag="BMA10229_0103"
FT   CDS_pept        90628..91476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaD"
FT                   /locus_tag="BMA10229_0103"
FT                   /product="3,4-dihydroxyphenylacetate 2,3-dioxygenase"
FT                   /EC_number="1.13.11.15"
FT                   /note="identified by match to protein family HMM PF02900;
FT                   match to protein family HMM TIGR02298"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98914"
FT                   /db_xref="GOA:A2RW60"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011984"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW60"
FT                   /protein_id="ABM98914.1"
FT                   /translation="MGKLSLAAKITHVPSMYLSELPGRHHGCRAEAIRGHQAIGERCRA
FT                   LGVDTIVVADTHWLVNAGYHVNCNGHFAGVYTSNELPHFIRDMRYEYPGNPALGHLIAA
FT                   SANERGIGTRAHEIDSLELEYGTLVPMRYMNADQRFKVVSIAGWCMWHALDESRRFGEA
FT                   LRHAIDASDANVAFLASGSLSHRFNDNGSPEEAIHMISREFYRQVDLRVVELWKQGDFA
FT                   TFCKMLPEYNAHCHGEGGMHDTAMLLGLLGWDRYDKPVEIVTDYFASSGTGQINAIFPL
FT                   P"
FT   gene            91534..91926
FT                   /gene="hpaF"
FT                   /locus_tag="BMA10229_0104"
FT   CDS_pept        91534..91926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaF"
FT                   /locus_tag="BMA10229_0104"
FT                   /product="5-carboxymethyl-2-hydroxymuconate delta
FT                   isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="identified by match to protein family HMM PF02962"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99807"
FT                   /db_xref="GOA:A2RW61"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW61"
FT                   /protein_id="ABM99807.1"
FT                   /translation="MPHIIVEYTANIRDDARIPVLLKSINETLIAQGGVFPTGGIRSRA
FT                   IELQDYCVADGTADDAFVHVTLKIGAGRDDATKKAACDALFDAIKAHFEALYARRYLAL
FT                   SMELAEFSETGSYKHNNIHARYKRGA"
FT   gene            91949..92752
FT                   /gene="hpaH"
FT                   /locus_tag="BMA10229_0105"
FT   CDS_pept        91949..92752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaH"
FT                   /locus_tag="BMA10229_0105"
FT                   /product="2-oxo-hepta-3-ene-1,7-dioic acid hydratase"
FT                   /EC_number="4.2.-.-"
FT                   /note="identified by match to protein family HMM PF01689;
FT                   match to protein family HMM TIGR02312"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00229"
FT                   /db_xref="GOA:A2RW62"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012690"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW62"
FT                   /protein_id="ABN00229.1"
FT                   /translation="MLDSATIQLLARRLHVAERERRQIRQISLDYPEITIDDAYAIQRT
FT                   WVDMKLAEGRVLKGHKIGLTSKAMQSSSQIDEPDFGALLDDMFFEDGATIPTRRFIVPR
FT                   VEVELAFVLGKPLKGPDCTVFDVYDAVDYVVPALEIIDARSQSIDPDTKRPRKVFDTIA
FT                   DNAANAGVVLGGRPVRPMDVDLRWVAAIMSRNGVVEETGVAAGVLNHPANGVAWLANRL
FT                   ARFDVSLDAGEIILGGSFTRPCAAKSGDTFNVDYGPLGAIHCHFE"
FT   gene            complement(93504..94346)
FT                   /locus_tag="BMA10229_0106"
FT   CDS_pept        complement(93504..94346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0106"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98882"
FT                   /db_xref="GOA:A2RW63"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW63"
FT                   /protein_id="ABM98882.1"
FT                   /translation="MLDPILPIELVTSSEGPFVAAVELTQRTERTTARHSHARGQLVGT
FT                   SSGLVSIGLDDEDWVVPAVHAVWIPPHRVHSLRSFGPFAGWSVFVAEDRCAALPGAPRA
FT                   IVMSTLLREAVRRAASWRGAALDAARARIANVILDEIAAAQTGPRGLPRPRDPRLRRIA
FT                   DALAGDLADNRRADEWAAWAGMAPRTLSRRFVSETGFTFTQWRQQARVLRALERLADGV
FT                   TVTAVALDLGYDNVSAFIDMFRRTLGTTPGQYVNARAGDARDGAPAPCGPRAVRARRQ"
FT   gene            complement(94414..94536)
FT                   /locus_tag="BMA10229_0107"
FT   CDS_pept        complement(94414..94536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0107"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00341"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW64"
FT                   /protein_id="ABN00341.1"
FT                   /translation="MRTASAAPPARTIPPRAVSLDASEENRRGAQRPARRIHRT"
FT   gene            94548..95588
FT                   /locus_tag="BMA10229_0108"
FT   CDS_pept        94548..95588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0108"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99841"
FT                   /db_xref="GOA:A2RW65"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW65"
FT                   /protein_id="ABM99841.1"
FT                   /translation="MAGASEIREARRSREPAAPDEQGASMKAAVVHRAGERPTYAEFEP
FT                   PRALPGHRLIDVSASALSRLAQARASGAHYSSTGGFPFVAGVDGVGRLDDGRRVYFFGP
FT                   PAPFGALAERTLVPAAQCIPLPDSIDDATAAAIAIPGMSSWAALTERARLAAGETVLVN
FT                   GATGASGRLAVRIAKHLGAASVIATGRNAHALDALSSAGADATISLAQDDEQVARAFEA
FT                   HFRAGVDVVLDYLWGVSARAALLAAAKAPQQARPVRFVQIGTIGGADLPLPGAVLRASA
FT                   ITLMGSGLGSIALPRLLNAARAVLGAACEARLRIDTRTVPLADVDAHWGDTGSTLRPVF
FT                   TMRAPG"
FT   gene            complement(95681..96772)
FT                   /locus_tag="BMA10229_0109"
FT   CDS_pept        complement(95681..96772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0109"
FT                   /product="putative outer membrane porin"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99502"
FT                   /db_xref="GOA:A2RW66"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW66"
FT                   /protein_id="ABM99502.1"
FT                   /translation="MKKHRRLAGTTAISASLAACAGLASGHALAQSSVTLYGIMDAGIE
FT                   YVNHAAPDGGGAFRMKSGNKNTSRWGLRGVEDLGGGLKAVFRLESGIDLANGAFDDGPD
FT                   SIFARRATVGLKGQWGELTLGRNFTPTYDYMLPFDPMGYAQNYSWATSSTATGGRKDGL
FT                   FTRSSNAVRYDGAYGGLRFGAMYGFGNVPGSMKTSSKYDFALGYESGPFAAVVTFDRQN
FT                   GAADSVTPADPVNYVQGIHAGVSYDFGRLKTMAGYRNYRRTYHTAAATQLSDMYWLGGS
FT                   YDFTPAFSLTGALYHQNIKGGTDADPTLVSLRAQYALSKRTVLYAAGGFAIAKHRQNVS
FT                   VSRDSVGYADTQLGVTVGMQQRF"
FT   gene            complement(96802..97101)
FT                   /locus_tag="BMA10229_0110"
FT   CDS_pept        complement(96802..97101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99016"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW67"
FT                   /protein_id="ABM99016.1"
FT                   /translation="MRESAVRRDFDLARDASGDRCIAECVSAVVRGPACGVPRSVMRRA
FT                   DREAQPPRTRMATPGRTSAACSPASPAVPAASPRRPAPAHPARACSQTAACARP"
FT   gene            complement(97257..98324)
FT                   /locus_tag="BMA10229_0111"
FT   CDS_pept        complement(97257..98324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0111"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00485"
FT                   /db_xref="GOA:A2RW68"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW68"
FT                   /protein_id="ABN00485.1"
FT                   /translation="MDKLIVDDLHLSYGANPILKGVSFELNAGEVVCLLGASGSGKTTL
FT                   LRAVAGLETPSSGRIRLDGRTFFDGAGRIDLPVEARSLGLVFQSYALWPHRTVAENVGY
FT                   GLKLRRVASNEIKRRVQTALEQLGLGHLAARYPHQLSGGQQQRVAIARALVYNPPVILL
FT                   DEPLSNLDAKLREEARAWLRELIVSLGLSALCVTHDQAEAMAMSDRILLLRDGRIEQEG
FT                   APAELYGAPRTLYTAEFMGSNNRLDARVDTIDGERVTLAGDGWRLAALARGALRRGEDA
FT                   HAVIRVERVQVADGPGENRLPAELVTSMYLGDRWEYLFHCGALRLRAFGTVPRAAGRHW
FT                   LEFPANDCWAFAKAG"
FT   gene            complement(98291..100084)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0112"
FT                   /note="ABC transporter, permease protein; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00528"
FT   gene            complement(100184..101272)
FT                   /locus_tag="BMA10229_0113"
FT   CDS_pept        complement(100184..101272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0113"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99736"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW70"
FT                   /protein_id="ABM99736.1"
FT                   /translation="MHHAPAGIAAVLFVAASTVCAQVPAGYPGNYQHVIDAAKQEGKLV
FT                   VYSTTDTSLVRPLIKDFESLYGVKVEYNDMNSTELYNRYVSESAAKSAIADVLWNSAMD
FT                   LQVKLVNDGLTAAYDSPETPHMPQWAQYQKQAYGTTYEPLAIVYNKRLIAERDVPKTRA
FT                   DLIRLLQSQPERFKGKVTTYDIEKSGVGFNYLTQDAHVNEKVTWELVRAIGATGPKLQS
FT                   STGAMMERISSGENLVGYNIIGSYAYAKAKKDKSIGYVLPKDYTLVVSRLVAISKQAQH
FT                   PNAAKLWVDYLLSRRGQTLIANQANLYSIRADVSGETSMTSLAKELGDSLKPIQIGSGL
FT                   LVYLDQSKRLAFLKQWQQALKR"
FT   gene            101314..102072
FT                   /locus_tag="BMA10229_0114"
FT   CDS_pept        101314..102072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0114"
FT                   /product="DNA-binding response regulator TctD"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99370"
FT                   /db_xref="GOA:A2RW71"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW71"
FT                   /protein_id="ABM99370.1"
FT                   /translation="MVSGAHFQRAFIFRHDRFLLIMDFPRFRSMRVLLVEDNPILAQSL
FT                   ADALSSARFAVDHMADGEAADHVLHTQDYALVILDLGLPKLDGLDVLRRLRARRNPVPV
FT                   LILTAHGSVEDRVRGLDLGADDYLAKPFELTELEARARALIRRSLGHEHGRVECGPLAF
FT                   DSVDRSFRLNNDALALTPRERSVLEVLILRNGRAINKETLSEKIFGLDESVNADAIEIY
FT                   VHRLRKKLEGSGVAIVTLRGLGYLLEAQPS"
FT   gene            102069..103574
FT                   /gene="tctE"
FT                   /locus_tag="BMA10229_0115"
FT   CDS_pept        102069..103574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tctE"
FT                   /locus_tag="BMA10229_0115"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518; match to protein family HMM PF08521"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98432"
FT                   /db_xref="GOA:A2RW72"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW72"
FT                   /protein_id="ABM98432.1"
FT                   /translation="MTRLNLRAQVALWLLLPFLGLLALDSWLTYQRAMNAAHVAFDRTL
FT                   ASSLKSIREGVRLVGGEVEVDLPYLALEMFESNDGGKIYYLIRGDDGRAVTGYRDLPMP
FT                   GAGAPLYATSFYDAVYRGEQLRMAALRLPVHDVPSARTRVVWVMVGETIEARQALAREI
FT                   LVGSLLQEGLLVVLALGIVWLGVGRGLRPLNRLSAKVAARAEDDPTPLETLGLPSEVAP
FT                   LVESINQYVARTQRMQVARRRFFADAAHQLKTPLAAAQAGVELALRPAERERVSVHLRR
FT                   VNGAVRQAAKIVQQLLSLSRLESDVAPAIERKPVALAKLARSVTLDWSGVARARGIDLG
FT                   FEQRASVDVMGRADLLGELVGNLIDNAIRYAGDGAVITVRVAREGALARLEVIDDGPGI
FT                   APGERDAVFERFYRSHATLAVEGTGLGLSIVREIARVHRGAVELDDAALAGGAAGDAGD
FT                   RAGERRERGEADRRGDSDGERSAERPARGRGLVVRVTLPALAV"
FT   gene            complement(104203..104982)
FT                   /locus_tag="BMA10229_0116"
FT   CDS_pept        complement(104203..104982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0116"
FT                   /product="MOSC domain protein"
FT                   /note="identified by match to protein family HMM PF03473"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99391"
FT                   /db_xref="GOA:A2RW73"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW73"
FT                   /protein_id="ABM99391.2"
FT                   /translation="MLEAHWPYRRGQVTMLTQRTHPRLALVRTAIGERELVVTAAGMPE
FT                   LRTPLAASALAGAERLAATVWRDTVSALDTGAHAARWFSEFLGAPARLARFAPDARRVV
FT                   GAKWTGPFTSYAQFADGFPLLVVGQSSLDDLNVRLRRKGASAVPMNRFRPNVVLVGLDA
FT                   YEEDYVDYLDVQTGGGGVRLSLVKLCTRCPVPTIDQRTGAPDPAWPNEPTDTMSLYRGS
FT                   KQFGGALTFGKNAIVLNGDGAFLEVGQSVDAEIAFGE"
FT   gene            complement(104990..105823)
FT                   /locus_tag="BMA10229_0117"
FT   CDS_pept        complement(104990..105823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0117"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99624"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABM99624.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(105847..106110)
FT                   /locus_tag="BMA10229_0118"
FT   CDS_pept        complement(105847..106110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0118"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00120"
FT                   /db_xref="GOA:A2RW75"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW75"
FT                   /protein_id="ABN00120.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            complement(106176..107444)
FT                   /locus_tag="BMA10229_0119"
FT   CDS_pept        complement(106176..107444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0119"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF05231"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99113"
FT                   /db_xref="GOA:A2RW76"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW76"
FT                   /protein_id="ABM99113.1"
FT                   /translation="MNTKRSRPELVAALLWAALYLASGYLSHALNGPVRLTGYIWLPAG
FT                   VTVGAFMLRPVREWPMLAAAFVAAQLALTGIEHGNPFNAALFAIDELGAAALAVGFVRR
FT                   IRFSLEGLYFLRSVILAGVIAGVLGALGGAAWYTVVNGASFVDVGLVWAASDFIGVLLV
FT                   TPVLASWSRFRAHRSGDHERFDLMLGIAAFALVAIGAFAIFDGDSASKFGIGAGFAMTY
FT                   IPLFLTVAVTLLLGGRAGSSSVLVLALIVIMQTAQGEGPFASLDANHGRSLLEAQLYLA
FT                   VASLLVLTVSTLKTTRERVHEHAQVLRNNMELALASAGQIAYVLDPSSGRIDWSGDVER
FT                   VFGVGVDAAQIASVPLVLERVHADDRDALRDYWRAEIAGEDRASLSLRVVQRDGGTQTI
FT                   TDHGAPLLDSNVDVAVVAGVWQI"
FT   gene            complement(107445..107675)
FT                   /locus_tag="BMA10229_0120"
FT   CDS_pept        complement(107445..107675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98764"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW77"
FT                   /protein_id="ABM98764.1"
FT                   /translation="MRYARRRARRADFRRAAPASARRGTDAGAPAARFGIPTRAPAAYH
FT                   SRIAHPQGHRRAPPPTNGQARPPARRSTQES"
FT   gene            108463..109065
FT                   /locus_tag="BMA10229_0121"
FT   CDS_pept        108463..109065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0121"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00108"
FT                   /db_xref="GOA:A2RW78"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW78"
FT                   /protein_id="ABN00108.1"
FT                   /translation="MNAATTADVRQHILDTAKPIMLCKGFTGVGLNEILAAAGVPKGSF
FT                   YHYFGSKEAFGESILESYFDDYVAHLDELLVRGPGAAIDRLMRYWTQWQQMQMGNDPEG
FT                   KCLVVKLGAEVCDLSEAMRAALERGTSQIVARLAACIAAALDDGSLKVDLEPQQTAAML
FT                   YELWVGATLIEKIRRDGEPLAVAMASTRRVLGLTGAR"
FT   gene            109183..109581
FT                   /locus_tag="BMA10229_0122"
FT   CDS_pept        109183..109581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0122"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99763"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW79"
FT                   /protein_id="ABM99763.1"
FT                   /translation="MPREPAPVRQADRFARGRRSPSIERLDAKPRTFDDGGEAGRRAVG
FT                   RGRRAIVGATVSGGTRDARTPRRSPSAPLPTEAARGMTRSEAGRHGRTVAPRPMRAAAA
FT                   AAPFRSRASGTPAASKTYDRRARPGRAA"
FT   gene            109610..110290
FT                   /locus_tag="BMA10229_0124"
FT   CDS_pept        109610..110290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0124"
FT                   /product="DJ-1/PfpI family protein"
FT                   /note="identified by match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98526"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW80"
FT                   /protein_id="ABM98526.1"
FT                   /translation="MKILVVLTSHDELGTTGKKTGFWLEELAAPYYALKDAGAELTLAS
FT                   PRGGLPPVDPKSDDPASQTDATRRFAKDAEAQAALASTRKLADVSIDDYDAVFYPGGHG
FT                   PLWDLAEDRHSIALIERAIATNKPVAAVCHAPGVLRNVKDPSGASFVKGLNVTGFSNSE
FT                   EAAVELTEVVPFLVEDMLKTNGGNYSRAADWAPHVVVDGLLVTGQNPASSEPVAEALLN
FT                   LLET"
FT   gene            complement(110271..110480)
FT                   /locus_tag="BMA10229_0123"
FT   CDS_pept        complement(110271..110480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0123"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98867"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW81"
FT                   /protein_id="ABM98867.1"
FT                   /translation="MRLRHGPARRRRRAAKHAHREAIRYGVTRREAAEREPTSARLDAN
FT                   RARQQRGERCATRPPAPRITSRAD"
FT   gene            110579..111676
FT                   /gene="xenA"
FT                   /locus_tag="BMA10229_0125"
FT   CDS_pept        110579..111676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xenA"
FT                   /locus_tag="BMA10229_0125"
FT                   /product="xenobiotic reductase A"
FT                   /note="identified by match to protein family HMM PF00724"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99871"
FT                   /db_xref="GOA:A2RW82"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW82"
FT                   /protein_id="ABM99871.1"
FT                   /translation="MAALFEPFQLKDVTLRNRIAVPPMCQYVAEDGVPNEWHHVHLAGI
FT                   ARGGAGLVIAEATAVSPEGRITPGCTGLWSDGQAAAFARSVAAIKAAGAVPGIQLAHAG
FT                   RKASANRPWEDDDHIADGDPRGWRTIAPSAVPYGAHLPKVPREMTLDDIARVKADYVAA
FT                   AKRALDAGFEWLELHFAHGYLAQSFFSVHSNRRADAYGGSAENRGRFLVETLAAVREVW
FT                   PERLPLTARFGVIEYDGRDEQTLAESIELAKRFKLEGLDLLSVTIGFSTPAARIPWGPA
FT                   FLAPVAERVRREAQLPVASAWGIDAPALAERVVREGQLDLVMVGRAHLADPHWPYRAAL
FT                   ELGVDRAPWTLPAPYAHWLERYRAA"
FT   gene            complement(111964..112155)
FT                   /locus_tag="BMA10229_0126"
FT   CDS_pept        complement(111964..112155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0126"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00244"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW83"
FT                   /protein_id="ABN00244.1"
FT                   /translation="MRDGDAHAPMQAAGIGRPSWPDSHPAGRRASSRSGAAISFGADGG
FT                   APPAVTPRRPRGGHADRT"
FT   gene            112277..112561
FT                   /pseudo
FT                   /locus_tag="BMA10229_0127"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            112648..113409
FT                   /locus_tag="BMA10229_0128"
FT   CDS_pept        112648..113409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0128"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98911"
FT                   /db_xref="GOA:A2RW85"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW85"
FT                   /protein_id="ABM98911.1"
FT                   /translation="MRLQHKRGLIIGIANENSIAFGCARVMREQGAELALTYLNEKAEP
FT                   YVRPLAQRLDSRLVVPCDVREPGRLEDVFARIAQEWGQLDFVLHSIAYAPKEDLHRRVT
FT                   DCSQAGFAMAMDVSCHSFIRVARLAEPLMTNGGCLLTVTFYGAERAVEDYNLMGPVKAA
FT                   LEGSVRYLAAELGPRRIRVHALSPGPLKTRAASGIDRFDALLERVRERTPGHRLVDIDD
FT                   VGHVAAFLASDDAAALTGNVEYIDGGYHVVG"
FT   gene            113960..114133
FT                   /pseudo
FT                   /locus_tag="BMA10229_0129"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            114281..115351
FT                   /locus_tag="BMA10229_0130"
FT   CDS_pept        114281..115351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0130"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00483"
FT                   /db_xref="GOA:A2RW87"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW87"
FT                   /protein_id="ABN00483.1"
FT                   /translation="MVQNASVPPASAGRPKAQSIALGALYAALVALALWVIRDFMPAIA
FT                   WACVVAIALWPALRRIDALPALRGRATLVAAVLTSAVALLVVVPIAAGLVEAVDQSHEL
FT                   LGWLHRVEQTGIPEPDVLSHLPFGSQQASAWWLANLAKPLHPATAVKGVDGASVVTFGR
FT                   HFGSRLAHAAVLFGFMLVTLFVIFQAGPRLSGSLLTGVRRAFGDSGAALLQRMAAAVYG
FT                   TVTGLVVVGFGEGVLLGLAYAFAGLPHAALLGLVTAIAAMLPFCAPLVFGGAALWLFVQ
FT                   GALGWAIGLAAFGSVVVFAAEHFVRPVLIGNSARLPFLLVLFGILGGAETFGLLGLFVG
FT                   PALMTVLTVLWAEWVD"
FT   gene            115477..115872
FT                   /gene="osmE"
FT                   /locus_tag="BMA10229_0131"
FT   CDS_pept        115477..115872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmE"
FT                   /locus_tag="BMA10229_0131"
FT                   /product="osmotically-inducible lipoprotein OsmE"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98754"
FT                   /db_xref="GOA:A2RW88"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW88"
FT                   /protein_id="ABM98754.1"
FT                   /translation="MSFQTTNRTVSALACPFAAALLMSGCSWFGGWFDSFSYARLPLPK
FT                   AAAQPGATQAQIVKAGGNPASVWMVRNGAGVCYNYDLRHGNDHRPYYVVFDRRGIVSRH
FT                   GFSTCAQADREGLLRGGARSTRDEPRA"
FT   gene            complement(116159..116953)
FT                   /locus_tag="BMA10229_0132"
FT   CDS_pept        complement(116159..116953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0132"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99256"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW89"
FT                   /protein_id="ABM99256.1"
FT                   /translation="MHIDLTGKTALVTASTAGIGLAIAEGLARAGAQLFINGRSDASVK
FT                   AALAHLRVTAPGAHAQGVVADLSDADGARRVIDAAPSADILVNNAGIYGPKPFFDIDDA
FT                   EWEHFFQVNVMSGVRLARHYLKGMLERDWGRVVFISSESALNVPADMIHYGFTKTAQLS
FT                   ISRGLAKLAAGSRVTVNAVLPGPTMSDGVKAMLKATADAEHTSIEQAGVDFVRTHRSSS
FT                   IIQRPATCDEVANLVVYVCSPQSSATTGAALRVDGGVVDTIA"
FT   gene            complement(117296..118804)
FT                   /locus_tag="BMA10229_0133"
FT   CDS_pept        complement(117296..118804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0133"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99066"
FT                   /db_xref="GOA:A2RW90"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW90"
FT                   /protein_id="ABM99066.1"
FT                   /translation="MDYGVLLSNFERDTARDALARASQQHRLYACLRAAILNGTLEAGT
FT                   YLMSSRALAETLRIARNTVLYAYERLAAEGFVVARRQGTMVARVGLPAASATASPTHAR
FT                   PALARRVTGLPDIDADDEREPLPFLPGMPALDQFPLAPWRRAVERAWRRIGPAQLGHAP
FT                   LGGNLRLRQAIAEYLRVSRGIGCDAQQVFITDGTQHGLDLCARTLADAGDTVWIEHPGY
FT                   AGARAAFEAADLRLVPIPVDADGLAPSAEHWRAHPPRLVYITPSHQYPLGAVMSVERRV
FT                   ALVANARAAGAWIVEDDYDSEFRHFGAPLAALQSLGDDAPVVYLGTFSKTMFPTLRIGF
FT                   VVASAALAPQLRHTIGALAPRGRLAEQLALADFIEAGHFTRHLRRMRRLYEERRDALQD
FT                   ALARHLGGALTVSSGAGGMHLSARLDAPVADVDVARAALARAITVRPLSRFCLPGTDRA
FT                   AYNGLVLGYGAVPTEQIDACVRRLGAAIDDALREVTQAPRDAAR"
FT   gene            118842..119627
FT                   /locus_tag="BMA10229_0134"
FT   CDS_pept        118842..119627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99532"
FT                   /db_xref="GOA:A2RW91"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW91"
FT                   /protein_id="ABM99532.1"
FT                   /translation="MVPQIFYRRALRNEHADAGAPPMTSTAADSAIPPGAPSARTRVRR
FT                   AAYRGHYDRPTLEAILDDAYVCHVAFADDSGVHCIPTACWREGDHLYIHGSNGSRMLKL
FT                   AAAGAQVCVTVTHLDGLVLARSAFNHSMNYRSAVIYGEFEVVPDARKAAVLDTFVERIA
FT                   PGRSRDARPGDASELAATTVLRIALDEVATKVRTGGPKDDEADLGLPVWAGVLPMREAH
FT                   FAPLTDAAPAGVPDYVRRWQDAVPLRETQDEEARRAAAR"
FT   gene            complement(120102..120865)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0136"
FT                   /note="heavy metal sensor signal transduction histidine
FT                   kinase, authentic frameshift; this gene contains a frame
FT                   shift which is not the result of sequencing error"
FT   gene            complement(120908..121762)
FT                   /locus_tag="BMA10229_0137"
FT   CDS_pept        complement(120908..121762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0137"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99158"
FT                   /db_xref="GOA:A2RW94"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW94"
FT                   /protein_id="ABM99158.1"
FT                   /translation="MMTDDVQAPHRPPLAADEAARADEAAAEPASAPAEAPVETSAAAP
FT                   VRAAAAAAAAAGAGELRALFSRCGWFNTLAPEHQALVVAQSHAEYRDAGDWVARRQAPS
FT                   EYWIGVHRGLVKLAIYNASGRGCTFSGVPSGGWFGEGSVIKRELRKYDVIAIQRSLVLF
FT                   VPSATFHALLDSNLPFTGFVIRQLNNRMGEFIASIQNSRLLDVNARVAQSLAQLFNPDL
FT                   YPDTGATLAISQEELGMLVGVSRQRINQALQHLERLGAVRLAYNQIDVLDLPKLAAFGM
FT                   EQI"
FT   gene            121914..123575
FT                   /locus_tag="BMA10229_0138"
FT   CDS_pept        121914..123575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0138"
FT                   /product="AMP-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00377"
FT                   /db_xref="GOA:A2RW95"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW95"
FT                   /protein_id="ABN00377.1"
FT                   /translation="MTQKFEEGLGRREANYVPLTPIDFIARAAEVYGERLAAVHGEIRR
FT                   TWSETYARARRLASALERAGVGRGDTVAALLPNIPAMIEAHFGVPMAGAVLNALNTRLD
FT                   VASMLFMLRHGEAKVLIVDTEYAEFAHRAALEVPGLAIVSVADAMPADPARFPAALDYE
FT                   AFLAGGDPAYAWTPPSDEWEAIALNYTSGTTGDPKGVVYHHRGAYLAAISNLLEWDMPK
FT                   HAVYLWTLPMFHCNGWCFPWAVAARAGVNVCLRKFDAKRVLELIRRERVTHYSGAPIVQ
FT                   SAIANAPAEWRAGIAHEVHAFVAGAAPAPAVIAKMKEIGFDLTHVYGLTEVYGPATVCA
FT                   KQAHWASLPDDELAQLNARQGVRYHLQAGATVLDPDTMAPVPADGETLGEIMFRGNLCM
FT                   KGYLKNPHATDEAFAGGWFHTGDLGVLTPDGYIRIKDRRKDIIISGGENISSIEVEDAL
FT                   YRHPAVEVAAVVALPDPKWGEVPCAFVELRDGMSATEEEIIAHCRLLLAAYKIPKTVRF
FT                   GELPKTSTGKIQKFQLRAQVGSSSAIDLVAAARKPG"
FT   gene            complement(123594..123815)
FT                   /locus_tag="BMA10229_0139"
FT   CDS_pept        complement(123594..123815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0139"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00369"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW96"
FT                   /protein_id="ABN00369.1"
FT                   /translation="MHACAAARAPRTAHCRPCGARIARSAAPSTSRRPARRAWDARAPS
FT                   IETPSATCPAGGERAAHAARNGRSPPVT"
FT   gene            complement(123893..126172)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0140"
FT                   /note="methyl-accepting chemotaxis protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   SP:P05704; match to protein family HMM PF00015; match to
FT                   protein family HMM PF00672"
FT   gene            complement(126340..126951)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0141"
FT                   /note="outer membrane efflux protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            complement(126958..128199)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0142"
FT                   /note="RND efflux system, outer membrane lipoprotein, NodT
FT                   family; this gene contains a premature stop which may be
FT                   the result of a sequencing error; identified by match to
FT                   protein family HMM PF02321; match to protein family HMM
FT                   TIGR01845"
FT   gene            complement(128257..130224)
FT                   /locus_tag="BMA10229_0143"
FT   CDS_pept        complement(128257..130224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0143"
FT                   /product="putative cellulose synthase"
FT                   /note="identified by similarity to SP:P21877; match to
FT                   protein family HMM PF00535; match to protein family HMM
FT                   PF07238"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99611"
FT                   /db_xref="GOA:A2RWA0"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWA0"
FT                   /protein_id="ABM99611.1"
FT                   /translation="MFDFFLANRSLLDINGGVLLVVLLLTRAGRRERAADRIVFGGVTV
FT                   VLLLVYLAWRATQTLPEPRMDFPSAWAHVFFGFECMALAYTLISVAVLTRTTERTPQAD
FT                   AGEAALRRAAAPPRVDIFIATYNEGLDILEKTTVAALAIDYPDFRVWVLDDTRRDWLKA
FT                   FCDQVGARYATRADNAHAKAGNLNNGLRLSARSEGGGAPYIMVLDADFAPHRKILLRTV
FT                   GLFADRTVGIVQTPQFYYNADPVQYNLRSAECWVDEQRAFFDVMQPAKDAWGAAFCIGT
FT                   SFVVRRDLVERIGGFPTGTVTEDIHLTYRLMRHGYVTRWLNERLSVGLSAEGLPEYISQ
FT                   RSRWALGTIQVALTPDGPLRGRGYTFAQRLHYVHGMLHWLSRPFTLMLLLGPLLYWYFD
FT                   IPTLYGEPLQFLAYGLPALIAYWGYSMWITGRRALPVFTEVTQIVCALAVSLSLASALV
FT                   RPFGRPFKVTNKGLDRSKLIVHGRFAAFYAGLLVLSALGLGRALASAPGAPGLAFNAAW
FT                   TAISLALYLASLLVCIELPRPRREERFPYRARARLRVGDREYAVATRDLSCNGAAVTTA
FT                   QAASLPLHAAGALWLAPIGWIPCRIVRRDGALLGVALGADTAARHGLIRLLFGDPPHNI
FT                   AIRGRPRLAISRLMQRALSG"
FT   gene            complement(130227..131489)
FT                   /locus_tag="BMA10229_0144"
FT   CDS_pept        complement(130227..131489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00116"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWA1"
FT                   /protein_id="ABN00116.1"
FT                   /translation="MASLLFVAHGAAGAEPPRAALLAAGCKTLAERVHALPGSGPVFLG
FT                   SYEPAPGGAALAGALTQAAFVYDNALASIALIACHRPGDARRIADAILQASRQDRHYRD
FT                   ARVRNAYRAGALPPGPAPLPGWWDTPSKRWFEDAYQAGTATGNVAWAALSLLAVYEATR
FT                   ERRYLDGAAALMGWVDPGRLDATAPAGYVGGEFGHEPQPLRQGWKSTEHNVDAYAVFRW
FT                   LAARTGDARWHAVAGRARRFVSAMWEPGDGRFLIGTRDDGHTPNTGPSALDASLWPLLA
FT                   MPDAPADWRRSLAWVERAHRIDGGYGFNAHPDGVWTEGTAQAALALQAAGRSDDARPLW
FT                   ALLMSQRAPSGLLFATPEPSIRTGLSIGPTSKTDDFRYFHLPHLSATAWAVLAAAGWNP
FT                   FRPGGCLAAGYPGDAAPACGA"
FT   gene            complement(131567..133003)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0145"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            133138..133320
FT                   /locus_tag="BMA10229_0146"
FT   CDS_pept        133138..133320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0146"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00321"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWA3"
FT                   /protein_id="ABN00321.1"
FT                   /translation="MRQKTGAHARPGAARVDVDGIDGDRRASLRTCVGAQNGFLSNSWL
FT                   LQGAVSEHLSNRRTV"
FT   gene            complement(133532..134140)
FT                   /locus_tag="BMA10229_0147"
FT   CDS_pept        complement(133532..134140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0147"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98490"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWA4"
FT                   /protein_id="ABM98490.1"
FT                   /translation="MLRAANERANPIGAPDKVHCIRAVRPARSSSPDITQKPCQRDASG
FT                   SRRHATSARDGRPAALRRCRNATRRPRPATCAYMRTRCARESACQNDSPTLRNARTVHR
FT                   DIATRIIDETSRPLPPRAAARHPCDPFRPRSFGMRSAARRAIRWRQSVPEGRAAAERRM
FT                   SNHASACRPRACVATDGARRALSSDESERIREPSNSAAA"
FT   gene            134144..134473
FT                   /locus_tag="BMA10229_0148"
FT   CDS_pept        134144..134473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0148"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99081"
FT                   /db_xref="GOA:A2RWA5"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWA5"
FT                   /protein_id="ABM99081.1"
FT                   /translation="MDTLPNQSDAQFQAFLAKLLEQPQPAVWGEKQQIELDMARELAVE
FT                   MLQLAERMNAAHTPDLENCLVLLRHAKVLDFILSSLAARRDIHPRTLRTIFKLAKLKVH
FT                   DSYPE"
FT   gene            complement(134658..135137)
FT                   /locus_tag="BMA10229_0149"
FT   CDS_pept        complement(134658..135137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99548"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWA6"
FT                   /protein_id="ABM99548.1"
FT                   /translation="MRIMRIMRITRTTRIASSAENHENGRGVAPRPDSPPTLDMRREPN
FT                   RRLPGAPPLERFAAAARGGEPVSAAHCTAASHARVAAKTVHPWKCGRAKPWARSVQDAG
FT                   YRDGHTRLCASNRPFAESCSTCRRQAGAAGVAHETGRAGCERRGPIATRTSARHD"
FT   gene            135136..135342
FT                   /locus_tag="BMA10229_0150"
FT   CDS_pept        135136..135342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00279"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWA7"
FT                   /protein_id="ABN00279.1"
FT                   /translation="MIRAIRVAGGDVARIGDVADILVCKTGIESLRSRSPRLAARSPCR
FT                   ATAGRFAGLRGCRALPAARRLSD"
FT   gene            complement(135376..135870)
FT                   /locus_tag="BMA10229_0151"
FT   CDS_pept        complement(135376..135870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0151"
FT                   /product="2,4'-dihydroxyacetophenone dioxygenase"
FT                   /EC_number="1.13.11.41"
FT                   /note="identified by match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98863"
FT                   /db_xref="GOA:A2RWA8"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWA8"
FT                   /protein_id="ABM98863.1"
FT                   /translation="MNSPLPPAPAAFLPPISCLQDDDRPWLPMDASLPGLAIKYLHINV
FT                   ADDEMTVLLKMPVGLALPRHRHDGAVFVYTLQGEWRYREYDWIARPGSAVLEPAGSHHT
FT                   PEALASETGAVVTFNVMRGDLVLLDDAGRETARENCRVALLRERRFARGAPDAAAPFVT
FT                   R"
FT   gene            complement(136021..136806)
FT                   /locus_tag="BMA10229_0152"
FT   CDS_pept        complement(136021..136806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0152"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99008"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWA9"
FT                   /protein_id="ABM99008.1"
FT                   /translation="MNPKVTGGSGVDPTYAATSTTAEPQAASHASGTSRTIPSELRELQ
FT                   RTKFRLGGSPVFQRPVQPNRDGSGVGVVVPENSVGRIPPGGAANLCYPNISSCVSVSAL
FT                   SRNGSLRGVHLTTPEGFEQKDMETMFEAIDAKNCAQVVVAGPIQEAKGRTENSEFNTRA
FT                   NITARIHKLAPDAQVGFVETEATVRPHDIYVRHDPQTADGKLEVHVAPSDVSSEDGVKT
FT                   GRIPQDASIPGHAHRVADGDIVQSRQGGLRRLFSFSKNG"
FT   gene            complement(136803..137231)
FT                   /locus_tag="BMA10229_0153"
FT   CDS_pept        complement(136803..137231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0153"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99826"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWB0"
FT                   /protein_id="ABM99826.1"
FT                   /translation="MSSHARRAAARDCRILTTVGQASLDARRATAASAASHARARDATP
FT                   RRPGRRRANAPLADGVRPNGPRLRAIGAITIARAAWKINSYDRMSRRKAAPAGARHGDG
FT                   TQRAARSRISTRGAPMRRARRRPARPASPGRETLIATE"
FT   gene            137365..137568
FT                   /pseudo
FT                   /locus_tag="BMA10229_0154"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(137753..138703)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0155"
FT                   /note="transcriptional regulator, LysR family; this gene
FT                   contains a premature stop which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT   gene            138762..140162
FT                   /locus_tag="BMA10229_0156"
FT   CDS_pept        138762..140162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0156"
FT                   /product="beta-alanine--pyruvate transaminase"
FT                   /EC_number="2.6.1.18"
FT                   /note="identified by match to protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99456"
FT                   /db_xref="GOA:A2RWB3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWB3"
FT                   /protein_id="ABM99456.1"
FT                   /translation="MRNIFIHSRIAAPTDMNAPTEPTAPDTTVRTDAEWLDAHWMPFTA
FT                   NRQFKRDPRIIVEGKGAYYTAADGRQIFDGLSGLWCCGLGHGRAEISDAVARQVARLDY
FT                   SPAFQFGHPQSFELANRIKAMTPAGLDYVFFTGSGSEAADTSLKLARAYWRAKGKGTKT
FT                   RLIGREKGYHGVNFGGISVGGIGPNRKLFGQGIDADFLPHTQLPENRFSRGLPERGAEL
FT                   AERLLDLIALHDASNIAAVIVEPFSGSAGVVVPPKGYLQRLREICTAHDILLIFDEVIT
FT                   GFGRTGAMTGAEAFGVVPDIMNVAKQVTNGAQPLGAVIASKDVYDAFMAAGGPDYMLEF
FT                   SHGYTYSAHPVACAAGVAALDLLVKEDALGRVRELAPYFEAAVHGLKGVRHVADIRNCG
FT                   LAAGLTIEHAPGEPARRPYEIAMHCWKNGFYVRYGGDTIQLAPPFIAEKREIDSLIGAL
FT                   NDALLATD"
FT   gene            140232..141890
FT                   /gene="mmsA_2"
FT                   /locus_tag="BMA10229_0157"
FT   CDS_pept        140232..141890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA_2"
FT                   /locus_tag="BMA10229_0157"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01722"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00186"
FT                   /db_xref="GOA:A2RWB4"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWB4"
FT                   /protein_id="ABN00186.1"
FT                   /translation="MRSAPARRTRPDRRRSASIRAVRVPRARAGAGSATHPTQHTNSGN
FT                   TAMKHDSNVTPPLGHLIDGKRVDGGERVQPVFDPATGASTKRVRMADRPSVEAAIAAAQ
FT                   AAYPAWRNTPPLKRARVMSRFKTLLEEHANELCALITAEHGKVLADAMGELQRGIENVE
FT                   YASYAPELLKGEHSKNVGPAIDSWSEFQALGVVAGITPFNFPIMVPLWMWPMAVACGNT
FT                   FVLKPSERTPSSTLRMAELALEAGLPPGVLNVVNGDKEAVDTILTDSRVKAVSFVGSTP
FT                   IAESIYATGCAHGKRVQALGGAKNFAIVMPDADIGNAVNALMGAAYGSCGERCMAIPLV
FT                   VAIGDDTAEQVVDGLKAEIAKMKVGPGTGEQVDMGPLVTRQHFEKVTGFVEAGIAAGAT
FT                   LVVDGRGVKVDGHEGGYYLGPCLFDHVKPGMPIYQHEIFGPVLGVVRVASLAEAMALVD
FT                   AHEYGNGTCLFTRDGEAARFFSDNIQVGMVGINVPLPVPVAYHSFGGWKRSLFGDLHAY
FT                   GPDAVRFYTKRKTITQRWPSAGVREGTVFSFPSSR"
FT   gene            141902..142072
FT                   /locus_tag="BMA10229_0158"
FT   CDS_pept        141902..142072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98472"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWB5"
FT                   /protein_id="ABM98472.1"
FT                   /translation="MVGLARPFGGALRRRPVSKPAQHAGFFFALRALSGNVGRLVGDPR
FT                   MRRHLTKLLTT"
FT   gene            complement(142230..143063)
FT                   /locus_tag="BMA10229_0159"
FT   CDS_pept        complement(142230..143063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0159"
FT                   /product="IS1404 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99828"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABM99828.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(143087..143350)
FT                   /locus_tag="BMA10229_0160"
FT   CDS_pept        complement(143087..143350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0160"
FT                   /product="Transposase subfamily"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99464"
FT                   /db_xref="GOA:A2RVY0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVY0"
FT                   /protein_id="ABM99464.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKDLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            143492..146500
FT                   /pseudo
FT                   /locus_tag="BMA10229_0161"
FT                   /note="sarcosine oxidase, alpha subunit, truncation;
FT                   comparison of this gene to its homologs suggests this gene
FT                   has been truncated; identified by match to protein family
FT                   HMM PF01571; match to protein family HMM PF07992; match to
FT                   protein family HMM PF08669; match to protein family HMM
FT                   TIGR01372"
FT   gene            146768..147121
FT                   /pseudo
FT                   /locus_tag="BMA10229_0162"
FT                   /note="sarcosine oxidase, gamma subunit; this gene contains
FT                   a frame shift which may be the result of a sequencing
FT                   error"
FT   gene            147121..147582
FT                   /locus_tag="BMA10229_0163"
FT   CDS_pept        147121..147582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0163"
FT                   /product="putative dihydroneopterin aldolase"
FT                   /note="identified by match to protein family HMM PF02152;
FT                   match to protein family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99536"
FT                   /db_xref="GOA:A2RWB9"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWB9"
FT                   /protein_id="ABM99536.1"
FT                   /translation="MKPVEEPFAALDPARSRGRGWSVFVDALKVPARIGIHAHEHAAPQ
FT                   PVVIDARLAYRREPSEASGDGWIDYDAYCARIASFLARKPHTRLLETLALEIAVLSFDE
FT                   WPALDALTLALHKPKIRPGTKRVGVELDWTRGDYRAWRAASEPNGASSG"
FT   gene            147925..148086
FT                   /pseudo
FT                   /locus_tag="BMA10229_0164"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            148113..148322
FT                   /locus_tag="BMA10229_0165"
FT   CDS_pept        148113..148322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0165"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98958"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWC1"
FT                   /protein_id="ABM98958.1"
FT                   /translation="MRRAMHRAAAASSVRNECIKRGPACAPLTRMRSILAQYFFFGGID
FT                   RRTCLRSRATAAAFFRLRSVVGFS"
FT   gene            148529..148915
FT                   /locus_tag="BMA10229_0166"
FT   CDS_pept        148529..148915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0166"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98856"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWC2"
FT                   /protein_id="ABM98856.1"
FT                   /translation="MRSLLFPSMMSPLIEVRDAVATGRSAGANRRISHAARSIRARREA
FT                   ARRPPSACRRCGRMHAMRSGAGYPEHDGPEARRGHYTREWVPARFNFGCSASRCAELQA
FT                   ERGGPSAGARGRERTESGCLSEKP"
FT   gene            149085..149288
FT                   /locus_tag="BMA10229_0167"
FT   CDS_pept        149085..149288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0167"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00313"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00433"
FT                   /db_xref="GOA:A2RWC3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWC3"
FT                   /protein_id="ABN00433.1"
FT                   /translation="MDTGTVKWFNETKGFGFITPDSGGDDLFAHFSEIRSEGYKTLAEN
FT                   QKVSFETKRGPKGLQAANIKPL"
FT   gene            149489..149704
FT                   /locus_tag="BMA10229_0168"
FT   CDS_pept        149489..149704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0168"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99846"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWC4"
FT                   /protein_id="ABM99846.1"
FT                   /translation="MTSMTYRGYAVQSFAHRLPDGYFSANLQLENARLGDDDGRYSFYA
FT                   LDYFHSEDEAVCYSACWARNWIDTRG"
FT   gene            149656..149952
FT                   /locus_tag="BMA10229_0169"
FT   CDS_pept        149656..149952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0169"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99225"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWC5"
FT                   /protein_id="ABM99225.1"
FT                   /translation="MLLGLLGSELDRYARLIAALRGMASRRVTPQHAASPNADRAPCYA
FT                   ARRRCGLSGGVGGRSVARAMRRAHSPKSFRFVQQIDAFASICCASSGGGGCRV"
FT   gene            complement(150066..150497)
FT                   /locus_tag="BMA10229_0170"
FT   CDS_pept        complement(150066..150497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0170"
FT                   /product="putative alanin-rich signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98579"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWC6"
FT                   /protein_id="ABM98579.1"
FT                   /translation="MEMKTIAIVSALAAGLCFSISSFAQAPASAPVGTTGLCKDGSFYS
FT                   GASKKGACSGHKGLKTWYGASKAAASAPAAASGASSPAAATKGAAPAGAPGQVWVNTDT
FT                   KVYHCATDKYYGKTKHGEYMSEAAAKAKGFRASHGKTCS"
FT   gene            150780..151040
FT                   /locus_tag="BMA10229_0171"
FT   CDS_pept        150780..151040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0171"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00161"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWC7"
FT                   /protein_id="ABN00161.1"
FT                   /translation="MFASFEPTHTGFVAEIDGCRCSIEGAPSPIAERIDWRWTIAQPTP
FT                   ENPDGSDPYQYEVLATGETVTPLQAEQQIVAWLEAHPPEDA"
FT   gene            151206..152189
FT                   /locus_tag="BMA10229_0172"
FT   CDS_pept        151206..152189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0172"
FT                   /product="glyoxylate reductase"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99479"
FT                   /db_xref="GOA:A2RWC8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWC8"
FT                   /protein_id="ABM99479.1"
FT                   /translation="MRAIVTLASTLLPPTFAMKPRLLVLIPLRDHAHAHIADVFDILYA
FT                   LTPDQRRRAIAERGAAVQAVLTNGTTGLFAEEIACLPALEFVAALGAGYENIALDDARS
FT                   RGITVVNGAGTNDDCVADHAFALLLAAVRAVPKLDAACRAGVWRDALPMRPNMSGKKLG
FT                   IVGLGNIGQKIARRAAGFDLEIGYHNRRPREGAAYRYFAGLDALAHWADFLVVATPGGA
FT                   ATHHLIDARILDALGERGFLVNVSRGSVVDTAALADALREGRVAGAGLDVYEGEPQPPR
FT                   ALAALDSVVLTPHVGGWSPEALERSVRQFLENAARHFAGRPVLTPI"
FT   gene            152228..152713
FT                   /locus_tag="BMA10229_0173"
FT   CDS_pept        152228..152713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98873"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWC9"
FT                   /protein_id="ABM98873.1"
FT                   /translation="MSTYTAEVAWQKQESETFADNRYSRKHEWRFDGGVRVPASSSPHV
FT                   VRVPFSDPTAVDPEEAFVAALSSCHMLWFLSLAAQKQFVVTGYRDVAEGTMAKNAQGKA
FT                   AMTRVVLRPHVTFGGERAPTRDDVDALHHAAHDACYLANSVRTDIDIEGSWAHAPAR"
FT   gene            153007..155472
FT                   /locus_tag="BMA10229_0174"
FT   CDS_pept        153007..155472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0174"
FT                   /product="sensory box histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF02518; match to protein family HMM PF05227;
FT                   match to protein family HMM PF08448; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00378"
FT                   /db_xref="GOA:A2RWD0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWD0"
FT                   /protein_id="ABN00378.1"
FT                   /translation="MRPWYPSPNLQTSFVHRRLAPGAPIVPSARSSGLATAGVGKCLNR
FT                   TGTRRVRPARRRASRTTRERPACAPARGEPGGGRIPRSSLQTTFWQRHLGGGEMASGIG
FT                   RFGKRASRLIDFGLWAAAALLLLTAGVGALGTARLSDNEADIHRASEVISGLERLLALA
FT                   RDMETSQRGYILTGKTDYLQPYKAALPEIRKQFDALATLVQGDAVQQQRLATLRMLLEK
FT                   KQHELAATIELRKTEGFDAAQAIVSSDAGKIFMDRARVMVNEMEATVQQQLRTLRDRAR
FT                   ATRDIAIGVGLASGLLTLAVCVSFGYVMRRLLLVEAAAAHDLFEQRELLHVTLASIGDG
FT                   VIATDVGGRITFFNRVAEEMTALCADAVVGQPIERVLMFRHATTQRVIDNPARVAVERR
FT                   RTASLPAHTRFVGRSGGELPVDGNAAPTFDANGKLVGAVLIVRDVSERERAEERFRLAV
FT                   EAAPTAMIMVGRDGRIVLVNSQAEKLFGYARGDMIGHGIDMLVPERFRAGHWAHRDAFF
FT                   GNPDARPMGEGRDLFGLRRDGSEFPVEIGLNPITTSEGAFVLCSIADITARKRAELELR
FT                   RRSEELARSNQDLEQFAYVASHDLQEPLRAVAGPLQLLQRRYQGQLDARADEFIGHAVD
FT                   GATRMQSLIDDLLSYSRVGRLEDARRPVDCEHVLDEALRNLSAAIRESGAQVTHDPLPT
FT                   VHGIEAQLVLLFQNLIGNAIKFRGKDRVARIHLEAHTRDDAWLLRVRDNGIGIDPQYFE
FT                   RIFLIFQRLHTRREYPGTGLGLALCKRIVEHHGGRIFVESEPGQGTTFSFTLSRPGADE
FT                   TRWPRDPRE"
FT   gene            155476..155928
FT                   /locus_tag="BMA10229_0175"
FT   CDS_pept        155476..155928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0175"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99794"
FT                   /db_xref="GOA:A2RWD1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWD1"
FT                   /protein_id="ABM99794.1"
FT                   /translation="MIADERGNFVEILLVEDSPTDVMMTKEALEYYKVLNPLNVVEDGV
FT                   AAMAYLRREGPYAGARRPGLIILDLNLPRKSGREVLQELKLDPELSTIPVVILTTSKSE
FT                   EDVARSYGLHANCYITKPVDFAKFTDVVHSINEFWLSVVTLPPAKS"
FT   gene            155925..157403
FT                   /locus_tag="BMA10229_0176"
FT   CDS_pept        155925..157403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0176"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF07730; match to protein family HMM PF08447;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99626"
FT                   /db_xref="GOA:A2RWD2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWD2"
FT                   /protein_id="ABM99626.1"
FT                   /translation="MSSPSKNVEILLVEDSVTDALLIGEALIDVTEFAPHVVNAELLSA
FT                   ALECTKRAHFDVVLLDLGLPDAHGLDTFRQFHRQVPDVPVLVLTGLDDLSVGLQAIQEG
FT                   AQDYLLKKRVETPLLSRAIRYAMERHRVAAALAASEERFQLAVSGASAGLWDWNPKTGA
FT                   MYLSPHFKKIMGYEDHELPDEITGHRESIHPDDLKRVLDALKAHLEHRDTYDVEYRVRT
FT                   RSGDYRWIQSRGQALWNSAGEPYRMVGWIMDVTDRKRDEDALRVSREELRRLSAHIQSI
FT                   REEEKTRIARELHDDLGQQLTALKMAVTLVDNELKDAGWASRTSRLPNVYALIGQLLDS
FT                   VRRIAADLRPVMLDDLGLMAAIEWLTHEFVERYRIPVTSRIEADDIAFTRGSATEVFRI
FT                   VQEALTNVARHSEATEVTLDIIRDEPNCIVRIADNGCGTARDTRPNRHSLGLLGMRERA
FT                   ARLGGEIRIDTAPGRGFALTATLPLAVIEAADSA"
FT   gene            complement(157484..158920)
FT                   /locus_tag="BMA10229_0177"
FT   CDS_pept        complement(157484..158920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0177"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99079"
FT                   /db_xref="GOA:A2RWD3"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWD3"
FT                   /protein_id="ABM99079.1"
FT                   /translation="MPAAPAVPSRAARASAAARLERLPFSGYHKLIFVIIAIAFFFDSV
FT                   DLGTMTFVLGSIKREFGLSTATAGLVASASFFGMVLGAAVAGLLADRFGRRPVFQWSMV
FT                   LWGAASYLCSTAQSVDALIVYRVLLGIGMGMEFPVAQTLLSEFVPAAKRGRLIALMDGF
FT                   WPLGFITAGVVSYFVLPLFGWRTVFALLALPAVFVLVVRRLVPESPRWLEHRGRLAEAG
FT                   RVLAHVEAKVMKSARVASLPAPSRLAEPACAQGRGAFGEIWSAAYRRRTTMVWLLWFFA
FT                   LLGFYGLTSWLGALLQQAGFAVTQSVFYTVLISLGGIPGFLCAAWLVERWGRKPTCIAS
FT                   LVGGGAMAYVYGQSALFGGSVTLLVGTGLAMQFFLFGMWAVLYTYTPELYGTGARATGS
FT                   GFASAIGRVGSLIGPYAVGIVLPVFGQGGVFTLGALSFVVAALAVGVLGIETQGLALEA
FT                   LASTHAADDDARDPAGAAAN"
FT   gene            complement(159145..162522)
FT                   /locus_tag="BMA10229_0178"
FT   CDS_pept        complement(159145..162522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAH38827.1; match to
FT                   protein family HMM PF05853"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98652"
FT                   /db_xref="GOA:A2RWD4"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWD4"
FT                   /protein_id="ABM98652.1"
FT                   /translation="MVKTFYITAAPVGAVPKFLDPLEPKFIPHALLELLPADAREATTQ
FT                   ALEANGWEAVPAGGIVREYGYDAPIDLTDYDGAQASASVQDALRNTGWTPCGTVWHRTQ
FT                   TSPSLAQPPLITRTTLERLSSVDLVRQIVLQLTTFGWTATEDGSLTWTHERIHSYLSPD
FT                   FVERMRADKAAVLESLFDNGWRVCGAGYWQPGKARSPYLPITADGIVDASREALREGAA
FT                   VVHLHTRATDDQATLAIPGLNTPIGIGSQRNHIVLDDYDRIVPTMLDLEPSAILNLSTS
FT                   ARGDRRASQSPLRRAHLKRYGHAQLAPDVASFSPGPVVFQAGGGYDNPNAFLADQLAHF
FT                   AEVGVRPEIEVFNHTIVENSVTLYQSPLVKAGVPVLFMLVAAVDQYHRDPVSGDTSDDS
FT                   LIDVPTRKAIAKLLQAGTDDAHEKAVELAATQLRPTVDKLRDNFPSCKISLLLPGPFQA
FT                   LLVDVAIALDLDGIRVGLEDALNVFDARVPGGVRKACGTGDQVRWLRLELERRGIGIVD
FT                   AEALRDELGMSRPDVALFRQAEAALAHYPADERLVSADTILDALRPIVDTYRKVEDRLA
FT                   THLASAEALPADPAALAEHVLTAARSFGVTIRSFVEELDRYEDHEYLVARYIQVPQALN
FT                   FARELLVPRGYSIDAYDRALEDYARPGKTVTREHASYSVRVDQFKPLPLRCLEYLVGIP
FT                   CRYNGDYSNVVNLGLRQSPRYSATMALLYHALRELTLELRERSNASRKTCGPVWTVLET
FT                   SANASEPPVRRDIAPDALTAAIDGVDWVVLPSTPTTNYPLGLKLANGMAQLFHGFVAQI
FT                   AADPTLRPSRQTHRDTPLRLLAITHSGRRDDGETVIEASMLHNRFALNVDPSGIYFSEE
FT                   SQLIYERLILPRLVDKPAKLAYNERQLVRRDTAGFPLYQDGSRARRIKAEQIERLPFLK
FT                   CFAHSSGIATAQQLDVQACRDGERLGLTADELRAFFDRALLVSFGSAADIHLDWLGTSV
FT                   VDVTAFNDVRSLAGTTSRHYLIQPGEHADVLQHCLVHTQPADYRYDHATPVWQEGRQGK
FT                   VVARLTGVFLLDDHARLDDGHSIRRYLAASPLWLRQWIARFHDAPADAGAHAILRELQA
FT                   SMTDYRSSANQTTRRALA"
FT   gene            complement(163602..165299)
FT                   /gene="betA"
FT                   /locus_tag="BMA10229_0179"
FT   CDS_pept        complement(163602..165299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="BMA10229_0179"
FT                   /product="choline dehydrogenase"
FT                   /EC_number="1.1.99.1"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199; match to protein
FT                   family HMM TIGR01810"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00224"
FT                   /db_xref="GOA:A2RWD5"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWD5"
FT                   /protein_id="ABN00224.1"
FT                   /translation="MTTREFDYIICGAGSAGNVLATRLTEDPGVTVLLLEAGGPDYRFD
FT                   FRTQMPAALAYPLQGRRYNWAYETDPEPHMNHRRMECGRGKGLGGSSLINGMCYIRGNA
FT                   LDYDNWATHKGLEDWAYLDCLPYFRKAETRDVGPNDYHGGDGPVSVTTSKPGVNPLFEA
FT                   MVEAGVQAGYPRTDDLNGYQQEGFGPMDRTVTPRGRRASTARGYLDQARARPNLEIVTH
FT                   ALADRILFSGKRATGVTFLHGSARVTAHARREVLVCSGAIASPQLLQRSGVGPGEWLRE
FT                   LDIPVVLDLPGVGRNLQDHLEMYIQFECKEPVSLYPALKWWNQPKIGLEWMLNGTGLGA
FT                   SNHFEAGGFIRTRDDDPWPNIQYHFLPVAINYNGSNAIEMHGFQAHVGSMRSPSCGRVK
FT                   LKSRDPHAHPSILFNYMAEALDWREFRDAIRATREIMRQPALDRFRGRELNPGADLKSD
FT                   NELDTFVRARAETAFHPSCSCKMGYDDMAVVDNEGRVHGIDGLRVVDASIMPIITTGNL
FT                   NAPTIMIAEKIADRIRKHKPLERSNAQYYVANGAPARGGKPARAPAVV"
FT   gene            complement(165319..166788)
FT                   /gene="betB"
FT                   /locus_tag="BMA10229_0180"
FT   CDS_pept        complement(165319..166788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="BMA10229_0180"
FT                   /product="betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01804"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00451"
FT                   /db_xref="GOA:A2RWD6"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2RWD6"
FT                   /protein_id="ABN00451.1"
FT                   /translation="MSVYGLQRLYIAGAHADATSGKTFDTFDPATGELLARVQQASADD
FT                   VDRAVASAREGQREWAAMTAMQRSRILRRAVELLRERNDALAELEMRDTGKPIAETRAV
FT                   DIVTGADVIEYYAGLATAIEGLQVPLRPESFVYTRREPLGVCAGIGAWNYPIQIACWKS
FT                   APALAAGNAMIFKPSEVTPLSALKLAEIYTEAGVPAGVFNVVQGDGSVGALLSAHPGIA
FT                   KVSFTGGVETGKKVMSLAGASSLKEVTMELGGKSPLIVFDDADLDRAADIAVTANFFSA
FT                   GQVCTNGTRVFVQQAVKDAFVERVLARVARIRAGKPSDPDTNFGPLASAAQLDKVLGYI
FT                   DSGKAEGAKLLAGGARLVNDHFASGQYVAPTVFGDCRDDMRIVREEIFGPVMSILSFET
FT                   EDEAIARANATDYGLAAGVVTENLSRAHRAIHRLEAGICWINTWGESPAEMPVGGYKQS
FT                   GVGRENGITTLEHYTRIKSVQVELGRYQPVF"
FT   gene            complement(166831..167418)
FT                   /gene="betI"
FT                   /locus_tag="BMA10229_0181"
FT   CDS_pept        complement(166831..167418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="BMA10229_0181"
FT                   /product="regulatory protein betI"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM TIGR03384"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99819"
FT                   /db_xref="GOA:A2RWD7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2RWD7"
FT                   /protein_id="ABM99819.1"
FT                   /translation="MPKLGMREIRRAQLIDATLRSIDEAGLPGTTLASVAQRANISTGI
FT                   VSHYFGDKDGLLEATMRHVLRDLWAATTRRRAAASDAPRARLRAVVAANFDDTQISAPV
FT                   MKTWLAFWSQSMHEPTLRRLQRVNTRRLHSNLCAEFAKTLPRARAREAASGLAALIDGL
FT                   WLRGALAGEPLDTKAALKLANDYIDQLLAPRV"
FT   gene            167776..168039
FT                   /locus_tag="BMA10229_0182"
FT   CDS_pept        167776..168039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0182"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99471"
FT                   /db_xref="GOA:A2RVY0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVY0"
FT                   /protein_id="ABM99471.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKDLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            168063..168896
FT                   /locus_tag="BMA10229_0183"
FT   CDS_pept        168063..168896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0183"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98891"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABM98891.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            169063..169962
FT                   /gene="rhlA-2"
FT                   /locus_tag="BMA10229_0184"
FT   CDS_pept        169063..169962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlA-2"
FT                   /locus_tag="BMA10229_0184"
FT                   /product="rhamnosyltransferase I, subunit A"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00178"
FT                   /db_xref="GOA:A2RWE0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWE0"
FT                   /protein_id="ABN00178.1"
FT                   /translation="MPIEKQVVALPSGLKVHVERHVFDPAFETVILVNGALATTASFGQ
FT                   TIRYLGERVNAVCFDLPYAGQSRQHNPGEYILTKDDEVEILLHLAERFEPSLLLSVSWG
FT                   GVASLFALARGCASVRRAVIASFSPFLNDAMTDYVTRARDHIAAGENLKAAQLLNDTVG
FT                   RYLPRIMKLYNYRYLTKLPRNEQDQVAFHVDQILAMQPEQYLPEFRQIGCAVKFINGEL
FT                   DEYTAASDVRRLAAYVRRAEFATIRQAGHFLDLEGRQQQEQVRAAVLGFFADERASAAR
FT                   DAAQDETLAPLGQLPALS"
FT   gene            170184..171503
FT                   /gene="rhlB-2"
FT                   /locus_tag="BMA10229_0185"
FT   CDS_pept        170184..171503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB-2"
FT                   /locus_tag="BMA10229_0185"
FT                   /product="rhamnosyltransferase I, subunit B"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00201;
FT                   match to protein family HMM PF03033"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00133"
FT                   /db_xref="GOA:A2RWE1"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWE1"
FT                   /protein_id="ABN00133.1"
FT                   /translation="MAKVIVTAIGSAGDVHPLLGVSRALAARGHDVVFCTHAPFEAAVR
FT                   ASGFAFVPVGTAEAYAQAMADPALWDPRTSFRTLWRVIAPVLRPHFDTLRALSDADTVL
FT                   VGTLWAFSARLMQERFGARYVSVQVSPSTLLSAHAPPTHKRLTIPKGLPLAVKAGLMTL
FT                   IERQVLDRVRGPELNAARRALGLAPARRILGRWLHSTDGVLCLFPSWFAPAQPDWPANH
FT                   LQSGFALFNDVGPVPADAELDAFVASGEAPVVFTAGSTLVDGRAYERAVTQVLRATGVR
FT                   GILLAPDAPAASDGTTGPRERAAETTARANGAALLKRRYVPLAALLPRCRALVHHGGIG
FT                   TASLAYAAGVPQVVTPFAHDQFDNAQRVAASGCGVRLDAPVRGEPLARALARVLGDAAM
FT                   AARCAEVRARMAAQPDGCDEAARFIERFAPGVAARQAQPA"
FT   gene            171500..173086
FT                   /locus_tag="BMA10229_0186"
FT   CDS_pept        171500..173086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0186"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99821"
FT                   /db_xref="GOA:A2RWE2"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWE2"
FT                   /protein_id="ABM99821.1"
FT                   /translation="MSAPARPAAAAANGAGAHEPAAARPLRGAKLALLTFALSLATFIE
FT                   VLDSTVANVAVPAISGSLGVSNSQGTWVISSYSVAAAIAVPLTGWLARRVGEQRLFVAS
FT                   VILFTLTSLLCGLARDLEVLVACRALQGLFSGPMVPLSQTILMRAFPPAKRTFALALWG
FT                   MTVLLAPIFGPVVGGWLIDNFSWPWIFLINLPIGLFSFAVCTLMLRPRASRGEASPIDV
FT                   PGIVLLVIGVGSLQAMLDLGHDRGWFDSSLITALAIAAGVSLVSLLIWELGEAHPVVEL
FT                   SLFRERTFTFCVVIISLGMMSFSVVGVVFPLWLQAVMGYTAYQAGLATASMGLLALVFS
FT                   ILVGVYASRVDARVLVTFGFGVFAAVMGWSTHFTLSMTFAQVVTPRLIQGMGLPCFFIP
FT                   LTAATLSRVADDKLAAASSLSNFLRTLSAAFGTALSVTWWDNRATYHYAVVSQAVTRAS
FT                   ENTQRYVDALHAMGLHGARELSSLHQVVRQQAYMMATNDMFYMASVTCVLLAGLMWLTR
FT                   PKRGAAATMGH"
FT   gene            173038..173154
FT                   /locus_tag="BMA10229_0187"
FT   CDS_pept        173038..173154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0187"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99214"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWE3"
FT                   /protein_id="ABM99214.1"
FT                   /translation="MADAAEAGRGGDDGALTGDVAVRGARMPGDARRPPLSG"
FT   gene            173177..173326
FT                   /locus_tag="BMA10229_0188"
FT   CDS_pept        173177..173326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0188"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99096"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWE4"
FT                   /protein_id="ABM99096.1"
FT                   /translation="MRDVRAKTKPKTKTKPKPKPKTKTKTKTKTKTKTKPKPKPKPNGE
FT                   ASKS"
FT   gene            173393..174388
FT                   /locus_tag="BMA10229_0189"
FT   CDS_pept        173393..174388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0189"
FT                   /product="putative dtdp-rhamnosyl transferase rfbf protein"
FT                   /note="identified by match to protein family HMM TIGR01556"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98545"
FT                   /db_xref="GOA:A2RWE5"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWE5"
FT                   /protein_id="ABM98545.1"
FT                   /translation="MTTLGALVILYYPTDEQLSGLEALARDSDALAVIDNTPHEHAAAR
FT                   ERVRALAARAHGEARVVWRHHGNRGGVAGAYNAGLSALFAQGMEAVALFDQDSTVPAAY
FT                   FARMRDACAQLGTQPGAHAGAFIAGPRIYDANEQRFLPELMTSGVAVRRVRVEGERAPQ
FT                   RCAFLISSGSVISRGAYARLGRFDEALFIDHVDTEYCLHALAHNVPLYVVPSLVLTHRI
FT                   GARRRHKVGPFELTAMHHGWLRRYYGARNAMQLGLQYGLRFPVALVPNLLTIWQVVQVV
FT                   LCEREKGAKLRGIALGVLDGVFGRLGSFEAARAGHRTAREEAMREARQQS"
FT   gene            174514..174696
FT                   /locus_tag="BMA10229_0190"
FT   CDS_pept        174514..174696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0190"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00314"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWE6"
FT                   /protein_id="ABN00314.1"
FT                   /translation="MMTVKRKTTQTTPTAQRLAPVSAASRGGRAIPLTVTGEAVRHRRR
FT                   RPQRNRARTKDASHA"
FT   gene            174693..176276
FT                   /pseudo
FT                   /locus_tag="BMA10229_0191"
FT                   /note="putative outer membrane protein; this gene contains
FT                   a frame shift which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT   gene            176757..178010
FT                   /locus_tag="BMA10229_0192"
FT   CDS_pept        176757..178010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0192"
FT                   /product="multidrug resistance protein A"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99325"
FT                   /db_xref="GOA:A2RWE8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWE8"
FT                   /protein_id="ABM99325.1"
FT                   /translation="MNDTATDTARAKAPTDPAVSDGAPASGHGLPASPETAATLAARRA
FT                   TRRRRFAWFFGVLAIVALGAALYWFIVGRFSEETDDAYVAGNVVQIAAQIQGTVTDVLV
FT                   ADTQQVKAGQALVRLDDAEAAAAFAQAQAQLAQAVRQVANTRLSMQTYEQTVKAREADL
FT                   KLAQQAYRARAGASVEVVAPEELARAKSSLANAQAALAGAQAQREAARALGSERPVGQN
FT                   PAVQQAAAQFKLAYRNLKRTTIVSPVDGTVGQRSVQIGQQVGPGVPLMSVVQLRQVWVE
FT                   ANFKEGQLRHMRVGQPVRLESDLYGARVTYHGRVEGFSAGTGSAFSMLPSQNAAGNWIK
FT                   VVQRLPVVISLEPSELAAHPLRVGLSMRATVQTKARGGHLLDGDAPLPAQRTRVHEMHA
FT                   GEAEAAAEAVIRANDGGQ"
FT   gene            complement(178630..180948)
FT                   /locus_tag="BMA10229_0193"
FT   CDS_pept        complement(178630..180948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0193"
FT                   /product="prolyl oligopeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00326"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98746"
FT                   /db_xref="GOA:A2RWE9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWE9"
FT                   /protein_id="ABM98746.1"
FT                   /translation="MRAIVGIAHEYGRSGKRHGVGTGFGQPRHDEGTLATRAPRMPAAD
FT                   ASQSTSRQPSASAARLTLPLHAMPLAKNAMPHASWPEQADPHQFLEELDSAASVGWVDA
FT                   QNARTHDAPWLDEAHYRALVERFTQALLPRERPVIPQRWQDWAYDVWQDEQHPKGLWRR
FT                   TRWTSWRSGHADWQTLIDLDALGEAQGVQWVFDDQLILEPDGDRALIVLSDGGADAVVV
FT                   REFDIAQCRFVDDGFSIEAAGKHSVEWIDRDTIYVGWDDGGATVTRSGYPREVRRWTRG
FT                   TPLSSAPVVFRGARGDISVDAQYDPLDRHHAIEQAINFYDANTYRLAEDGAWARYDVPP
FT                   HVEVGYWSGWLLLQPRLDWTCGGARYAGGSLLAIREDAFVAGERAFAALFEPNERTSAC
FT                   GWTHTRRYVLVSWLDDVLTRTMLWLPERQDDGAWRWHARPFPARGLAQVDVSPVEPTFD
FT                   DEVYVSVDDYLKPPEYSLANLASDDLSAWTLLDRWPTQFDASELTVRREHARSRDGTLV
FT                   PYTLVGPRDVLDNAARAPRPCLLNGYGGFAIALTPDYDPLLGIGWLEKGGIAVFAHIRG
FT                   GGEFGTQWHESARQTQRQRSFDDFIAVAEKLVADGVTSAAQLGIRGGSNGGLLVAACMI
FT                   QRPDLFGAVVSDVPLLDMQRYALLHAGASWLDEFGDPDDPAHASALAAYSPYHRVARDI
FT                   AYPPALFTTSTSDDRVHPAHARKMVARMQAQGHRNVWLIEKTDGGHGSADAIDTAEHEA
FT                   IGYVFLWTHLSRGAHDARE"
FT   gene            complement(180957..181097)
FT                   /locus_tag="BMA10229_0194"
FT   CDS_pept        complement(180957..181097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0194"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00608"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWF0"
FT                   /protein_id="ABN00608.1"
FT                   /translation="MKSPYRYRASGARHGPGWTANAVYSHREFTMKEPPQKPNQLFFIS
FT                   K"
FT   gene            181096..181563
FT                   /locus_tag="BMA10229_0195"
FT   CDS_pept        181096..181563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0195"
FT                   /product="rhodanese-like domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00185"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWF1"
FT                   /protein_id="ABN00185.1"
FT                   /translation="MTIELEARATHAVLDAAREAALAAGLPYAGGVSPRDAWALVATGH
FT                   ARLVDVRTAEERTFVGHVPDSLHVPWATGTSLTRNPRFVRELEAKTGKDAVVLLLCRSG
FT                   NRSALAAQAAAKAGFTQVFNVLEGFEGDLDDAGHRGTTNGWRLHGLPWRQS"
FT   gene            181678..182667
FT                   /locus_tag="BMA10229_0196"
FT   CDS_pept        181678..182667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0196"
FT                   /product="putative serine O-acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99394"
FT                   /db_xref="GOA:A2RWF2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWF2"
FT                   /protein_id="ABM99394.1"
FT                   /translation="MAVFDIDDIVQSLQTVRQRWREVQRRSFEPGGRELPAREALAGIV
FT                   ETFKGVLFPMRLGPPDLRQESENFYVSHALDDALHALLAQARLELRYKGRHDADAPAEA
FT                   AIDAKADAAVRAFAARLPDIRALLDSDVLAAFHGDPAAGSVDEVLLCYPGVLAMIHHRL
FT                   AHALYRLELPLLARIVAEHAHAQTGIDIHPGAQIGGGFFIDHGTGVVIGETAVIGERVR
FT                   VYQAVTLGAKRFPRDASGHLEKGLARHPIVEDDVVVYAGATILGRVTIGKGAVIGGNVW
FT                   ITQDIPPGSHVTQAVTRSDPARPADAAASSPWPAGAHDATLSAAQALR"
FT   gene            182664..182948
FT                   /locus_tag="BMA10229_0197"
FT   CDS_pept        182664..182948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0197"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99201"
FT                   /db_xref="GOA:A2RWF3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWF3"
FT                   /protein_id="ABM99201.1"
FT                   /translation="MTALVQRFGAAIRQLREARAWSQEQLAEHAGLNRSYVGEIERGTA
FT                   IASIVTVDKLARAFGVPIARLLSPAGDAGPPPHGFGAPPASSAPLSSTR"
FT   gene            183069..184001
FT                   /locus_tag="BMA10229_0198"
FT   CDS_pept        183069..184001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0198"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99239"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWF4"
FT                   /protein_id="ABM99239.1"
FT                   /translation="MSTTVSAQTALGDNAARQLANATKTVPQLCTITPRWLTHLLQWVP
FT                   VEAGIYRLNQVKNPEAVRAACTAREDEGALPRTFVPYEEEPREYFLSAVSTVLDVHTRI
FT                   SDLYSSPHDQIKEQLRLTIETIKELQESQLINHPDYGLLANVAEAQRVFPLTGAPTPDD
FT                   LDELLTKVWKEPAFFLTHPLAIAAFGRECTRRGVPPPTVSLFGSQFLTWRGIPLIPSDK
FT                   VPVADGKTKILLLRVGDKRQGVVGLYQPGIAGEQGPGLSVRFMGINNQAIASYLISLYC
FT                   SLAVHSPDALAVLDDVEIGKYHDYPDTYR"
FT   gene            184009..185991
FT                   /locus_tag="BMA10229_0199"
FT   CDS_pept        184009..185991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0199"
FT                   /product="putative cysteine desulfurase"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01212; match to protein
FT                   family HMM TIGR01979"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99559"
FT                   /db_xref="GOA:A2RWF5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWF5"
FT                   /protein_id="ABM99559.1"
FT                   /translation="MSAAPVALPDAAPPAGLPDPATLARLASEFLAALPGQPAAPNAGA
FT                   GSGAVGGVPSALPAAAPMLASVSNPAPPGSPLAGPGGTGTGVPGIGVPPGKVPGANLVP
FT                   APTHVLSLGNRTPALVGHAAAQNGWPDSAVAIAPALEPRAGGVALGVPPVPEPDAVRRA
FT                   GDASAAAAPSPWSYYFVEPASDDWWRDAARTPIDVPRDGVASPRAFGLPDENAWRDLLS
FT                   IGRPAADRHRASRYFVDDAQPTNAHAPGAGAHPPFDVAAIRRDFPILAERVNGKPLVWF
FT                   DNAATTHKPQAVIDRLAHFYAHENSNIHRAAHALAARATDAYEHARATVQRFIGAASPD
FT                   EIVFVRGATEAINLIAKTWGVGNVGEGDEIVVSHLEHHANIVPWQQLAASVGAVLRVIP
FT                   VDDAGQVLLGEYRKLLNDRTKIVSVTQVSNALGTVVPVKEIVELAHRAGAKVLVDGAQS
FT                   ISHMRVDVRALDADFFVFSGHKIYGPTGIGVVYGKRALLDGMPPWQGGGNMIADVTFER
FT                   TVFQPPPNRFEAGTGNIADAVGLGAALDYVARIGIERIARYEHDLLAYAAGVLAPVPGV
FT                   RLIGTARDKASVLSFVLKGYETEEVGRALNAAGIAVRSGHHCAQPILRRFGLEATVRAS
FT                   LAFYNTRDEVDAMVDVVRELAARRI"
FT   gene            complement(186274..186807)
FT                   /locus_tag="BMA10229_0200"
FT   CDS_pept        complement(186274..186807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0200"
FT                   /product="cytochrome b561 family protein"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98728"
FT                   /db_xref="GOA:A2RWF6"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWF6"
FT                   /protein_id="ABM98728.1"
FT                   /translation="MTPSTRTPDRYDLLSRILHWSVAALVLAQFALGWTMPDVHGTAPP
FT                   VGLVAWHVALGTALIVVIAARLLWPIVRRSPPAHQQGALLSFAASATHKLLYVALIAVP
FT                   LLGWLNANGRTWQLKLAGAIPLPTIAAPHSLGAAIGEWHSLSATLFIVLIGMHALAALV
FT                   HRFVMKDGAFERMI"
FT   gene            complement(187000..187152)
FT                   /locus_tag="BMA10229_0201"
FT   CDS_pept        complement(187000..187152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0201"
FT                   /product="putative liporotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98611"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWF7"
FT                   /protein_id="ABM98611.1"
FT                   /translation="MNRIDMKRILILLLCLGVLGVASGCAAPQTALDSSVDTRRPARAG
FT                   RPNWL"
FT   gene            187321..187668
FT                   /locus_tag="BMA10229_0202"
FT   CDS_pept        187321..187668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0202"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99995"
FT                   /db_xref="GOA:A2RWF8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWF8"
FT                   /protein_id="ABM99995.1"
FT                   /translation="MSAACSPIDLSGMRASADAACALLKVLSNPDRLLMMCELAQCGEL
FT                   CVSDIEARLDIHQPTLSQQLGVLREHALVDTRRDGKNIYYALTSEPAVAIMAVLYEQFC
FT                   ATHQKGKRRGR"
FT   gene            187658..188092
FT                   /locus_tag="BMA10229_0203"
FT   CDS_pept        187658..188092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0203"
FT                   /product="YeeE/YedE family protein"
FT                   /note="identified by match to protein family HMM PF04143"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00595"
FT                   /db_xref="GOA:A2RWF9"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWF9"
FT                   /protein_id="ABN00595.1"
FT                   /translation="MAVDFVHFTPGLSFAGGLLIGAAAALLVFFDGRIAGISGIVGGLL
FT                   AGGRSDAGWRAAFLVGLIAAAVAANALDWFSMPAVDAGWARVIAGGVLVGIGTRYAGGC
FT                   TSGHGVCGISRGAPRSIVATAVFMAAGIATVFVLRHVVGG"
FT   gene            188094..188516
FT                   /locus_tag="BMA10229_0204"
FT   CDS_pept        188094..188516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0204"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04143"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98482"
FT                   /db_xref="GOA:A2RWG0"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWG0"
FT                   /protein_id="ABM98482.1"
FT                   /translation="MSLLFAFLSGLLFGAGLLLSGMANPAKVQGFLDLAGNWDPSLAFV
FT                   MAGAIAVGSIAFAFAKRRERSLLGLPMQIPPRGAVTPRLVAGSAAFGVGWGLVGFCPGP
FT                   AVVSLGLGGAKAFGFVAAMLIGMAAFECGERFRAKR"
FT   gene            188557..189120
FT                   /locus_tag="BMA10229_0205"
FT   CDS_pept        188557..189120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0205"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98603"
FT                   /db_xref="GOA:A2RWG1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWG1"
FT                   /protein_id="ABM98603.1"
FT                   /translation="MPAEYVRSGFSVSDAVDTMISIRLLEPADAAAFSALRLVAIDTSP
FT                   SAIWPTRAEEAGRSIREVEARLRASGTQAVFGALTDDGGLIGIAGVRREALVQLAHKAV
FT                   LWGVFVAPAYRGNGLARRLIDAALTHASRDWGVEQVNLCVNTENEPAKALYASLGFETF
FT                   GVERRAMRVGDRFYDEQHMVRVRR"
FT   gene            189235..189417
FT                   /locus_tag="BMA10229_0206"
FT   CDS_pept        189235..189417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0206"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00461"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWG2"
FT                   /protein_id="ABN00461.1"
FT                   /translation="MRADMRVPLMRMGPNAGRLNRRDSARSTIVYRLPPGGVCRQAARA
FT                   ARHLRFFRAGGLLIA"
FT   gene            complement(190018..190290)
FT                   /locus_tag="BMA10229_0207"
FT   CDS_pept        complement(190018..190290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99843"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWG3"
FT                   /protein_id="ABM99843.1"
FT                   /translation="MEHLVRIVNDTDRQILAWLRSQVGDERVERAAQHMGRVRKPYLSA
FT                   VCRYLGVWPPISLRYPPRHGAVDHAVGDRYLTLIRQHLAAHTAGR"
FT   gene            190541..190696
FT                   /locus_tag="BMA10229_0208"
FT   CDS_pept        190541..190696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0208"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99416"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWG4"
FT                   /protein_id="ABM99416.1"
FT                   /translation="MQDAQRPTGDFTSVGICLSRDRAPNADASRRRRKFERFLECGGRV
FT                   FGASQP"
FT   gene            complement(190979..191839)
FT                   /locus_tag="BMA10229_0209"
FT   CDS_pept        complement(190979..191839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02409;
FT                   match to protein family HMM TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98846"
FT                   /db_xref="GOA:A2RWG5"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWG5"
FT                   /protein_id="ABM98846.1"
FT                   /translation="MSNQSIGAPDSTAVRVALWRALHARIDAPPHVLDDEIGLALAAPD
FT                   DDWRSRPDMDPQASRGYRASIVGRARFVEDLVDEQADRGVAQYVVLGAGLDTFAQRRAK
FT                   LASHLRVFEIDQPGTQAWKRQRLIALGYGVPQWLRLVPVDFETSGAWRAQLSAAGFDDS
FT                   RPAVVSSTGVSMYLTREAIAGTLSQIATLAPGSTLAMTFLLPLELIDDPAERAQHAAVY
FT                   ERARAAGTPFVSFFSPSDMLALAREAGFREARHVSTDDLVRRYFESRPDGLRPASGEAF
FT                   LVAST"
FT   gene            complement(192018..193640)
FT                   /locus_tag="BMA10229_0210"
FT   CDS_pept        complement(192018..193640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0210"
FT                   /product="di-heme cytochrome c peroxidase family protein"
FT                   /note="identified by match to protein family HMM PF03150"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98989"
FT                   /db_xref="GOA:A2RWG6"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWG6"
FT                   /protein_id="ABM98989.1"
FT                   /translation="MTGGKRSGAARRAGAAFAARGPALAGAPGARNARRIVSTLAIAAV
FT                   TRAAGGALAACASAIAFASGAAAPGALDAVRAAYPASSLSPARTPGAGGAAHVKPVQEA
FT                   LRAKAASPSPSLLPSPPSPTTSLLPGAPPQRVVATIGRGTPQVASKVDPTAAAFHPDPA
FT                   LAALGKRVFFDPALSEPRGTSCASCHDPGRAFAPTLSRAALAGPRVPQGSRPGHFSRRN
FT                   APSLLYVRYVPRRHFYQDDDALAPAPFGGLFSDGRADTLAEQLRGPLFDPDEMNNASPA
FT                   ALTRKIGGTALGATLAERFGPSVRRDPERMVRALGEAMQAYLQSDEMAPFSSRYDAYVM
FT                   QRAPLTPQEKRGLALFRNPDKGNCMSCHTLSDTASRPERSLFTDFGYDAIAVPRNRALR
FT                   ANRDPRHFDNGLCDTAAKLRWPEPAQWCGYLRTPGLRNVAIKESFMHNGVFDTLRDAVA
FT                   FYNTRSTDPKRWYHGRDTFDDVPAAYRGNINVNSTPMNRRAGTPPAMTDADVDDIVAFL
FT                   RTLTDARYVGLMPAAPDGKAARP"
FT   gene            complement(193637..195349)
FT                   /locus_tag="BMA10229_0211"
FT   CDS_pept        complement(193637..195349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0211"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98655"
FT                   /db_xref="GOA:A2RWG7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWG7"
FT                   /protein_id="ABM98655.1"
FT                   /translation="MTASGARASSASCALPRVARHPHAPERAARLPARPSPAHVARGIA
FT                   LVPAVAARRAMMSCRLHISYIGRAYFYGFPTGTTMPRPILRAAALSLTLAGAALFHACT
FT                   SSVDNQPDAASAPANIQAAWVEIGDANQAIARVITNYAPPPAAPGEPAPAVCPQLNADG
FT                   KIARMTLRVAAGTAAQRPTASDPADSKPSSFPVSVCETTLPANAKDVSVASRALPLPKA
FT                   EPQRVAIVANTGCRMKKADNAFQACSDATVWPFATIAASIAKLNPDLVLHVGDYHYREN
FT                   ACPPDIAGCRNSPWGYGWDAWRADLFEPAAPLFAKAPWVVVRGNHEECARAGQGWFRFL
FT                   DPRPYSDARSCNDAANDGNANYSEPYAVPLGTGSQVIVFDTAKVGRAALKTTDTQFQLY
FT                   QKQFQTVAALANKPGMSTTIFTNHHPILAFAPIPGSTPAPGNLALQSVMSSLYAQAYYP
FT                   PGVQVALHGHVHDFQAINFASGHPATIVSGNGGDNLDVALPDPFPANLTPAPGVVIDKL
FT                   SHNNSFGFLIMERRAAPARGWTFKAYTAAGKLLASCDQAGATLTCDKTGFVAP"
FT   gene            complement(195530..196420)
FT                   /locus_tag="BMA10229_0212"
FT   CDS_pept        complement(195530..196420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0212"
FT                   /product="hydrolase"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00462"
FT                   /db_xref="GOA:A2RWG8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWG8"
FT                   /protein_id="ABN00462.1"
FT                   /translation="MSEQEWNAFAPAAAAPHAACGITAIDAHAHVFETGLPLAGRRRYA
FT                   PDYDAPLDAYLAQLDAHRVSHGVLVQPSFLGSDCRYLLRALARQPRRLRGVAVIDAGCA
FT                   PAALDALDRAGVVGIRLNLIGMPDPALDGPAWRATLERVAALRWHVELHAQAQRLARLI
FT                   APLLAHRMNIVVDHFGRPEPARGIADAGFRDLLRAAATRRVWVKLSGAYRNWPFAPGEA
FT                   HARARAAFDALAAEFGAERLVWGSDWPHTQFERTETFGRALAFARRWIPDDAMRRAIFV
FT                   ETPARLFRFGEQRGA"
FT   gene            complement(196472..197896)
FT                   /locus_tag="BMA10229_0213"
FT   CDS_pept        complement(196472..197896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0213"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99853"
FT                   /db_xref="GOA:A2RWG9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWG9"
FT                   /protein_id="ABM99853.2"
FT                   /translation="MEQRAARMASSARQETTVFTWFAAVSPRERRTFWACFGGWALDAL
FT                   DMQMFSLVIPAIVAEWSLSRTQAGFVGGATLVASALGGWVAGMLSDRFGRVRTLQWTIA
FT                   CFSVGTFACAFATSYPQFVTLKTLQGLGFGGEWAAGAVLMAETIRAEHRGKAMGAVQSA
FT                   WALGWGSAVLLYALAFSLLPAELAWRAMFAIGLLPALLIVYVRRGIAEPSARALNPSGP
FT                   CDPPEPPNSPDGAPPSGASPAVRASAPLVGIFSRGTRRMTLIGALLGVGAHGGYYALMT
FT                   WLPTYLKTERHLSVLGTGGYLAVIIVAFFCGCLASAQLLDLIGRRGTILAFAACCVGTV
FT                   ILYLFAPLGNAAMLALGFALGFFAAGIPASMGALFNEMYPRGTRGTGVGFCYNFGRVAS
FT                   AGFPVLVGHMSAGMPLGTAIGIGAAVAYSIVVVAVLMLPETRGRTLDDCASADADAARA
FT                   GAGRIGAPAAPGARHR"
FT   gene            complement(197956..198681)
FT                   /locus_tag="BMA10229_0214"
FT   CDS_pept        complement(197956..198681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0214"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99634"
FT                   /db_xref="GOA:A2RWH0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWH0"
FT                   /protein_id="ABM99634.1"
FT                   /translation="MHATDDRLPRYQRLRDELAALIAARHWRPGEAIPTEQALAKRYDV
FT                   AIGTVRKAVDLLVADGMLERFQGRGTFVRRASFDSSLFRFFRFQGRHGERRIPESRILR
FT                   REVVEAPSAVAAALQIPARASVIEMTRVRLIDGAPMLAEEIWLPYDRFAAFARLELASI
FT                   GDLLYPVYEAHCNQIVASATETLTVEAIGPVHARLLRIEPGTPAVVIERLAYGYDRRPL
FT                   EWRRSRGPASEFIYQAEIR"
FT   gene            198849..201104
FT                   /locus_tag="BMA10229_0215"
FT   CDS_pept        198849..201104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0215"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99246"
FT                   /db_xref="GOA:A2RWH1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWH1"
FT                   /protein_id="ABM99246.1"
FT                   /translation="MDETSIRERAVMAKIARRLMPLLVIMFLIAFIDRQNVGFAKLQMV
FT                   HALGMTETSYGLGASLFFIGYLLFEVPSTLALHRFGARLWLARIMMTWGVITVLLGFTH
FT                   STGVFYVFRFLLGVAEAGFYPGVIYYLTLWFPQSHRTRVLGLFTLGSALANMLGSLAGG
FT                   LLLSLDGRLGLAGWQWVFVATGLPAIAVALVAWRYLPESVERATFLSDDEKRVALAALK
FT                   REASPEAVSESPWRALVDPRVLMFALAYMLMSTSLYGVTYWLPTLLKSNGVPSSLNGLL
FT                   NMIPWAIAALLLLWLPARLKRERIVLKAMAAVAGVGVAGFALSLALPGLPLRFAALVLG
FT                   GACIRLLYPCFWSLPPRFFSGARAAASIAAINSIGNLGGFFAQNLMPYVGKAAGSAGAP
FT                   MLVPVVCLAALGVGMLAAASMAGRRRPAWRPDERRLTRRRRLGRAGARVAASLSGRRCA
FT                   SARRPVRSARRVRGARFASGGARPLCHHRRRPPRVRRDAPLRTRSSPRFYAGGAHAGPT
FT                   CAASLPALLRRPIRERKRGAQRGMVRRPRPPRRPRRARRTPRAPGFPSPFSQQSCVRAS
FT                   GQVSPCRPPALRPLRPLRPLWPIRPREPVRARLAFHAARARHGPDAYRARRPPGVRGAC
FT                   RAARSRSPRRVRRSLRCRRARGLPRPRPSRRSAASARACVSSRRGPCRALSCPTASRRR
FT                   RRRRRPPRSAASSRRPPSGSAGTRTCPTCRRGRSRAARAPAPPRAGCRTRESRSTTR"
FT   gene            201241..201798
FT                   /locus_tag="BMA10229_0216"
FT   CDS_pept        201241..201798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0216"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99573"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWH2"
FT                   /protein_id="ABM99573.1"
FT                   /translation="MLAVLVVVGRAFRAGLGLARVAFRERALLLAGEVVVEDEFVAVRD
FT                   EQIRRRVLHADADHALRVLAQLRHERREVRIAADDDERVDVRLRVAEIERVDDEPDVRR
FT                   ILAGLAHVRDFDQLEARLVHRRLERLVAIPIAVRLLDDDAALEQQLLEHGLDVEFLELR
FT                   VAHAERDVFEVAKERHVDAVLG"
FT   gene            complement(202234..202743)
FT                   /locus_tag="BMA10229_0217"
FT   CDS_pept        complement(202234..202743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0217"
FT                   /product="putative leucine-responsive regulatory protein"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00448"
FT                   /db_xref="GOA:A2RWH3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWH3"
FT                   /protein_id="ABN00448.1"
FT                   /translation="MRATKKSSPKAAAPPAGVDIDRVDRAILRVLQRDASVSNVALAAK
FT                   VNLSPPACLRRVERLKEMGLIRGIVALLEPKALNAGMLVMIGVVLDRSTPDSFGAFEQA
FT                   AQKVSGCMECHVVTGEFDYIMLIRTRDSDTFNRLHAEQLLYLPGVRQIRTFVVLKEILS
FT                   TTSFPI"
FT   gene            202936..203952
FT                   /locus_tag="BMA10229_0218"
FT   CDS_pept        202936..203952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0218"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01274"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98755"
FT                   /db_xref="GOA:A2RWH4"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="InterPro:IPR020601"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2RWH4"
FT                   /protein_id="ABM98755.1"
FT                   /translation="MNLQKFSRYPLTFGPTPIQPLKRLSAHLGGKVELYAKRDDCNSGL
FT                   AFGGNKTRKLEYLIPDALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVN
FT                   YHDAVYDRVGNIQMSRMMGADVRLVPDGFDIGFRKSWEDALADVRARGGKPYAIPAGCS
FT                   DHPLGGLGFVGFAEEVRAQEAELGFQFDYVVVCSVTGSTQAGMVVGFAADGRADRVIGV
FT                   DASAKPAQTREQILRIAKHTADRVELGRDITSADVVLDERFGGPEYGLPNEGTLEAIRL
FT                   CAKLEGVLTDPVYEGKSMHGMIEKVRLGEFPAGSKVLYAHLGGVPALNAYSFLFRDG"
FT   gene            203986..205152
FT                   /locus_tag="BMA10229_0219"
FT   CDS_pept        203986..205152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0219"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99466"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWH5"
FT                   /protein_id="ABM99466.1"
FT                   /translation="MTPSNSSGPSARRGDVSMTYRRRIGGVRAAAVTPHGPRDSRFATR
FT                   VRAAALAGICAHYSRGFTATTESAMDISKIQHSAVALDASSDSSSGQQASGHTAARQTS
FT                   SRGAGAALGGLKELQDLKRGDLIMEHGNMHAVMYAGGDKPLVHSTNGKFFGVLQQGPNY
FT                   LTKKFGNETPTKLPVYRMKNADSPIPSEAARIGEQWAIRSGDTETTKTKTPFGENRLND
FT                   ADEDKAVEWSPEATFRAARAALRSDEGMPLSKQQGVSCSQFVTYAYQAAALKKGGDASG
FT                   GAHEALDSVKQAGAHRQGAFKTAENKVQQQAGLVQGAHEQATQAMPHTLQVNAKHMTAD
FT                   VLAERLRERGGDFERVGYAVPYEKDGESGVKLLPKDDPRATQKISNIE"
FT   gene            complement(205346..206644)
FT                   /locus_tag="BMA10229_0220"
FT   CDS_pept        complement(205346..206644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0220"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99958"
FT                   /db_xref="GOA:A2RWH6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWH6"
FT                   /protein_id="ABM99958.1"
FT                   /translation="MDARYPGDSNYRFAQILCFNAETYFRGASPCTRKYRARRSRFAVR
FT                   APQARASEPRAAVPDAHFASPRRFPLEWCPSAHGARAAATGAAARHGMKLASRGWRAPR
FT                   ARVPTTSKHPPACAAPSTRTERPHPPPAVSFHRNRGSTVAKLDHRNQSRYWHSPGISGV
FT                   DLLLADFTTHDYAPHVHDSLVVAVTEVGGSVFKSRGQTRLAEPNAVLVFNPCEPHSGRM
FT                   GGSSRWRYRSFYLAEAGLSRVLTLLGMAQPRFFTSNVLDDPQLVEQFLTLHRAMDEQDD
FT                   LLRQQELLVSSFGTLFSRHGLQAGLGAGPGFGTKAGLPALKPALDLMNDCFDHALTLEQ
FT                   IAAAAGLTSFQLITAFNRVIGLTPHAYLNQLRLRAALRELQAGRSLADAALTSGFYDQS
FT                   ALCNHFKRTFGMTPMQYTRALAPGKRPLAPIGI"
FT   gene            207065..208054
FT                   /locus_tag="BMA10229_0221"
FT   CDS_pept        207065..208054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0221"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98504"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWH7"
FT                   /protein_id="ABM98504.1"
FT                   /translation="MQNVDRPTGSSLAGAAILLEIGAAYGIVDFIRHSNGFDVAALAER
FT                   SGIGEPMIADYVDAMREAGLVTLAKAGERDIYRPADDFPDVVNDVGYLSWALLACAPLI
FT                   VNAREFAADNALAQARHPRDGGLVARTSKWMGELSFYPQPERAILKLRPKKIVDLGSGS
FT                   GGFLIRMLHQLDGARGVGVDLSATATEQAKQAAEANGFAGRLEFLHRPIQSLVDDPAPL
FT                   KGADVVHAGFVMHDLLPAEERTLDALLETCREHASSGTVVIVDAVPLAPDRWERSFAAA
FT                   FNHLHRNFMSRRLLSEDAWREKFEQAGFGNVAVETLGHPGGRMILGSA"
FT   gene            208113..208916
FT                   /locus_tag="BMA10229_0222"
FT   CDS_pept        208113..208916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98981"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWH8"
FT                   /protein_id="ABM98981.1"
FT                   /translation="MPITVDELVQKVKSHRCYSHPVFLNWAKVDPEPKVVGALFHQIQH
FT                   FCASTRPGWNFPRALAEHGLQKQSELMTEIVDSESGHGPELATMAGYIVNRAAGGAVIP
FT                   DLYDQAAVEGALKRYSDELLGSLPGYDDETGLTTQVRRAINVFERRKLVDVESTYRNLG
FT                   TALALEMISNRQLIPGEKHCLVDSGLYGASLEVPEMHYLLEHWGEVGAEQQHEENARAA
FT                   VKPALESEHAALVIEGAQEFLDALASVWDLLDASLLESGYVKKAA"
FT   gene            208977..209267
FT                   /locus_tag="BMA10229_0223"
FT   CDS_pept        208977..209267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07045"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98508"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWH9"
FT                   /protein_id="ABM98508.1"
FT                   /translation="MAAYLLGRMAISDPSKYARYKALTPDIIARYGGRFLTRGGEKLTL
FT                   EGPADEWRIVLVEFADAAARFYHSADYQHAKSLREGAADMQLMIVGGFERK"
FT   gene            209407..210900
FT                   /locus_tag="BMA10229_0224"
FT   CDS_pept        209407..210900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0224"
FT                   /product="putative glycolate oxidase, subunit GlcD"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99189"
FT                   /db_xref="GOA:A2RWI0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWI0"
FT                   /protein_id="ABM99189.1"
FT                   /translation="MREVTDDGQQWDGRAAAFAGVPPGGGAPAAFATPQTIGRCVEALR
FT                   AIVGERLAVGRAVREQHGKDISFHPGAPPDAVAFVRTTAEVAEITRACHRLRVPLIPFG
FT                   TGTSCEGHIAALRGGVCIDLSGMNRILRVSAEDLDCTVEAGVTRKQLNAHLRDTGLFFP
FT                   IDPGADASIGGMCSTRASGTNAVRYGTMRESVLALEVVLPNGDVVSVGSRARKSAAGYD
FT                   LARLFVGAEGTLGTITGVTLRLHPRPDRLSAAVCGFPDLKAAVDSVIGVIRSGVPIARV
FT                   ELLDALQIVACNRYAKLSLDERPTLFFEFAGFGAAVDEQIDWVGEICAGYGGGEFRWAS
FT                   RPEERSALWAARHDAWWAALALRPGCEGMPTDSCVPVSRLAEAVLAARADVDALGLVAT
FT                   ICGHVGDGNFHVCIAIDPADPDELARATELNRRLALRAIALGGTCTGEHGVGYGKIGYL
FT                   EREHPTALQLMAAVKRALDPRGIMNPGKVLHHDRYPPFD"
FT   gene            211488..212207
FT                   /locus_tag="BMA10229_0225"
FT   CDS_pept        211488..212207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0225"
FT                   /product="threonyl and alanyl tRNA synthetase domain
FT                   protein"
FT                   /note="identified by similarity to SP:O07438; match to
FT                   protein family HMM PF07973"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99687"
FT                   /db_xref="GOA:A2RWI1"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWI1"
FT                   /protein_id="ABM99687.1"
FT                   /translation="MNRLFCQDDADTLLLSGTVVDTRPGAVRLSRHPFYPGGGGQLPDL
FT                   GTVRWEGGVETVAGFSEDGGGLWIEFANGVEIVGDVQSSVDAAFRRAMRELHTDLHVLN
FT                   ALVYRDFDGALVTGVQMNADRTARIDFDLPDADNDRLRALEAEMNDVVRRDLPVRTRYV
FT                   PLADAQQASGLLRSRSVAPPPTADGLVRIVEIDGLDSQACGGTHLASTGGSSPVRILKI
FT                   ENKGRSNRRVRIGLEPR"
FT   gene            212204..213142
FT                   /locus_tag="BMA10229_0226"
FT   CDS_pept        212204..213142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0226"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00211"
FT                   /db_xref="GOA:A2RWI2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWI2"
FT                   /protein_id="ABN00211.1"
FT                   /translation="MTQRLLAAAWRRPVWLLWVPPAFWAGNVVLGRAFSTSFPPVSLAV
FT                   GRWLVALVALAPFVWRDVLRERRLLLRHWKLIWACGALGIAGYNALAYVALRTVPAASV
FT                   AFLNSTLPLMVPLAAAMLGVERITSRAIVGIVVSFGGVAWIVARGHWEDLVALRFDHGE
FT                   LIVILATANYAIYSVLLRRKPAAIGPLAFLAATMAAGLAVLAPFWALELAGGARIPFDP
FT                   KAIGAVLYIGVFASLIAFILWGHCVQVLGATVTGVSFHLVALFTAVLAALTLGEPVRSY
FT                   HLVGIALILFGFFVATRAAPGVRSAPNARSL"
FT   gene            213226..216129
FT                   /gene="ileS_2"
FT                   /locus_tag="BMA10229_0227"
FT   CDS_pept        213226..216129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS_2"
FT                   /locus_tag="BMA10229_0227"
FT                   /product="isoleucine--tRNA ligase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by similarity to SP:P00956; similarity to
FT                   SP:P41972; match to protein family HMM PF00133; match to
FT                   protein family HMM PF06827; match to protein family HMM
FT                   PF08264; match to protein family HMM PF09334; match to
FT                   protein family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99091"
FT                   /db_xref="GOA:A2RWI3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWI3"
FT                   /protein_id="ABM99091.1"
FT                   /translation="MSEYKETLNLLQTPFPMKGDLPRREPALVERWAAQRVYARMRAAA
FT                   AGRPPFVLHDGPPYANGDIHIGHAVNKVLKDIVLKSRFAAGYDAQWIPGWDCHGMPIEH
FT                   RIEQLHGRGLPPAAVQRLCREYAFEQTERQRRDFLRLGLLGDWPHAFRTMDFRTEANEL
FT                   RFLERIRARGLLYRGQKPVNWCVDCQSALAEAELEYARKTSVAIHAGLRVRDPVDFASR
FT                   FRRRPVLDKPAMLVVWTTTPWTIPGNAAAGVRADAPYGLYDTPGALIVVAQPLADALFA
FT                   SLGVDHALCALARGRELVGLALGQPFFAGRDVPVVEAEFVTLDAGTGIVHLAPAHGAED
FT                   AELCRRLGIAGENVVDGAGRFAADLPEIGGLPLADGIARIVAKLRADGTLVREAAFEHA
FT                   YPHCWRHKTPILFRSTPQWFIGMDIECEQGEADPGRAAVTEEAGATGEARKVGKAEEAE
FT                   EAGPAKTLRASARDAIADVPFYPPSARQRMEAMIDGRPDWCVSRQRTWGVPLPYFVRRD
FT                   DRSLHPRSARLVEAVAARVERDGIAAWSRLRPAELGVDENAYEKLSDTLDVWFDSGSIH
FT                   ATVYRDAARADTGGYPADLYLEGADQHRGWFGASLMTGCAADGRAPFRAILTHGFVVDG
FT                   AGRKMSKSLGNTVSPQRIADTRGADILRLWIASTDYAAEMSISDEILERVVETYRRMRN
FT                   TLRFLLQNVADFDPRDDAVPAGQLLDVDRYALARCREFVDACRSAYARYDFVAVTRLAH
FT                   GYCAEELGGFYLDALKDRLYASVADGVERRAAQTALHSVLANLLISIAPILSFTAEEAW
FT                   TVFAGDERDSVFLHTWDEHAPPPDDAALARWAHVRALRPHVTKALEEARGAALIGRSSE
FT                   AELVVRAPRDVLDALAPLHGELAAVFIVAGVTLETADQIAVAVARTPLARCERCWRHEP
FT                   SVAAHASGDALCARCRHALSRRARAERSEPRAAVGSR"
FT   gene            216762..217013
FT                   /pseudo
FT                   /locus_tag="BMA10229_0228"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(217067..217708)
FT                   /locus_tag="BMA10229_0229"
FT   CDS_pept        complement(217067..217708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0229"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00338"
FT                   /db_xref="GOA:A2RWI5"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWI5"
FT                   /protein_id="ABN00338.1"
FT                   /translation="MKLSPGLVAELTVNLLLPWAAYRAALPYWGKTGGLIASAVPPLVW
FT                   STVQLARFRRVDALSALVLFGIVLSIAAALAGGSARMLLMRESLASGAIGVAFLASLAL
FT                   RKPLVFHLARATLAREAHDGAARLDALWAERPAFVASMRLMTLVWGCGLVAENLLRAWM
FT                   VWNWPVERVLVVAPFVGYGVYGALMMWTLWYRKVMRANALAGLPPGGALG"
FT   gene            complement(218196..219587)
FT                   /locus_tag="BMA10229_0230"
FT   CDS_pept        complement(218196..219587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0230"
FT                   /product="phosphoesterase family protein"
FT                   /note="identified by match to protein family HMM PF04185"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99286"
FT                   /db_xref="GOA:A2RWI6"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWI6"
FT                   /protein_id="ABM99286.1"
FT                   /translation="MAKILENVEHIVVVMFENRSFDTMLGWLYSPDAPPAHVLPPQSSP
FT                   QFDGLRPEMSNPSKAGKTIAVTREALNSVIPDPQETFVNVTSQILGPSDAGNPWPPMQG
FT                   FVVNYETTQTTDPGHVMQCHSVAQLPTLTALARAYAVSDAWFASVPSQTWPNRAFAHAG
FT                   TSNGHVNNGAIPDPLEWDVPTIFDVLSSIGASWAVYSDTTVTPSLTHTMFPSLWKDAYA
FT                   ERFRRFPDFVAACGNDALPQYAFIEPSFLFEPNDQHPPHDVRAGDKFLHDIWTAIRTSP
FT                   GWPRTLLVVTYDEHGGCFDHVLPPANATPPDNASNPGDEAFGFYRFGVRVPAVVVSPYI
FT                   EAGTVFRSPTNVPYDHTSILATLRDWLDIPPDRMLGSARIANAPTLAQLVTRDTPRTDL
FT                   PTIAAPSTDFVHPPPDAPLNDVQKSLVTGTSRRDGHDPAAGVAPIATRQHALDFFKRRA
FT                   AAKTA"
FT   gene            complement(219735..220070)
FT                   /locus_tag="BMA10229_0231"
FT   CDS_pept        complement(219735..220070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0231"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98723"
FT                   /db_xref="GOA:A2RWI7"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWI7"
FT                   /protein_id="ABM98723.1"
FT                   /translation="MTVPATLAAAGTPPLAEWIGLGTLALLYLFGLGWAVRGAASRARG
FT                   RAYWIACAALIVGGTACALVAPPSPPDSGEMPPGFGLGVLVTLLGIAGTTAGCAWRAIA
FT                   RLRRGRP"
FT   gene            complement(220142..220261)
FT                   /locus_tag="BMA10229_0232"
FT   CDS_pept        complement(220142..220261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0232"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99382"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWI8"
FT                   /protein_id="ABM99382.1"
FT                   /translation="MDPHGFKTSILDSPRRFRRRCPAPGQGDARKLRARRAIR"
FT   gene            220265..221464
FT                   /locus_tag="BMA10229_0233"
FT   CDS_pept        220265..221464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0233"
FT                   /product="putative esterase"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00014"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWI9"
FT                   /protein_id="ABN00014.1"
FT                   /translation="MNSAFDAPASAAAAAFPPADDAALAARLDRVLGAALGERRIVGAV
FT                   ALAARHGRLVYRRAHGLAERETQRPMREDTLFRLSSITKPIVTVAVLRLVADGRMALDA
FT                   PITRWLPDFAPALPGGRAPALSVHQLLTHTAGLSYWLLEAPGSAYHTLGVSDGIDLVDF
FT                   DLAENLRRIAAAPLAFEPGSAWRYSLALDVLGAAIERETGRALPDAVARLVTTPLGMRD
FT                   TGFVAADPARFAVAYANAAPEPARITDNLDVPLPEGHGVAVRFAPSRVFDATAFASGGA
FT                   GMYGSADDVLRVLETIRTGGDGFLPAALVAAMRTDHTGPAAGTRGPGWGFGYGGAVLSD
FT                   PALAQSPQSAGTLQWGGVYGHSWFVDAARGLTVLLMTNTAYEGMSGPLTLEVRDAVYGV
FT                   "
FT   gene            complement(221930..224080)
FT                   /locus_tag="BMA10229_0234"
FT   CDS_pept        complement(221930..224080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0234"
FT                   /product="transporter, betaine/carnitine/choline
FT                   transporter (BCCT) family"
FT                   /note="identified by match to protein family HMM PF02028;
FT                   match to protein family HMM TIGR00842"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00592"
FT                   /db_xref="GOA:A2RWJ0"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWJ0"
FT                   /protein_id="ABN00592.1"
FT                   /translation="MLQFLHPRFARAAASALSVPLPRPRRPRRAPDASFSGDPPMPPSR
FT                   STPRTTLKPPVVVPSLAVIGALLAVCALRPNEAGALFGAAQQWIVERFDWFYVLAITTF
FT                   LIFLVLIAASRFGNIKLGPDDAEPEFSFVSWTAMLFAAGMGIGLMYFGVGEPIQHYLSP
FT                   PTAAGGTPAAAREAMLMSFFHWGLHAWATYGVMGLVLAYFGFRYNLPLTLRSGLYPVLR
FT                   EGVNGWIGHTVDAFALVGTVAGIAVTLGYGVLQLSAGLHTIAGWQTDTDTFRIGLVAVV
FT                   VALAGLSAASGLDKGVRRLSELNLMLAFALLAFVVVAGPTSFLLRAIGDNIGEYLSKLV
FT                   SLSFRTYAYEAPNDKGWFGGWTLLYWAWWVSWSPFVGMFIARISRGRTIRQFVIGVLLV
FT                   PTAFNLVWMTAFGNSAIWLDTHAAAGALAQTATNVDALLFRFFDYLPLTQLLSVAAIVL
FT                   IAVFFVTSADSGAFVIDAIATRGAPQSPVWQRLFWAAVLGVTASVLLVAGGLKALQALT
FT                   LVAALPVALVMLALCYGLWRGLKADHAHYSQDMAPATSFWTGQHWRHRLSQILRHTSDA
FT                   DARQFIAQTVEPALRKVADELKAGGVDAHVARDDDDAVRLTVPAPAQRDFVYGARVSRK
FT                   SAPAFRIREAAEPEPQREHVCEVLTFFADGRLGYDIEYLRGDEIIADVLRQYERYVSLA
FT                   ADTRTHLLNRAPEHAGPDGLSR"
FT   gene            224312..225256
FT                   /locus_tag="BMA10229_0235"
FT   CDS_pept        224312..225256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0235"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98980"
FT                   /db_xref="GOA:A2RWJ1"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWJ1"
FT                   /protein_id="ABM98980.1"
FT                   /translation="MPSSPATPLAAEPSIAVRIAAALPSLTPIHRRMGEYVLANPFRAA
FT                   TMRIDELANAVDASIATANRFARALGFDGYPALRAALVRGFEATLAPVERLRCAQEREA
FT                   GARGGELIDASFEQALANFERTRGRLDRANVEAAVDSLLAARRIFIVGMGASAFLAGLM
FT                   EHGLSVYRDNVQSLALLGGPTDAARRLFSARGDDLVVAIAFPRYVYDTIELTRRAAERA
FT                   APVLAITDGPDSPIAPFAARALFVHAERRLAATSEAAVLALVEALIDAVAHRSQRSARA
FT                   AAEVTEFMLPWLEARGACAAPPRPPRRSRKTDR"
FT   gene            225253..226299
FT                   /gene="iaaA"
FT                   /locus_tag="BMA10229_0236"
FT   CDS_pept        225253..226299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iaaA"
FT                   /locus_tag="BMA10229_0236"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="identified by match to protein family HMM PF01112"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99517"
FT                   /db_xref="GOA:A2RWJ2"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWJ2"
FT                   /protein_id="ABM99517.1"
FT                   /translation="MTSPAIVAIHGGAGTILREAMTADAEAQYRAELAAILAAAQKVLA
FT                   EGGSALDAVSVAVRMLEDCPLFNAGRGAVYTADGTHELDAAIMDGATLAAGAICCATRV
FT                   RNPVLAARRVLEASEHVMFAGAGADAFAAAQGLELAPPGYFDTEPRRAQWLKARRAAGT
FT                   MLDHDAAAFVFGRGGGDGGGNGGGNGGGPGARAACAPEPLDPDRKHGTVGAVARDLHGH
FT                   LAAATSTGGITNKQPGRVGDTPIIGAGCYANDATCAVSATGTGEMFIRLATAYDVSAQI
FT                   EYRGASLAGAAYDVVMNKLPSIAGRGGIIAVDARGNLAMPFNTEGMYRGYARVGEAPVT
FT                   AIYREDAA"
FT   gene            226340..228361
FT                   /locus_tag="BMA10229_0237"
FT   CDS_pept        226340..228361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0237"
FT                   /product="putative glutathione ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99614"
FT                   /db_xref="GOA:A2RWJ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWJ3"
FT                   /protein_id="ABM99614.1"
FT                   /translation="MSASRAAPSLPDARVLAVDGLTVTFRREDAAFVAVRDLSFHVDRG
FT                   ETLAIVGESGSGKSVTSLALMRLVEHGGGAIAGGAIALRRRGGAVLDLARATPSTLRTV
FT                   RGADVAMIFQEPMTSLNPVFTVGDQISEAIALHQHKSAGEARAETLRLLDLVRIPEARR
FT                   VFARHPHQLSGGMRQRVMIAMALSCRPALLIADEPTTALDVTIQAQILQLIRGLQDEMD
FT                   MGVIFITHDMGVVAEVADRVLVMYRGEKVEEGACDAIFAAPSHPYTKALLAAVPRLGSM
FT                   RGTDAPAKFPLLRFDPAAGDALVVAGGDATAASGDAARESVLFVDSDAAAASAASTAST
FT                   ASAASAASAAPTACARPAIDAGAPPLLRVRELVTRFPVKSGVFGRVSQYVHAVERVSFE
FT                   LRAGETLALVGESGCGKSTTGRSLLRLVERVSGSIEFEGREIGALKGRELQALRRNIQF
FT                   IFQDPFASLNPRLTVGFSIMEPLLVHGVASGRQAQARVDWLLERVGLPADAARRYPHEF
FT                   SGGQRQRIAIARALALNPKVVVADESVSALDVSVQAQIVNLMLDLQRELGVAYLFISHD
FT                   MAVVERISHRVAVMYLGQIVEIGPRRAVFETPRHPYTKKLMSAVPIADPACRHAPRTLP
FT                   ADELPSPIRALGDEPEVAPLVAVGPAHFVAEHRVGGAY"
FT   gene            228565..230127
FT                   /locus_tag="BMA10229_0238"
FT   CDS_pept        228565..230127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0238"
FT                   /product="putative glutathione ABC transporter, periplasmic
FT                   glutathione-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00320"
FT                   /db_xref="GOA:A2RWJ4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWJ4"
FT                   /protein_id="ABN00320.1"
FT                   /translation="MTQPHSFLPFSPRALLVACAGAIAMSSAPLALAERAAVMAVDSTF
FT                   TTLDPYDSNDTLSQAVSKSFYQGLFGFDKDMKLVNVLATGYEASPDAKVYTIRLRQGVK
FT                   FQDGTDFNAAAVKANFDRVTDPANKLKRYNLFRRIAKTEVVDPYTAKITLTEPFSAFIN
FT                   VLAHPSAVMISPAALKKYGREIGLHPVGTGPFELVEWKQTDDLKVKKFAGYWKAGYPKI
FT                   DAIDWKPVVDNNTRAALMKTGEADFAFRIPFEQTAELKASPKVDVIERASIIQRYVSLN
FT                   VMQKPFDNPKVRQALNYAVNKEALAKVAFAGNATPATGIVPQGVDYAVKLGPWPYDPAK
FT                   ARALLKEAGYPSGFETTLWSAYNNSTSQKAIQFVQQQLAQVGVKAQVQALEAGERVAKV
FT                   ESAQDPAKAPVRMYYIGWSASTGESDWAISPLLASSSIPPKLVNTAYYRNDAVDADLAK
FT                   ALETTDRAKKAELYADAQRRIWADAPWIALVQEKIVYARSKRLQGAYVMPDGSFNFDEI
FT                   AIK"
FT   gene            230124..230270
FT                   /locus_tag="BMA10229_0239"
FT   CDS_pept        230124..230270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0239"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99686"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWJ5"
FT                   /protein_id="ABM99686.1"
FT                   /translation="MSAMTGGGRGASPDRRDFARPGARGASRASDTGGARLLRAPHREA
FT                   SAC"
FT   gene            230264..231184
FT                   /locus_tag="BMA10229_0240"
FT   CDS_pept        230264..231184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0240"
FT                   /product="putative glutathione ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99363"
FT                   /db_xref="GOA:A2RWJ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWJ6"
FT                   /protein_id="ABM99363.1"
FT                   /translation="MLNFLVKRLFGLLPTLACVAVLVFLFVHLLPGDPARLAAGPEADD
FT                   ATVALVRADLGLDKPLPAQFASFFARIAHGDFGVSTRSKRPVATEIGERFMPTLTLTVV
FT                   SMAWATLFGMAIGIASAVWRNRWPDRIGMTLAVSGISFPAFALGMLLMEVFSVKLGWLP
FT                   VVPDGSWKSYVLPSVTLGAAVAAVMARFTRASFVEVLNKDFVRTARAKGVREPMVVLKH
FT                   CLRNAMIPVVTMMGLQFGFLLGGSIVVEAVFNWPGLGRLLVDAVTMRDYPVIQAIVLLF
FT                   SLEFILINLSVDVLYAVINPTIRFK"
FT   gene            231192..232100
FT                   /locus_tag="BMA10229_0241"
FT   CDS_pept        231192..232100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0241"
FT                   /product="putative dipeptide ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98767"
FT                   /db_xref="GOA:A2RWJ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWJ7"
FT                   /protein_id="ABM98767.1"
FT                   /translation="MNATVSSPPSAPASAGAPAAIRTPWSEFWRKFRKQRVALAAGAFV
FT                   LLLVAVAIVGPHVVPYDPENYFDYDALNAGPSAAHWFGVDSLGRDIFSRIVAGARISLA
FT                   AGFFSVALGAAIGTFFGLLAGYYEGWWDRATMRVADVLFAFPGILLAIGVVAILGNGMI
FT                   NVICAVAVFSVPAFARLVRGNTLALKQMTYVEAARSIGASDRTIIMRHILPGTVSSVVV
FT                   YFTMRIGTSIITAASLSFLGLGAQPPTPEWGAMLNEARADMVNAPHVALFPSVAIFLTV
FT                   LAFNLLGDGLRDALDPKLERR"
FT   gene            232100..233446
FT                   /gene="dmpA"
FT                   /locus_tag="BMA10229_0242"
FT   CDS_pept        232100..233446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmpA"
FT                   /locus_tag="BMA10229_0242"
FT                   /product="D-aminopeptidase DmpA"
FT                   /EC_number="3.4.11.19"
FT                   /note="identified by match to protein family HMM PF03576"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00599"
FT                   /db_xref="GOA:A2RWJ8"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWJ8"
FT                   /protein_id="ABN00599.1"
FT                   /translation="MRARTSGRADAAEALDAADAAPHVGALPAGPLRSIADVAGVTVGH
FT                   ATLDARGVQTGVSVVRPHAGDVYRDKVPAAAAVINGFGKSIGLVQVDELGVLETPLALT
FT                   NTFGVGALAQAQIRAAIDANPQIGRAWPSVNPLVFECNDGYLNDLHAFAVTPAHYAQAL
FT                   ADARRAFARGAVGAGRGMSCFDLKGGIGSASRVVRAAGEAWTVGALVLANFGRLPMLTI
FT                   AGVPVGRMIAERDAGGAPGAAGGQGADGARDDVAAAGARGERGERGDGPNGTYGTYGTY
FT                   GAHGRENAGTGGGAAGGLAPRRARDAGASSPGAAPDAAPPEQGSIIMLVATDAPLSSRQ
FT                   LKRVALRAAAGLARTGSVYGHGSGDIALAFSTAYTVPHDAERVSLPALVADAALDPLFA
FT                   AAADSVEQAIVDALWRATRVTGRDGHTRRALRDAAPELERWLRAARAGA"
FT   gene            233443..234273
FT                   /locus_tag="BMA10229_0243"
FT   CDS_pept        233443..234273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0243"
FT                   /product="putative dipeptide transport protein"
FT                   /note="identified by match to protein family HMM PF04951"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99864"
FT                   /db_xref="GOA:A2RWJ9"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWJ9"
FT                   /protein_id="ABM99864.1"
FT                   /translation="MMKVLISTDIEGVAGVVSVEQTRAGNPEYERARRWMTAEANAAVE
FT                   GAFAGGATRVWVNDSHGGFRNLLPDGIDARARVVLGKPRPLGMMAGLEAGPDLVFMIGY
FT                   HAKAQTRGLLAHTINSSAFARVVLDGRDVGEAGLYGALAHEYGAHVALLSGDDVFVDET
FT                   RPLFPAAQFVTVKEAAGFASGASMTPAAACGAIGVAARQAVEQAREGARAARPHAPRAA
FT                   RCELQAQSVAAADLFCQWPSLERVDALTLRFFAPSIEHVVRTLNCLSAMSFMLR"
FT   gene            complement(234542..235135)
FT                   /gene="pcaG"
FT                   /locus_tag="BMA10229_0244"
FT   CDS_pept        complement(234542..235135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="BMA10229_0244"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="identified by match to protein family HMM PF00775;
FT                   match to protein family HMM TIGR02423"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99492"
FT                   /db_xref="GOA:A2RWK0"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWK0"
FT                   /protein_id="ABM99492.1"
FT                   /translation="MTTLKQTPSQTVGPYFAYGLCPQQYNYDLKSLFTAEIATPDAAGE
FT                   PILLVGRVLDGDGHPVGDALLEFTHVDGDGRYPASRDEAAQRGFSGFARVGTGTHAQNR
FT                   FVVRTVKPARTSDTDAPHIDVTVMMRGMLAHAFTRIYFDDEAAANAADAALASVPAVRR
FT                   ATLIATRDAQANGVTVYRFDIHMQGERETVFFDV"
FT   gene            complement(235138..235872)
FT                   /gene="pcaH"
FT                   /locus_tag="BMA10229_0245"
FT   CDS_pept        complement(235138..235872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="BMA10229_0245"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="identified by match to protein family HMM PF00775;
FT                   match to protein family HMM TIGR02422"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98713"
FT                   /db_xref="GOA:A2RWK1"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWK1"
FT                   /protein_id="ABM98713.1"
FT                   /translation="MTIINLETFPMDSSTLAPRDWPSHPAYIHPPYRSSVKRGPTQPLI
FT                   PLKETLRNQHAPVYGADDLGALDHDLTKNAAKNGEPLGERIVVTGRVLDEGGKPVRDTL
FT                   VEVWQANAAGRYVHKVDQHDAPLDPNFLGAGRCLTDANGRYRFLTIKPGAYPWGNHPNA
FT                   WRPNHIHFSLFGDYFGSRLVTQMYFPGDPLLALDPIFQGTPEDARERLISRFSIDTTEE
FT                   GFALGYEFDIVLRGRDATPMER"
FT   gene            235950..236954
FT                   /locus_tag="BMA10229_0246"
FT   CDS_pept        235950..236954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0246"
FT                   /product="Pca operon transcriptional activator PcaQ"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466; match to protein
FT                   family HMM TIGR02424"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99025"
FT                   /db_xref="GOA:A2RWK2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWK2"
FT                   /protein_id="ABM99025.1"
FT                   /translation="MHNRIADGRVKFRHLQCFLAVAQFGSVQKAAHSLSITQPAVSKTI
FT                   AELESILGVRLFERGRQGARPTREGQLFMPHASACVLALRQGVGLLAREGGGAAATLEI
FT                   GMLPTVAASLAPAVLKTLAAEWPRAVVRITTVANAELLERLKAGAIECAIGRLSEPERM
FT                   VGLSFEHLYNEPLVAVVRAGHPLAASASPAAQLARYPVVLPPYGTIIRQAAEQLLSACG
FT                   APPLESFVEVLSVSVARALALENDAVWFVPRYAAEFDLAAGTLTRLALPVDGADEPVGL
FT                   ILRTDAQPSPVARALIDAVRAIARRRLAGAGTTSGRARGARGATGKGRGRRDA"
FT   gene            complement(237697..238368)
FT                   /locus_tag="BMA10229_0247"
FT   CDS_pept        complement(237697..238368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0247"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98559"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWK3"
FT                   /protein_id="ABM98559.1"
FT                   /translation="MAYAKSSSSVPTEFLYIGAAGEHYIMSECFRHNMEAFKLPIDKGF
FT                   DLVVTRAYRHLSRLDDVRKPVDPGLPDTPIYVQVKSRQATPVAPPRKKGERPVWEGHFP
FT                   IKPADLDLICATPNSALACVLFIDTRGELMRSRTAYAWWMSSAYVNQLRDAGHFIAMPR
FT                   KDALELWVRYVEPAPDSGYKQNTYISLLKQCQIKGSEPGKKSTGFLLSEERFDFGKLGV
FT                   E"
FT   gene            238396..238533
FT                   /locus_tag="BMA10229_0248"
FT   CDS_pept        238396..238533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0248"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00286"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWK4"
FT                   /protein_id="ABN00286.1"
FT                   /translation="MRGGGACARECATPRCSGDEAPRARGASGRGRRAARWRAMQKYDE
FT                   "
FT   gene            complement(238781..238987)
FT                   /locus_tag="BMA10229_0249"
FT   CDS_pept        complement(238781..238987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0249"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99752"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWK5"
FT                   /protein_id="ABM99752.1"
FT                   /translation="MVCDTRGTARIETARASRADGPNRIGKFRSRSASARRIGDAGQSI
FT                   GRHFESTSHHATTGHFIERSARC"
FT   gene            239089..240558
FT                   /locus_tag="BMA10229_0250"
FT   CDS_pept        239089..240558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0250"
FT                   /product="diguanylate cyclase (GGDEF) domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98798"
FT                   /db_xref="GOA:A2RWK6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWK6"
FT                   /protein_id="ABM98798.1"
FT                   /translation="MPLGYMVIAGAVAVAIVMMSICAAILRDSRDDAFEHAQRAARNTL
FT                   QMIERDVTRGFRLYDRTLARIAAQFGDRRIAALPAGLRREILFDSAAAANEAGVMYVLD
FT                   ASGHVTLASTRGPLPAERFASYDFFAAQRDTPALGMYLSGPYRMSSRDGEPYVALSRRI
FT                   ERADGAFAGVVVLAVRIAYFRQLLAAANVGPHGALVLMHTDGRILMRIPFDEKFVGLDL
FT                   TGTSLYSRMQFGRSGEFFDVEPIDHVKRFYLYRRLDDVPLVVQVAIADDDIYATWRLRA
FT                   WRFGVLTGVFALIFVVMSAYLAHSLWRKSTAEAALARLAGTDSLTGLYNRRALDETLER
FT                   EWRRAVGGDRPLAILFVDIDHFKRYNDTYGHQVGDEVLATVSRCIAQQAARLGDVVARY
FT                   GGEEFVVVLPDTPRGGALVVAERVRLGVRMLGIEHEGSEVGFVTVSVGVAVWHPDGASA
FT                   PHIAAIVEAADQALYRAKADGRNRVVDLGLG"
FT   gene            240573..240743
FT                   /locus_tag="BMA10229_0251"
FT   CDS_pept        240573..240743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0251"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00241"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWK7"
FT                   /protein_id="ABN00241.1"
FT                   /translation="MARRNGFGALAPEGVTRCGDARRPTRGGRARTRLGDRRKRGNVGD
FT                   VSEWANGRMGE"
FT   gene            240716..240847
FT                   /locus_tag="BMA10229_0252"
FT   CDS_pept        240716..240847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00042"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWK8"
FT                   /protein_id="ABN00042.1"
FT                   /translation="MGEWANGRMSEWANERMGEWANERMGEWANGRMGEWANGRMGE"
FT   gene            241306..241974
FT                   /locus_tag="BMA10229_0253"
FT   CDS_pept        241306..241974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0253"
FT                   /product="O-methyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01596"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99612"
FT                   /db_xref="GOA:A2RWK9"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWK9"
FT                   /protein_id="ABM99612.1"
FT                   /translation="MNERQWSAVDDFFCSQLAPSDPVLDAALASSRAAGLPAINVTANQ
FT                   GKFLNLLATIRGARRILELGTLGGYSAIWLARALPPGGVLITLEANADHAALARENLGR
FT                   AGLGGVASVVVGRAKDSLERLIAERAEPFDLIFLDADKDSYPAYLPLMVALSRPGTVIV
FT                   ADNVVRQGRVADRRNQDPDALGVREYFRLIAAHPRLTTTALQTVGSKGWDGFALTIVTA
FT                   "
FT   gene            complement(242255..242392)
FT                   /locus_tag="BMA10229_0254"
FT   CDS_pept        complement(242255..242392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0254"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99581"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWL0"
FT                   /protein_id="ABM99581.1"
FT                   /translation="MITFGEPLVALFDGSAVRNIQVGAPCYPTSRRYAAIDHGGAPAGA
FT                   "
FT   gene            complement(242472..243590)
FT                   /locus_tag="BMA10229_0255"
FT   CDS_pept        complement(242472..243590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0255"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="identified by match to protein family HMM PF00793;
FT                   match to protein family HMM TIGR00034"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00103"
FT                   /db_xref="GOA:A2RWL1"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWL1"
FT                   /protein_id="ABN00103.1"
FT                   /translation="MQNIDNPQRDRETGFADATQDTTRIDDVRIGAVRPLISPALLQDE
FT                   LPVPSAVQALVEASRDAIGDVLHGRDDRLLAIVGPCSIHDHDQALDYARRLKSAADALR
FT                   DDLLIVMRVYFEKPRTTVGWKGYINDPRLDGSFRINEGLRAARRLLIDINALGLPAGTE
FT                   FLDLLSPQYIADLIAWGAIGARTTESQSHRQLASGLSCPIGFKNGTDGGVQVAADAIVA
FT                   ARASHAFMGMTKMGMAAIFETRGNDAAHVILRGGKRGPNYDRASVDEACAVLRAAGQRE
FT                   QVMIDCSHANSNKSHLRQVDVAEDLARQLSDGERRITGVMVESNLEAGRQDLKPGVPLQ
FT                   YGVSITDACLSWAQTEPVLDTLAQAVRRRRAA"
FT   gene            243589..244320
FT                   /locus_tag="BMA10229_0256"
FT   CDS_pept        243589..244320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0256"
FT                   /product="DGPF domain protein"
FT                   /note="identified by match to protein family HMM PF04946"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00450"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWL2"
FT                   /protein_id="ABN00450.1"
FT                   /translation="MVGFRFCEISPDYGTRAGPGATIGGVSRCAAANARAAGSRRTRPR
FT                   RRQRAPPRAAGCFFARTCRIRRRSVVEMSWPPDGAGPDPAAARLDSSTRGGSKMRVMVM
FT                   VKATNESEAGKLPTREQFEAMGRFNEALVKAGVILAADGLHPSAKGKRVRFSGSARSVI
FT                   DGPFAQTGELVAGFWLWKVASMDEAVEWVKRCPNPMESDSEIEIRPLYELEDFGDAFTP
FT                   ELREREARLRDEIDEQGKKAP"
FT   gene            complement(244466..245035)
FT                   /locus_tag="BMA10229_0257"
FT   CDS_pept        complement(244466..245035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0257"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99252"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWL3"
FT                   /protein_id="ABM99252.1"
FT                   /translation="MRRAPPIPILFAVACVAARAAGLPTPVLSRLPPGYEVMAARQGPD
FT                   VDAGRISYLIVLHRPADSASEPSPRPLVIVEQQADGTFRLAARNDEVVLRANEGGQCDP
FT                   FDPQDADENGLAVKGRFFTVQNFVACGQHWSDYVTFRHDARTGRWLFANEIRTESFPLE
FT                   GKPDRVRAIRADPRKPVALDAWRRGD"
FT   gene            complement(245044..245211)
FT                   /locus_tag="BMA10229_0258"
FT   CDS_pept        complement(245044..245211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0258"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99838"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWL4"
FT                   /protein_id="ABM99838.1"
FT                   /translation="MRPRGSPTAVREPFEESATPSRAMNRPTRREAWRAPCASLARHAS
FT                   SRIAFRQPST"
FT   gene            complement(245539..246834)
FT                   /locus_tag="BMA10229_0259"
FT   CDS_pept        complement(245539..246834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0259"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00430"
FT                   /db_xref="GOA:A2RWL5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWL5"
FT                   /protein_id="ABN00430.1"
FT                   /translation="MNAPAEPGATTVPHRAGSLTILQGAALYIGAVLGTGVIALPALAA
FT                   EVAGPASLLAWAALVMLSIPLAATFAALGARYPDAGGVSTYVRKAFGPKAAAVVGWCFY
FT                   FAVPAGAPAAAMFGGAYVAAVTGGAHATMIASAAVLIALVAAANAFGVTVSGRMQLVLS
FT                   ALLVALLVAAVLASAPHARAANLHPFAPHGWLAVGEAAALLVWSFAGWEAITHLAAEFR
FT                   RPARDLPRSTGIAVAVVGLLYLSVAAASVLVLGPAAGESGAPLAALIARGIGGNAQLIA
FT                   TAAALLFTLGTMNAYFAGAAKLGAALGRDGALPRWFAQGSQTGGVPRRSLAVVAALAGC
FT                   ALVAAVATGMGPKPLVLATSGNFVMVYVLGAAAATRLLPRGGLAHRASIVALLSALLLL
FT                   ATTGWYLLWPLLLTASAIGYLFITGRRAAAKR"
FT   gene            246793..246939
FT                   /locus_tag="BMA10229_0260"
FT   CDS_pept        246793..246939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0260"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98879"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWL6"
FT                   /protein_id="ABM98879.1"
FT                   /translation="MRHGCGAGLGGGIHRSGLLMGGFEFACVFARGRAARRRRAGSGRR
FT                   AAG"
FT   gene            complement(247014..247196)
FT                   /locus_tag="BMA10229_0261"
FT   CDS_pept        complement(247014..247196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0261"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99070"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWL7"
FT                   /protein_id="ABM99070.1"
FT                   /translation="MIRARLAGFEPPAADALAAHAAPRASSGTSVPSEARPPPETPRAA
FT                   QAPHLRISQRNNPDR"
FT   gene            247369..247632
FT                   /locus_tag="BMA10229_0262"
FT   CDS_pept        247369..247632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0262"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99193"
FT                   /db_xref="GOA:A2RW75"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW75"
FT                   /protein_id="ABM99193.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            247656..248489
FT                   /locus_tag="BMA10229_0263"
FT   CDS_pept        247656..248489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0263"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00130"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABN00130.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(248703..253499)
FT                   /locus_tag="BMA10229_0264"
FT   CDS_pept        complement(248703..253499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0264"
FT                   /product="ATP-dependent helicase, DEAD/DEAH family"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF08494"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99959"
FT                   /db_xref="GOA:A2RWM0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWM0"
FT                   /protein_id="ABM99959.1"
FT                   /translation="MHATPARPAAGALDAFHPVVAAWFSDTFAAPTGAQALAWPHIKAG
FT                   RSTLVAAPTGSGKTLTAFLSALDDLVRDALAHDGALPDETLVVYVSPLKALSNDIHVNL
FT                   EAPLAGIAAEIARRGLPVPQIRTAVRTGDTTQAERVAHRKHAPHILVTTPESLYVLLSS
FT                   ESGRRMLASTRTVIVDEIHALANAKRGSHLALSLERLDALVGRKLPRIGLSATQKPVEA
FT                   VARFLVGGRDDAPLDCAIVDTGHTRTRDLALELPPVPLEPVMANDVWERLYDRIAELAA
FT                   AHRTTLVFVNTRRMAERAARHLADRLGADAIAAHHGSLAKEHRFDAEQRLKHGKLKLLV
FT                   ATASLELGIDIGDVELVCQLGSPRGIAPFLQRVGRSGHHIGGVPKGRLFPLSRDELVEC
FT                   AALLDCVRLGELDVLRIPRAPLDVLAQQLVAEVACREWDEHALYRCVTQAAPYATLARE
FT                   TFDEVLKMLAEGFTSRRGARAAYLHRDVVAHTVRGRRGARLAAVTSGGTIPDNADYAVL
FT                   LEPQGVNIGTVNEDFAVESLAGDVFQLGNQSYRIIRIETGRVRVEDAHGQAPNIPFWLG
FT                   EAPARSDELSAGVARLRARLDALLAHGDAAGAGAALPVNAASAPAPEREAAAAGQGARA
FT                   RAAAPHGTSALARRALPAALPAAPPAVCARAAPSAAAPSTAIPSAAAPTVAAMPVPPEA
FT                   ELRTEPRRLAPALAWLTGELGLDAEAARQIADYLARARAALGALPTQDTLVMERFFDES
FT                   GGMQLVIHSPYGSRINRAWGLALRKRFCRSFNFELQAAATDDALILSLSHAHSFALDEV
FT                   WRYLRASSAEHVLIQALLDAPLFAARWRWNATTSLALPRFAGGRKVAPQLQRMKSEDLL
FT                   ATVFPDQVACAENIVGEREVPKHPLVDQTLDDCLHDAMDTEGWLALLRRIEAGDVALVA
FT                   RDLPAPSPLAAEILNAKPYAFLDDAPLEERRTQAVLARRWSDPESADDLGALDAGAIEA
FT                   VRDEAWPLVREPDEMHDALVGLACIADDEIASHDGWRACVAQLAAGGRAARLALAGGRG
FT                   LWIAAERVACMRALYGADVALDPPLAPPPGFDAPWEPEAALVDVIRARLTGFGPVTAAA
FT                   LAAPLALPAASVAIALAALEREGYVMRGRFTPGARDDEWCERHLLARIHRYTVKRLRRE
FT                   IEPVELADFMRFLFHWQRVAPDTRGLGGDALAAVVHQLEGFEAAASAWEDEILPARLAD
FT                   YVAGGLDEPCRAGKLTWTRLGAPAKAASAPVKTTPVVLLPRRELAIWQALRDPAAQPAL
FT                   SARAERVRATLAAYGAMFFDELAAHARLLPVELERALGELVAAGLVNADSFAGLRALLR
FT                   PAAQRGAQRPSRARRGGALIGGMDDAGRWALVQRLPLAPLDFGEGGSEDEAANDDDAPS
FT                   GDGTPGAGPEAARRGGVREDGAEADARIARAMRAAPPQAGRHAIAPAALEHVARTLLRR
FT                   YGVAFWRLLACEAEWMPSWRELLPVYRRLEARGEIRGGRFVAGLAGEQFALPDAIPILR
FT                   ELRRRPAEGLMLCVSGADPLNLTGTLLPGERVPALAGNRILFRDGVPIASLVGGQFAFA
FT                   RELDALAQDRARARLARHR"
FT   gene            complement(253796..254062)
FT                   /locus_tag="BMA10229_0265"
FT   CDS_pept        complement(253796..254062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0265"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99342"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWM1"
FT                   /protein_id="ABM99342.1"
FT                   /translation="MPLKLPLKLPLKLPLKLPLKLPLKLPLKLPLKLPLKLPSQSQPKS
FT                   RPKSPLKSSSKLALKSQPKSKSQPLSETSPMSAKPVHRRPGCG"
FT   gene            complement(254120..254815)
FT                   /locus_tag="BMA10229_0266"
FT   CDS_pept        complement(254120..254815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0266"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99372"
FT                   /db_xref="GOA:A2RWM2"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWM2"
FT                   /protein_id="ABM99372.1"
FT                   /translation="MRATPMSARAAAIRPTLAEPNAGRGRARCAARCSVEWRARPRRAL
FT                   RRSGRIVRDTTHKNMTDDITTPSPAPRPLPGFGPLRWIVRHWRGGYSLAVSFWLNQAPI
FT                   YALRTICSQVLMTRVFELLDPGQGPGDNDALANALAAVPPVVLADAALSLLNVWWIVGV
FT                   WHAASRHIAATGRRFWARAAQVMVALAAVRIVYGIAVIPHSIESLQLLVIHPGSLLTDP
FT                   VGTLRNWLF"
FT   gene            complement(254968..255486)
FT                   /locus_tag="BMA10229_0267"
FT   CDS_pept        complement(254968..255486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0267"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98748"
FT                   /db_xref="GOA:A2RWM3"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWM3"
FT                   /protein_id="ABM98748.1"
FT                   /translation="MASHAAHHASGWAAGLVAAALVAQAGAAGPWHVYSLAAFAAGVAG
FT                   GTAPDWLEIAWWRRTRRLWVTHRTITHWGVGWAALLAFAYRSLGHRHPWAAPLFGFACG
FT                   GLVHLIADWPNPLGVPWLWKRHSLNWWNSGHCDLIVVAAAWAGALWLAQAAWGHAAPLA
FT                   HWLGWLRTV"
FT   gene            256343..258064
FT                   /gene="ggt"
FT                   /locus_tag="BMA10229_0268"
FT   CDS_pept        256343..258064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="BMA10229_0268"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="identified by match to protein family HMM PF01019;
FT                   match to protein family HMM TIGR00066"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99809"
FT                   /db_xref="GOA:A2RWM4"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWM4"
FT                   /protein_id="ABM99809.1"
FT                   /translation="MNATNRFKSTVLAALVSSALAGFLPSAPAHAKGPQQRVVLDGSAV
FT                   AVADKYSADAAEEIFRQGGNAVDAAVAIAFTLAVTYPEAGNIGGGGFMTVYMGGKPYFL
FT                   DYRERAPLAATKDMYLDKDGNVVKGMSLYGDRAVGVPGTVAGMWEAQKRFGKLKWKQVI
FT                   APAIRYARDGFVVDEQLAQRGVDASKEFGGKTNFDQYFSGLKAGATFKQPELAAVLARI
FT                   ANDGAKDFYDGKTADLIAASMKKGGGLITKQDLVQYKAVWRQPVQANWNGYRVITAPPP
FT                   SSGGIGLVQLLTMKADRKADFDGVALNSPQYVHLIAEIEKRVFADRAQYLGDPDFYKVP
FT                   VAQLTDAAYIAKRAAEVNPEKPSDTKSVLPGLGTSMPEKAETTHFSVVDKWGNAVSNTY
FT                   TINGYFGSGVVAEGTGIVLNDEMDDFSAKPGVANMFGVVGSDANAIEPKKRPLSSMSPT
FT                   VLTKDGKVALVIGTPGGSRIFTSIFQVITNLYDFKMPLKDAVGAMRFHHQLLPPNTIFW
FT                   EPYHSIDGELAKGIEAKGYTLKGQDFSGDIQAIRIDGKTPEAVSDPRGRGVSRVIR"
FT   gene            258067..258276
FT                   /locus_tag="BMA10229_0270"
FT   CDS_pept        258067..258276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00165"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWM5"
FT                   /protein_id="ABN00165.1"
FT                   /translation="MARRRAEAAARRREHERAGESAARRPWRAALSCFRRAFGLSAGPA
FT                   SLTRSRASRPRRRAAAPPHAHSLF"
FT   gene            complement(258261..259691)
FT                   /locus_tag="BMA10229_0269"
FT   CDS_pept        complement(258261..259691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0269"
FT                   /product="putative outer membrane protein TolC"
FT                   /note="identified by match to protein family HMM PF02321"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99112"
FT                   /db_xref="GOA:A2RWM6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWM6"
FT                   /protein_id="ABM99112.1"
FT                   /translation="MFETENLGASSKFRHAGFHLTTKSFRLRANVAYVTVCAVLAALGT
FT                   GSESARAFCLDEAYQHAISNDPKFLQARAEYDAARQKFPQARAQMLPQVSAQLEWGRYG
FT                   THANLFGIDVSGNSTAAYGAAQLSQALFNMPYLYDMSRAKEFEESARQQLEVAKQELIM
FT                   RVANACFDLLSAREKLQLADDEVGALTRLESDTRRMAQLGMKTIGDTAEIEARRSLAQS
FT                   DEALARTDVEARRARYETLLGSAIDFTRWPRLAMHGTSPRIPTGDYQPQDNPSYQQAYR
FT                   DLRVARLASKRINAEHLPSVDLFATYSRGLNPNLRGLTDKNDFHQSAVGVQVTIPIFSG
FT                   GSVHYRKIEADHVATQYQNRLREVEQQLSTDHRETLAALQSIGTRIRALQQSLQAARLA
FT                   YDSSMKAHQVGYSTTYETLNLRTDISNIRQKLFESYLDALKLQLKLKGILGTLDEQSLV
FT                   AVDSFLASNAAPADQKSE"
FT   gene            259970..260143
FT                   /locus_tag="BMA10229_0271"
FT   CDS_pept        259970..260143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99629"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWM7"
FT                   /protein_id="ABM99629.1"
FT                   /translation="MKVMTMEQAKVVNGGGPISSLGTLAAASGPLFTALGQFMPTLGGY
FT                   LQNPKNFNSNGK"
FT   gene            260390..260575
FT                   /locus_tag="BMA10229_0272"
FT   CDS_pept        260390..260575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0272"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99149"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWM8"
FT                   /protein_id="ABM99149.1"
FT                   /translation="MQAISEQQARAIRGGGSAYANSAAYTVSLANQSITPVVNGLLNEY
FT                   QTQAVNQFKMALGSGS"
FT   gene            complement(260630..260743)
FT                   /locus_tag="BMA10229_0273"
FT   CDS_pept        complement(260630..260743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0273"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99194"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWM9"
FT                   /protein_id="ABM99194.1"
FT                   /translation="MGLTLFVLNHIACESLDTTMPGRARRDPARGLRASAA"
FT   gene            260712..262835
FT                   /locus_tag="BMA10229_0274"
FT   CDS_pept        260712..262835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0274"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00350"
FT                   /db_xref="GOA:A2RWN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWN0"
FT                   /protein_id="ABN00350.1"
FT                   /translation="MWFNTNKVRPILQDEVTECGLACLAMIATWHGRDTTLRTLRNRYP
FT                   VKIDSGLSFFDLMEIANDLGMRARGLQFEANEIDALKLPCILHWGMNHYVVLTKVCYGS
FT                   VHIVDPALGETKLPLAQALTQITGYALELNPDIGFKHVGTSDKIRLGDYLVGLTGIRKS
FT                   ILLGVAGGIAAQLLLLLGPSYVQLTIDEALKKTDVDILYLLTILFGIVFLFDTLYANLV
FT                   GNIKSYLRNIVSQQLSANMVGHLARLPIGYYLFHNTGDSISRVSSVSEIGRFLVDGLIG
FT                   GLLNVFTCVITLVLMLYYSPVLAGISLAGMVLFALSRLAIQPQLQDAMSQILTRGAEAD
FT                   ALLIENIRSAHSIKLLSSETSRSSLWVNAFTQKLQAVRQQERLQLLFDAISKGIVHVEQ
FT                   LVIVTYGAWLVMHGQSTIGIIYAFIQYKNLFADKFVDSIQLYVRRKVLQVHMDRVADVL
FT                   QTETEEPAPDAPVRSIEHFDGSLSIRALTYTPKGGRRAILEDVNLDVPAGAKIAIVGRT
FT                   GSGKTTLLNLICGLYPPAPGALFVGGVDLSEVNLRLYRKHVAAVTQSDQLFRGTIRDNI
FT                   TNFAPAPRLGAMHEAARLACIERDIDVLDNRYDTPLGDTQKFLSAGQMQRLLIARALYC
FT                   EPRLLILDEFSSNLDQATTHEICRNVLTLPCTIVLVTHDASILSMVDRIYEMRDGRLAD
FT                   ITPARQPEPEVQK"
FT   gene            262832..263854
FT                   /locus_tag="BMA10229_0275"
FT   CDS_pept        262832..263854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0275"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98789"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWN1"
FT                   /protein_id="ABM98789.1"
FT                   /translation="MTLMRLFLFNAFSYCFLLRRVVKRIALGRSPARGLGMMRWCAGVC
FT                   LRLFPSIRGSIEMSVRHMLSAHLNDDPVRIRGVADGIVRELFEAEVAGLMLRSHSIASM
FT                   KTLIDRMECEGEGVLRAALARGGPLMLAGLHFGNLMLYVSKLRLMIPDDRKMMIVMHKD
FT                   APGAFFDDAQRLVQEYGAGKIELIDIEQRVHLRRLVAGLRKEAPVFLLFSDLHGRFGKT
FT                   NACRLGGRWVRLAGGGVKLAVEHDIPMLVSYATGVPFRDACKVHFVELDARPAPRMLGV
FT                   ADDASRVAAAHQRIADKLEEALVKQPEQWHFWEHFTPYLMPSPLLEQNARAAAQTLRSA
FT                   "
FT   gene            263867..265162
FT                   /locus_tag="BMA10229_0276"
FT   CDS_pept        263867..265162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0276"
FT                   /product="putative secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99443"
FT                   /db_xref="GOA:A2RWN2"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWN2"
FT                   /protein_id="ABM99443.1"
FT                   /translation="MPIRMNALREQKTPRKLTRGTTFGTVINGVVDVPISMRFFCYLSI
FT                   MMFAMFIVALVRLTYANTESVMGMLTPRSGLIGVGAPPGWAVREVFVAKDQHVKAGQKL
FT                   LSVTRDTSFVSQANNVQGMRESIKRQRVEVGQQIDAAKLEYQSTIQQINQQIAAFDESR
FT                   GLIDKQIQDQKRIVSEYQERRDRVKQLLNEQVVTLEQYNQVNTQYLQASQAYQDLMLRR
FT                   ADLAKNAMKLRGDLETVQSKYDGSNAELKIKQEELNSKEYNIDESVNQVLYAPADGQIV
FT                   RLDVVQGSVIDPPGTRVVEILPAKADGLIAELYIPSSKAGFVKPGQEVKLAYGSYPVEK
FT                   FGTYRGKLLSVSPVAFTAKELNLPADNGAPQTYFKSWVELVDRKPAFEGKALSLKAGMT
FT                   LRADIVLEKRTLLEWLFEPLYRIRQRIFGTPA"
FT   gene            265176..266672
FT                   /locus_tag="BMA10229_0277"
FT   CDS_pept        265176..266672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0277"
FT                   /product="putative liporotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00039"
FT                   /db_xref="GOA:A2RWN3"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWN3"
FT                   /protein_id="ABN00039.1"
FT                   /translation="MGDKHRRRRARRDWRAPVSCWLGATLLACAWSAHAQDSGAARWRD
FT                   GADGIGFFPGGDAPGFDARAWGAVPGDARRAAASDARNGAAASAGSEATAAAPAADANA
FT                   APARKLTEERITLGERVAPVADAARRVRADGDDGIGFADAPGGPPAGGATPSAACDDGA
FT                   CVPDGGDAGRAPRRPPAGATPRFIAGVRYDRMPYELHPIDPERLPDLPEAQGPTLLEQL
FT                   QGDDSNMIGVGWHYVLSTGRSTPVTTSTAALGIGSFANPGSAVSISNTNTPAFTFTHFF
FT                   GEHVAAEIVAGIPPELTMRGHGSIGLPFDKIFPGVQGRLPLVDLGNTQSNPLGTTRAWL
FT                   GSAVFKYYLGKREDRLRPYVGLGLSYTRFTNTNLNPVFAHKLASLGGLLSAGISLGDLQ
FT                   SLLTDSGALDRLLQAGANLILPNGVRATADVKSAWTPVFVVGANYQLTRQLSLSTALSY
FT                   IPLKAAITVNINDTKGILASNTTTLSANVLLCTMLLNFRF"
FT   gene            267072..267998
FT                   /gene="ppk2"
FT                   /locus_tag="BMA10229_0278"
FT   CDS_pept        267072..267998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk2"
FT                   /locus_tag="BMA10229_0278"
FT                   /product="polyphosphate kinase 2"
FT                   /EC_number="2.7.4.1"
FT                   /note="identified by match to protein family HMM PF03976;
FT                   match to protein family HMM TIGR03707"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98913"
FT                   /db_xref="GOA:A2RWN4"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWN4"
FT                   /protein_id="ABM98913.1"
FT                   /translation="MSEKDTRRDTAPLHERQRRFEEDLVDAYDEELEMELDDRRFDDES
FT                   LFSPERREARKRYFRELFRLQGELVKLQDWVVSTGHRLVVIFEGRDAAGKGGVIKRITQ
FT                   RLNPRVCRVAALPAPSNRERTQWYFQRYVAHLPAGGEIVLFDRSWYNRAGVERVMNFCT
FT                   DAEYEEFFRSVPEFEKMLVRSGIQIVKYWFSITDEEQEVRFQNRIEDPLKQWKLSPMDL
FT                   ESRRRWEAYTAAKEEMLLRTHIAEAPWWVVQAVDKKRARLNCIHHLLGLVPYYEIERDS
FT                   VHLPRREHHDDYIRRPVPAEMIVPEIY"
FT   gene            complement(268085..268342)
FT                   /locus_tag="BMA10229_0279"
FT   CDS_pept        complement(268085..268342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99461"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWN5"
FT                   /protein_id="ABM99461.1"
FT                   /translation="MQELSPQEIAHVSGGHYDGGSLFDTLGNLIEIAGKGAETIGNTLT
FT                   FGLLSPIGSAAYGVGEVLTTAAVNLGNSLLNLFGIPAKHY"
FT   gene            268384..268662
FT                   /locus_tag="BMA10229_0280"
FT   CDS_pept        268384..268662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0280"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99139"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWN6"
FT                   /protein_id="ABM99139.1"
FT                   /translation="MTSGPKGVKVPPAFGDAGARPASQQTLEAFPLESCASGDACDASG
FT                   CAARRGGGADARRAGLTNRARCSKLAHMNSLGFRIAHIIRTIHRMVG"
FT   gene            268753..269262
FT                   /locus_tag="BMA10229_0281"
FT   CDS_pept        268753..269262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0281"
FT                   /product="putative threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99560"
FT                   /db_xref="GOA:A2RWN7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWN7"
FT                   /protein_id="ABM99560.1"
FT                   /translation="MQSDDVVTETPEAPPREAVAPTAIAPRARTLDDYLKLVLNARVYD
FT                   VARETALERARSLSARLGNAVYLKREDNQPVFSFKLRGAYNKMAHIPADALARGVITAS
FT                   AGNHAQGVAFSAARMNVKAVIVVPVTTPQVKVDAVRAHGGPTVEVIQAGESYSVTCPLQ
FT                   TGPAGV"
FT   gene            269293..269556
FT                   /locus_tag="BMA10229_0282"
FT   CDS_pept        269293..269556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0282"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98634"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABM98634.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            269580..270413
FT                   /locus_tag="BMA10229_0283"
FT   CDS_pept        269580..270413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0283"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99444"
FT                   /db_xref="GOA:A2RWN9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWN9"
FT                   /protein_id="ABM99444.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQGYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            270482..271600
FT                   /pseudo
FT                   /locus_tag="BMA10229_0285"
FT                   /note="threonine dehydratase, biosynthetic, truncation;
FT                   comparison of this gene to its homologs suggests this gene
FT                   has been truncated; identified by match to protein family
FT                   HMM PF00291; match to protein family HMM PF00585; match to
FT                   protein family HMM TIGR01124"
FT   gene            complement(271579..272295)
FT                   /locus_tag="BMA10229_0284"
FT   CDS_pept        complement(271579..272295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0284"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99116"
FT                   /db_xref="GOA:A2RWP0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWP0"
FT                   /protein_id="ABM99116.1"
FT                   /translation="MARTTRTDWIAAGLAALDDEGAQGVSADRLARRLGVTRGAFYHHF
FT                   GSRKAFVLALLAEWEAAYTTQAIALLQAGGPPEAALDRYLAAASQMNPRREAAIRTWSL
FT                   HEPLVAEFQRRADRARLAAAHAFCRQTLRSEADAALFAQVAYLCFVGAQQSPLPMGPDD
FT                   FATLFRSLFALGERLSAPGLRDDERAVGNPDEREGARGRDAEPRAAGDASRGRDAAYAP
FT                   APARGRRGERQPRNNR"
FT   gene            272374..273672
FT                   /locus_tag="BMA10229_0286"
FT   CDS_pept        272374..273672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0286"
FT                   /product="putative protoporphyrinogen oxidase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01593"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99639"
FT                   /db_xref="GOA:A2RWP1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWP1"
FT                   /protein_id="ABM99639.1"
FT                   /translation="MHVLVVGAGIAGLAAAWQLKRGGCDVTVVEAAERAGGRIRSAPFH
FT                   GHVIECGAQFPSSGYRHLMPLFGEAGLDAQLVKTSPWAAFEHRGRLFRVHARRPWTIPA
FT                   SGLLGWRDSVRVSRARAALLARVRALDPNRYAAFAEFDDADAAHWAERAFGRAAVDAIF
FT                   APMIHGLYFQPLRGASRALLAAVTGFDGADTLAVAGGWQTLPVALAARLDVRYGTRVDA
FT                   LSAHANGVDACVGDRALRFDAAIVATPATVARRLWRGQTDAQRALLATGYARCAHVAFG
FT                   LAPGWRAPARLRRVYGALLSPHARRVAALTFERGRGIGDGQGEVVSAMLGHAGASALRY
FT                   ASDDEIARVALDDLRTLLPGVAEAVVATRVQRWDEAEPLSPVGRARAIAAYRASIDARP
FT                   RVLLAGDYMGSPWTDGAAETGRWAARRLLDARA"
FT   gene            273869..274291
FT                   /locus_tag="BMA10229_0287"
FT   CDS_pept        273869..274291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99128"
FT                   /db_xref="GOA:A2RWP2"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWP2"
FT                   /protein_id="ABM99128.1"
FT                   /translation="MAGPQAARVLFGAGVPGASRGAAIVCSLSLAWGFGEVAGYARALD
FT                   GKPTRAPWFYGTHVASVASGAAIVWIAPDLVSLNIAAQGIHAAMLPLVAGLLVAPAAIA
FT                   LPPARRARGAYLRIVSAVAAAVSVAGIAGAASGRMP"
FT   gene            complement(274395..275471)
FT                   /locus_tag="BMA10229_0288"
FT   CDS_pept        complement(274395..275471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0288"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98677"
FT                   /db_xref="GOA:A2RWP3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWP3"
FT                   /protein_id="ABM98677.1"
FT                   /translation="MPMSARTNAAFTALLAAALFGATTPLAKTLLGSLTPFMVAGLFYL
FT                   GSGVGLGAFMLMRRLARGAGAGASPAGHARLPLAELPWLAGAVAAGGVAGPALLMLGLA
FT                   TTPAATSALLLNLEGVFTALIAWAVFRENVDAQIFAGMAAIVAGGVLLSWHPGAAGVPL
FT                   GALLVAAACACRAIDNNLTRKVSTHDAAAIACVKGLVAGTVNLGIALALGARLPAAADS
FT                   AAAMLTGFAGYGVSLVLFVVALRNLGTARTGAYFSVAPLFGVGLSLALWPEWPPLSFWA
FT                   AAALMALGIWLHLRERHEHPHTHEALEHSHRHRHDTHHQHAHDFDWDGTEPHTHAHRHT
FT                   PITHTHAHFPDIHHRHSH"
FT   gene            complement(275601..276512)
FT                   /locus_tag="BMA10229_0289"
FT   CDS_pept        complement(275601..276512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01205;
FT                   match to protein family HMM PF09186"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00278"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWP4"
FT                   /protein_id="ABN00278.1"
FT                   /translation="MDPWSIARRAASAAAHPAACAGRKNGGHATCGVARSGKSARRRRD
FT                   RIRTAPECRDARHGKIYFLRPTRPRTHRAGERRPDEPTPADTRQKRKTPRAFDFLIPFA
FT                   TRNMTYTLAATYTRELDIRKSRFIAYAIPVEDRDAAMAELQRLRAEHPGATHVCWALLA
FT                   GGQSGMSDDGEPSGTAGRPILEVLRHHDLDGVLGAVVRYFGGVKLGAGGLVRAYTDAIA
FT                   AALIDAERVERIAYARLAIEIGYPDEARVRRWIEQEGHALVDSAYAMTVKLVIRLPAAA
FT                   ADAARDTLFDLTQGRAGFPSVD"
FT   gene            complement(276962..277468)
FT                   /locus_tag="BMA10229_0290"
FT   CDS_pept        complement(276962..277468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0290"
FT                   /product="RNA polymerase sigma-70 factor, ECF family"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99305"
FT                   /db_xref="GOA:A2RWP5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWP5"
FT                   /protein_id="ABM99305.1"
FT                   /translation="MTGADIASTLPPLLPRLLAFARRLCGDTHDADDLVQRACLRALER
FT                   PHQLQRDTSPLNWMMAIVHSSWMSELRARHVRHRLQTDWNDDVIDALPGPTAADPQIHA
FT                   MNAQIIRAVELLPETLRAAMLLIAVEGLSYQEAAGVLDVPIGTVMSRLWRARQSIGAQF
FT                   GARER"
FT   gene            complement(277516..277746)
FT                   /locus_tag="BMA10229_0292"
FT   CDS_pept        complement(277516..277746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0292"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00522"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWP7"
FT                   /protein_id="ABN00522.1"
FT                   /translation="MPAATVAEEQPIQYRFGGRCSMSSFTRSRARLSGEFDDFRRRTSE
FT                   RDRMGATAGNAAAMSRANESLLQRRLRNGLA"
FT   gene            278115..279914
FT                   /locus_tag="BMA10229_0293"
FT   CDS_pept        278115..279914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0293"
FT                   /product="AMP-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99680"
FT                   /db_xref="GOA:A2RWP8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWP8"
FT                   /protein_id="ABM99680.1"
FT                   /translation="MPSNFAEHFENQVLKYGNRSQFVFLHGKPGDSAGEARLGYAQLDA
FT                   RARSIAAWLSACGAARRPVLLVYPEGLAFVAAFLGCLYAGAIAVPVPVPADARSVERTR
FT                   RIVRDAGIALALTPTAADAHALANCLAAPGDAVSTVGALRCEATDALEALDASAWSRPA
FT                   LDASAIAFLQYTSGSTGEPKGVVVSHRNLLHNEAQIQRVVASDADSVVTGWLPHFHDMG
FT                   LIGMLLHPLYVGCDCVFMAPSTFLRRPVRWLEAATHYAATITVAPNFAYDLCARAVKRE
FT                   QLGGLDLSALKVALNGAEPVRAKTIEAFSARFAPVGFDARAFSPCYGMAEVTLLASAGR
FT                   PAAAPVLLDIDARALERHEASLAKPGAEALRVVGSGRAVDLDLRIVDPQTHAVAADGRI
FT                   GEIWLRGDSVAQGYWRRPDASEAAFRARTAAGDGPYLRTGDLGFVRDGELFVTGRLKDL
FT                   LIVNGRNLYPQDIEDFVRELHPALGAGAGAAFSIDADGERVVVVHEIKEAWLDDGLSAA
FT                   ALSARIRTALARAFDIAAPSVVLVPRGGVKRTTSGKVQRGLTRDAFLAARLRVLHEDIQ
FT                   VPVRSLRVAAGEGVAQDASRGAA"
FT   gene            279911..281671
FT                   /locus_tag="BMA10229_0294"
FT   CDS_pept        279911..281671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0294"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99071"
FT                   /db_xref="GOA:A2RWP9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWP9"
FT                   /protein_id="ABM99071.1"
FT                   /translation="MSLNHAPFALASAFDRYLGDPSMPDNAFSYARCAQLDAHERFPDA
FT                   VCAMLSQWGLHRYYVPERFGGMLRDFEQPLQLIRMLARRDLTVAIGHGKTFLGAVCVWV
FT                   GATHEQASRFARRIGDGAIVSWGLTEREHGSDLLRSDTYAEADGDEYRIAGEKWLINNA
FT                   TRGDMISLLARTRREGGPRGFDMLLVDKHALSQGRFRPLPKERTHGIRGADISGIAFDD
FT                   ARIPASARIGARGAGLETVLKGLQLTRTLCASLSLGAGDHALRLALGFACERRLYGRTL
FT                   IDLPNARRTLIDAYTDQLLAEAAALVGARSIQALPDEMSVTSAVVKYLVPTRAEAMLDT
FT                   LAELLGARAFLADTYAHGMFQKVQRDNRIVSLFDGNTLVNLNAIVNAFQTLAKRYRGRD
FT                   GADAGQALAAFDLGMPLPAFDRGALSLVSRHGCRVVGALPALADGIAQRAACEPALSRL
FT                   VAPVRRLAALTDDVHRRMLACPPVRVHVPVEQFELAKRYALCHAAASALGLWWHTRHRV
FT                   GEASAAPPWRDGLWLRAVLRRVRVALGDAADFDDEAGDALWRALLRQHRDGLLFSLLPC
FT                   ELAEHRGEAA"
FT   gene            281668..283461
FT                   /locus_tag="BMA10229_0295"
FT   CDS_pept        281668..283461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0295"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98460"
FT                   /db_xref="GOA:A2RWQ0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWQ0"
FT                   /protein_id="ABM98460.1"
FT                   /translation="MSADAILTGRERAHRRVDAAGPHADLEQALGDPFDAANPLGYARI
FT                   LDADEREALSPDAEAVLERWGMNAEFVPARLGGRWDSVTEMVRRLRPVFRRDAALGIGH
FT                   GVSSLVAAVGVWAAGSPAQQRELSELLLRGGKVSAAYHELDHGNDFLRNAFEAYPGADG
FT                   ALVLNGTKEVINNADRAHAWVVFARTDARAGGRSHSVLLLDRAALQPAIDAGELEILRR
FT                   HRTAGVRGCRLAGLRFSRCRVPAERLVAARGAGVEISLRAFQITRIALPGMAIGMLDTA
FT                   LRTVVAFARERTLYGTRVIEMPYVRALLSDAMADLLAADCLVRAAARGLHLAPAHACVH
FT                   AAAVKYLVPQLLRDSMNVLSVVLGARAYLRGGRHAIFGKMMRDMPIVGLAHAGGTACLL
FT                   TVLSQLPALARRAAHRARDAGAPFDERVALPPLDFDALTIAAHGEDWLLDALPNALDAF
FT                   EAAGERATPLARAVRHATAALDALRASAKRLPPSETGPAVHPESFELARRYAVLAAAAA
FT                   CVGVWRAERARAGASFVGAPAWLEAALSRLSERLGMPKQPAPPHVCDAIVSELVARADE
FT                   HRSFCLYHARLNGGADVPASV"
FT   gene            283472..283762
FT                   /locus_tag="BMA10229_0296"
FT   CDS_pept        283472..283762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0296"
FT                   /product="phosphopantetheine attachment site domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00404"
FT                   /db_xref="GOA:A2RWQ1"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWQ1"
FT                   /protein_id="ABN00404.1"
FT                   /translation="MLDPASAHSASIELWLIERIACYLQRAPHEIRPDTPLDEIGLDSV
FT                   YALTLCGEIEEVLHLTVEPTIAWDYPTVAEIARELDARLAQRSAQGEAHAQ"
FT   gene            284197..285000
FT                   /locus_tag="BMA10229_0297"
FT   CDS_pept        284197..285000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99671"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWQ2"
FT                   /protein_id="ABM99671.1"
FT                   /translation="MHRIEEEAFSAESRAEPDAGAALRALGWMMFGMEDLRLCADERRE
FT                   LAQLARYAQTLPIDGFGGNGRHRCYAEAVLSPSARTLRWKPGIVGKDGTIEVEYEQETE
FT                   FQPEYGGVRRRFARASDRVLQSSLIRKLIWFDFDLIGWAGASEPLQCGFHLVRLQALPG
FT                   KPSRSTPDCLHRDGQPYTAVHLVSRHDVTGGLNYIAPPRYSGRNVDELPADALTTFTLT
FT                   EPLDSYIVDDAAVCHHVSAVGCAPGAASGSRTVMLIDFSPIPLSS"
FT   gene            285050..294433
FT                   /pseudo
FT                   /locus_tag="BMA10229_0298"
FT                   /note="thiotemplate mechanism natural product synthetase;
FT                   this gene contains a frame shift which may be the result of
FT                   a sequencing error; identified by similarity to GP:3510629;
FT                   match to protein family HMM PF00109; match to protein
FT                   family HMM PF00501; match to protein family HMM PF00550;
FT                   match to protein family HMM PF00668; match to protein
FT                   family HMM PF00698; match to protein family HMM PF02801;
FT                   match to protein family HMM TIGR01733"
FT   gene            294459..297005
FT                   /pseudo
FT                   /locus_tag="BMA10229_0299"
FT                   /note="putative polyketide synthase; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00106; match to
FT                   protein family HMM PF00550; match to protein family HMM
FT                   PF08659"
FT   gene            297071..297334
FT                   /locus_tag="BMA10229_0300"
FT   CDS_pept        297071..297334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0300"
FT                   /product="Transposase subfamily"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99583"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABM99583.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            297358..298191
FT                   /locus_tag="BMA10229_0301"
FT   CDS_pept        297358..298191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0301"
FT                   /product="IS1404 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99986"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABM99986.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            298213..298368
FT                   /pseudo
FT                   /locus_tag="BMA10229_0302"
FT                   /note="amino acid adenylation; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            complement(298413..299702)
FT                   /locus_tag="BMA10229_0303"
FT   CDS_pept        complement(298413..299702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0303"
FT                   /product="ISBma2, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00398"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWQ8"
FT                   /protein_id="ABN00398.1"
FT                   /translation="MVMFKLLFIGYLFGVRSERQLMREVQVNVAYRWFARFRLTDKVPD
FT                   ASTFSQNRRRRFTDTTVYQEIFDEIVRQAIKRGLVDGRVLYTDSTHLKANANKGKFDVV
FT                   KLEQTPAAYTEALNAAVDADRAAHGRKPLDRDDDEPPSSKDTKLSRTDPDSGYMVRDDK
FT                   PKGFFYLDHRTVDAKHAIITDTHVTPASVHDSQPYLDRLDRQRERFEFKVEAVGLDAGY
FT                   FTPAVCQGLEERGIAGVMGYRTPNHKPGMFYKRQFKYDAYRNEYVCPQGQALPYSTTNR
FT                   LGYREYKSNAQICGRCPVRSQCTNSAIAVKVVTRHVWERAKERVDARRLTEWGQRIYAR
FT                   RKQTVERSFADAKQLHGHRYARMRGLRKVAEQCLLAAAAQNIKKIAMLLARKRKKGPAG
FT                   PDWRFVRMLLRLVSGLRCSFDYPLAANPQS"
FT   gene            299677..300603
FT                   /pseudo
FT                   /locus_tag="BMA10229_0304"
FT                   /note="putative non-ribosomal peptide synthase; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00975"
FT   gene            300608..301897
FT                   /locus_tag="BMA10229_0305"
FT   CDS_pept        300608..301897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0305"
FT                   /product="multidrug resistance protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99745"
FT                   /db_xref="GOA:A2RWR0"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWR0"
FT                   /protein_id="ABM99745.1"
FT                   /translation="MDLHERTLDAPGAPAAAAHGAGSRLSREVWIILLTLAVDAVGLGV
FT                   ATPVLPDLLRAVGERPAHVPVMLGSLITCFYFMQFVFGPIVGALSDAWGRRPILLIALG
FT                   GGALSYAIGATARSYGGLLAAHMLAGIAASSAAVATAYLADVTPPALRARRFALASSVL
FT                   GLGLIAGPAFGGVLGALGPRVPFVAAGAIAALNFVSAACFLRESLPARRRVPVSWARAN
FT                   LFGSLRLVREDRVFRDLLAAVCLGMLAYGIYLSCFVLANAARLGWGPRENGLALAGLGL
FT                   GITLTQTLLLPRLVARLGEHRTALVGFGAFVLAYGLYSRADSVALVAAALAVHALSLIS
FT                   DPSVRSLISVHAGPQRQGEYQGALVCLTGLASSIAPLVGGNLFAFFTRAGASTYFPGAP
FT                   FLAAAVLYALAMLAVWRAMAGAARRRSASH"
FT   gene            301916..302122
FT                   /locus_tag="BMA10229_0306"
FT   CDS_pept        301916..302122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0306"
FT                   /product="mbtH-like protein"
FT                   /note="identified by match to protein family HMM PF03621"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00272"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWR1"
FT                   /protein_id="ABN00272.1"
FT                   /translation="MTHLLDDPDGSFQVLVNEEGQHSLWPAELPAPAGWRRTFGEAGRQ
FT                   ACLDHIEAEWTDLRPRSVAARCA"
FT   gene            302077..302205
FT                   /locus_tag="BMA10229_0307"
FT   CDS_pept        302077..302205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0307"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98543"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWR2"
FT                   /protein_id="ABM98543.1"
FT                   /translation="MDRSAPAQRRRPMRVSAAPFAIPGCAPSRPACSISTQDFASP"
FT   gene            302169..305417
FT                   /gene="dhbF"
FT                   /locus_tag="BMA10229_0308"
FT   CDS_pept        302169..305417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhbF"
FT                   /locus_tag="BMA10229_0308"
FT                   /product="nonribosomal peptide synthetase DhbF"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99602"
FT                   /db_xref="GOA:A2RWR3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWR3"
FT                   /protein_id="ABM99602.1"
FT                   /translation="MQHIDTGLRLAMNMRDTSLRPLLPAQREIWLAEQLRPGTGVYNTA
FT                   GYADIVGAVDHGALRDAFGHAMREADAVRATFSAHGDDAWQTPRDAPHADVPLVDVSGQ
FT                   ADPAGVALAWMMRDMRTPPDFAAGPLARSALLRVGAARFFWYVCAHHIVTDAYGTALVV
FT                   QRTAQLYGARVRGAAPPPAWFGTLDALIDEDRAYRESAAFADDRDYWRARLAAAPEPRS
FT                   LSPVALPGQFAPAGDFHRQWGELDAATSDGLRAMARAGAQGMPPLVAAMMAAYVHRFTH
FT                   ERDVVLGLPVMARLSRATRRTPGMVANVLPLRFAFDRGTTFAALHAQCAAEMRASLRHQ
FT                   RYRGEALLRDAQQSRPAERLHAQNVNVMAFERALAFGDCPARSHSLSNGPVDDFSITVY
FT                   DDGARQPIRIAFDANAAHYASGDLAAHRERFLRLGVALANAAQRPIADAQWLTPAERRT
FT                   LVGERGTPAPDAGVPFDTIAARFAARAAERPDAITLVDRGRRITYGELNARANRLAHVL
FT                   IEAGVGPEALVGLHMPRSAELVVGMLAILKAGGAYVPLDPAYPASRIEFMVADARPMLS
FT                   ITTGEHAAQLPARTPTIVLDAADAQAALRRAPAHDPVRPAPLDREHAAYVIYTSGSTGK
FT                   PKGAVVSHRNVIRLLDGTRGWFDFGAAHTWTLFHSFAFDFSVWECWGALLTGGRLVVVP
FT                   YDVSRSPAEFLKLLVDERVTVLNQTPSAFRQLMQADEAHADLSARLALRYVVFGGEALD
FT                   ARSLARWYERHADTAPRLVNMYGITETTVHVSYLALSRAIAGMPANSLIGRPLPDLRVY
FT                   VLDAALRPVPAGVPGEMYVAGAGLARGYLRRPSLTAQRFIADPFGPPGTRMYRTGDVAR
FT                   WRADGGLDFIGRADEQVKVRGFRVELGEIAARLACDPSVAQAQAVVRQDGPAHERLVAY
FT                   VVPRAGATIDVCALRASLAAEMPEYMVPAAIVALDAMPLTPNGKLDRAALPAPIVTGTS
FT                   RRAPENRIEQQVCAMFAELLDAQTLGAEDNFFELGGDSLLAMRAINKLRQTFDVELTIR
FT                   DLFSAPTVAALSMRLDAQLAARRAHADGAELPAG"
FT   gene            complement(305703..306491)
FT                   /locus_tag="BMA10229_0309"
FT   CDS_pept        complement(305703..306491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00053"
FT                   /db_xref="InterPro:IPR021549"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWR4"
FT                   /protein_id="ABN00053.1"
FT                   /translation="MSVVDDVAARAQHTLDAWRERGADRLDPVRFRFIDALRRRAAARG
FT                   GDARRLLDARLAALIDAYAADLRRAESNGDACECAGAPAPAPASSTSPAPTPAAPSTTT
FT                   TSPAASSPAEPARGPLAALLDYIGSRERPTASAPDETRAAPASPTASGRVALRAEPELL
FT                   DYFRETWSKLSADSQLRASLEQVPKNAGPLNSSSLVHRSLSLMRELSPEYLRQFLSYVD
FT                   ALSWLQQMNGDEAATGDEAARGAVGGGGASAKKNTRKRSR"
FT   gene            complement(306475..307122)
FT                   /locus_tag="BMA10229_0310"
FT   CDS_pept        complement(306475..307122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0310"
FT                   /product="ompA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00517"
FT                   /db_xref="GOA:A2RWR5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWR5"
FT                   /protein_id="ABN00517.1"
FT                   /translation="MSDEIDGGIEQTAPIWAAFGDLMSVLLGAFVLILVGVIGVQLELS
FT                   SKLDAEVRQRQLESQRRKTLEQALAAPLAAGRVTLVNGRIGISGSVLFALNSDELQPAG
FT                   RDLLKSLAGPLAAYLNANHEILMVSGFADDLQVRAGNRRFADNWELSAKRALTVTRAFI
FT                   DEGVPASSVFAAAFGSEQPVSPNSNDAGRAKNRRVEIAPVPRPTTGDGERRG"
FT   gene            complement(307119..310175)
FT                   /locus_tag="BMA10229_0311"
FT   CDS_pept        complement(307119..310175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05650"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98790"
FT                   /db_xref="GOA:A2RWR6"
FT                   /db_xref="InterPro:IPR008520"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWR6"
FT                   /protein_id="ABM98790.1"
FT                   /translation="MSRFHVHLVVFFAGLAAVCWIGAGYAVSNPVALAVTLVIAACYLA
FT                   GALELRRYRQATSTLAQAVAALSEPPAALGAWLERLHPSLRHAVRVRVEGERVALPGPA
FT                   LTPYLVGLLVLLGMLGTLIGMVMTLRGTGAALESSTDLQAIRASLAAPVKGLGFAFGTS
FT                   IAGVATSAMLGLLSALCRRERLDAAQALDAKIATTLRVHSHAHQRDETFRLLQRQADLM
FT                   PTLVERLQAMMHSLEQQSAASAERQIAGQQAFLGKAEETYARLASSVGQSLTDSVAESA
FT                   RVAGSALQPVMETTMAGLARETAALHDALTQAVQRQLDGLSAGFETTAAQVADVWRHAL
FT                   ADHQRSSDALAQRLHGSIDRIVESFDRRSADLLDGVRARLDATASSVSDAWRGALAQQE
FT                   QANEAHAERNRQALETAAATFERHSAALLRTMSESHSALQATLESRDEQRLATWTDSLG
FT                   SIAAKLGTEWAQTSAQAANRQQTICDALAHTARDLSAQATAFEQHTAALLRAMSESHSA
FT                   LQATLESRDEQRLATWTDSLGSIAAKLGTEWAQTSAQAANRQQAICDALAHTARDLSAQ
FT                   ATAFEQHTAALLRAMSESHSALQATLESRDEQRLATWTDSLGSIAAKLGTEWEQTSAQA
FT                   ANRQQAIYDALAHTARDLSAQATAFEQHTAALLRAMSESHSALQATLESRDEQRLATWT
FT                   DSLGSIAAKLGTEWEQTSAQAANRQQAIYDALAHTARDLSAQATAFEQHTAALLRAMSE
FT                   SHSALQATLESRDEQRLATWTDSLGSIAAKLGTEWEQTSAQAANRQQAIYDALAHTARD
FT                   LSAHTQAHASATIAEISQLVQAASEAPRVAAEVVAELRQKLSDSMVRDTAMLEERNRML
FT                   APLETLLDAVNHASSEQRAAVDALVATSSALLQRVGTQFTDEVGTQTDRLGGVAAQITG
FT                   SAVEIASLGDALGAAVQSFGESNDKLVAHLQRIEAALDKSLARSDEQLAYYVAQAREVI
FT                   DLSMMSQKQIIEELQRVGGERASAGAAAA"
FT   gene            complement(310186..311157)
FT                   /locus_tag="BMA10229_0312"
FT   CDS_pept        complement(310186..311157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99910"
FT                   /db_xref="InterPro:IPR021783"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWR7"
FT                   /protein_id="ABM99910.1"
FT                   /translation="MLGRAVAAPRSLADAPPATPERAPIPSSRIAPKPPVARSTSRTPA
FT                   HASPTCKLLPFFDIDTRRMMQVPQRSALGGPTLIRLLARLAHADVPPSGQSLSDRLSQW
FT                   LAWTDAIALSSALSMSPPAAAAGARPAGDDPHGQGARVRASLAKAIARTGAFAAGRDGA
FT                   ARVAARGAPHDTPADFTLFRHDYLSMQQAMEIDIGELRGRLRQTMAAQTPALARLAALD
FT                   ATMERALVARERSLFASVPKLLGAYFERLREAEQQCLAEAEAKAHANAEADAHAEVARK
FT                   TAAPAPHAWLDAFRQDMQSVLLAELDIRFQPVDGLLAALRAS"
FT   gene            311232..311564
FT                   /locus_tag="BMA10229_0313"
FT   CDS_pept        311232..311564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00045"
FT                   /db_xref="InterPro:IPR016755"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWR8"
FT                   /protein_id="ABN00045.1"
FT                   /translation="MIQPTEVFKDNLAQLPAIDGIERIDLVDGGGAVVASIENKPGKQG
FT                   SLAVYHYLREAFGTLDAQAAAHGLAVFAEHTADARNRPGAHPNVDRLLAIAAGGEALRI
FT                   DVLARG"
FT   gene            complement(311806..313869)
FT                   /locus_tag="BMA10229_0314"
FT   CDS_pept        complement(311806..313869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00035"
FT                   /db_xref="GOA:A2RWR9"
FT                   /db_xref="InterPro:IPR019503"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2RWR9"
FT                   /protein_id="ABN00035.2"
FT                   /translation="MGNGERPPARRPDSSGSPPPAADAPAASNHPFSSHDTKHMTSRRL
FT                   ASRTAVAASLSALMLAACGGDDSANAPTAGGAAPLTPAVASPAGPTGSTPGSTPGATTA
FT                   PAPSSTSAGQLSVDKMAFAQTHVVPSGGLSWTLPNASASLRPISRRDALVLVAIGQADA
FT                   VQPVLEAWKDGAKLGALALSPPSALPPTESGGRAYANDRWSAVVPAAWMVPGVSFSVSA
FT                   SNYTSSVAQAPVFGTDADVQLTILPFYLFGADDTNSPPLSTTQAPDAATQQEIFAKWPT
FT                   AELKVRTHPAGRFSLATVVVGPRADRTGAAQPAYPVTALDQQKDGYGVMSAMLTLITNM
FT                   RTANGDGPLNDQYYAPLIALNSNGQFANLGGGLGGVGSGAAVGDHRYTGIFIHEQGHAF
FT                   GLNHAGDEYAKGAYPYAGGSLSGSVWGYDPNHREFLDVLVPTTASSYAKCASSHQLDAQ
FT                   GRCYKQDPMQGGAGDQSSGYKFATFSDYNTGRMQAWIASRVLADPASSTGYSKWDSAAQ
FT                   ARAPYTPTTDNNGLYGVNQNLPVQAGVPVHTIVVSFSKAGSAGASYIYPPFSYTGNLIA
FT                   TFDPTSAADRQAITVDKGTYPWYCKGTGCDYTLRVTYADGSRTYRVLQGGFRAWWTPTV
FT                   YDANATNPLSGSSFRVWAINVPGDKRIGKIELLDTPMVWNGMPANPTVLLSR"
FT   gene            314291..314557
FT                   /locus_tag="BMA10229_0315"
FT   CDS_pept        314291..314557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0315"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00503"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWS0"
FT                   /protein_id="ABN00503.1"
FT                   /translation="MRRPIGSAWWRAEIECAGRADPAGGSHRAPLAVAGAMRGIMRTAC
FT                   RRSAGSGQCCENRHAGLVLRAGRRVRVPPDAYAIAQTLPSSAR"
FT   gene            314865..315026
FT                   /pseudo
FT                   /locus_tag="BMA10229_0316"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            315061..316602
FT                   /locus_tag="BMA10229_0317"
FT   CDS_pept        315061..316602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0317"
FT                   /product="alcohol dehydrogenase, iron-containing"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99243"
FT                   /db_xref="GOA:A2RWS2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWS2"
FT                   /protein_id="ABM99243.1"
FT                   /translation="MRCDACSGATRGGIEIGLADGPLARTSRSRRASCCCGDALRALPR
FT                   RSERGSGTCSAAATALETARATTLQWRMRRRGAVARPRRREDGGKGSAAYEAARSKSRK
FT                   ARRAWACLILGSILDDWSTFDGANMLNFDFYNPTRIVFGEKTAARLNDLLPAAARVLVL
FT                   YGGESARSNGTLDEVRAALGARDVREFGGIEPNPAYETLMRAVELARRERVDFLLAVGG
FT                   GSVIDGTKFVAAAVPFEGDPWTILETHGANVAAALPFGCVLTLPATGSEMNNGAVLTRR
FT                   ATRAKLAFRHPLVFPTFSILDPTKTYTLPPRQVANGVVDAFTHIVEQYLTYPADGLAQD
FT                   RFAEGLLQTLIEIGPKALAEPRDYATRANLMWVATLALNGLIGAGVPQDWATHMVGHEL
FT                   TARYDIDHARTLAVVLPSMLDARRDAKRAKLLQYAARVWNIVDGPEDARIDAAIARTRA
FT                   FFESLGVKTRLADYGVGADAIDGLIAQLEAHGMTRLGERKDVTLDVSRRVLEASL"
FT   gene            316667..317704
FT                   /locus_tag="BMA10229_0318"
FT   CDS_pept        316667..317704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0318"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00287"
FT                   /db_xref="GOA:A2RWS3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWS3"
FT                   /protein_id="ABN00287.1"
FT                   /translation="MPQTKTTNRRIVLHSRPKGAPTPENFRTETAAVPVPAPGEVLLRT
FT                   IWLSLDPYMRGRMSDAPSYAAPVELGGVMVGGTVSRVVSSSVPAFRDGDLVLSNAGWQD
FT                   YAVSDGTDLMPLADVAHPSYALGVLGMPGFTAYFGLLHIGEPKAGETVAVAAASGAVGA
FT                   VVGQIAKLKGCRVVGIAGGADKCRYVAGTLGFDACVDHHDPDFAKQLAAACPDGIDVYF
FT                   ENVGGAVFDAVLPLLNDHARVPVCGLIAHYNDSELPGGPNRLPLLTSSVLRKRIRMQGF
FT                   IILDHYADVYPAFLKDMSEWVAQGKVKPREDVVDGLDAAPRALIGLLGGKNFGKVVVRV
FT                   GPDTL"
FT   gene            complement(318338..318586)
FT                   /locus_tag="BMA10229_0319"
FT   CDS_pept        complement(318338..318586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0319"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99378"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWS4"
FT                   /protein_id="ABM99378.1"
FT                   /translation="MFARRASAAEHSPPTPVRQGDRAASLGRRADAQTLGGRADHAARH
FT                   SSFQKAIMQNPPNSSGSFDFIFYESALAVDSPNQARG"
FT   gene            318743..320161
FT                   /locus_tag="BMA10229_0320"
FT   CDS_pept        318743..320161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0320"
FT                   /product="CoA transferase, CAIB/BAIF family"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00021"
FT                   /db_xref="GOA:A2RWS5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWS5"
FT                   /protein_id="ABN00021.1"
FT                   /translation="MFDLAASSHTEPSGHARAAAYLRDIWQAANGDPEWLRTLAFGGAG
FT                   VLPSAFPVTDFASAAIGAASVALAEFVHRATGRLPGVRVDRRYASIWFGTSLRPRGWNM
FT                   PPLWDAIAGDYRTADGWIRLHTNAPHHRAAALAVLGAPPERQAVARAVGQWRGDALESA
FT                   VVEHGGCAAVMRTEDEWARHPQGRAVRAEPLMIHDDVSIDGPRPAWPMSAERPLRGVRV
FT                   LDLTRILAGPVATRFLAGFGAQVLRIDPIGWDEPGTVPEVVLGKRCARANLACADGRAL
FT                   LRRLIGEADVMVHGYRPGALDRLGFDADERRRINPGLVDVSLDAYGWSGPWRGRRGFDS
FT                   LVQTSAGIAAAGMREAGADRPVPLPVQALDHGTGYLLAAAAIRGLVRRLATGAGTSTRA
FT                   SLARTAVLLTSGGLQEAGRQPIAPETAGDLDAWIEDTSWGPAQRVRAPVTIECAPVQWP
FT                   HPARALGTSPAEWA"
FT   gene            320362..320511
FT                   /locus_tag="BMA10229_0322"
FT   CDS_pept        320362..320511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00508"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWS6"
FT                   /protein_id="ABN00508.1"
FT                   /translation="MLGSHGDATRRTSARRVASRPPVTRAAARHRAPPRPLKRARRSRA
FT                   APAR"
FT   gene            complement(320471..321214)
FT                   /locus_tag="BMA10229_0321"
FT   CDS_pept        complement(320471..321214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0321"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00518"
FT                   /db_xref="GOA:A2RWS7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWS7"
FT                   /protein_id="ABN00518.1"
FT                   /translation="MNATPLTRVALVTGASRGIGAAVARRLARDGFSVAVNYASSGAEA
FT                   DALVAELRAGGAAALAVRADIGRADDVRRMFDAVERQLGRVDVLVNNAGILKTGPLADA
FT                   TDDAFDRIFDINVRGTFNTLREAAKRLADGGRIINFSSTTLALKLPGYGLYNATKGAVE
FT                   ALSHVFAKELRGRRVSVNVVAPGPVATSLFLEGKTDEQIQGYAKMPPLERLGEPEDIAG
FT                   VVSFLAGPDGGWVNAQVLRANGGLA"
FT   gene            321338..322393
FT                   /locus_tag="BMA10229_0323"
FT   CDS_pept        321338..322393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0323"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00366"
FT                   /db_xref="GOA:A2RWS8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWS8"
FT                   /protein_id="ABN00366.1"
FT                   /translation="MDRFQEMQVFVRIAERQSFSRASDDLRIPRATVTNLMKRMEARLG
FT                   ARLLERTTRTVCLTQDGEAYYRRCVRLIADLEEAEGAFRAAAPRGLLRVNLQGTLARYF
FT                   VVPALPDFLARYPGIRLHIGEDDRFVDLVREGVDCVLRSGNLQDSSMVGRRVAQLEQVT
FT                   VASPGYLARHGEPAELAALAAHRAVDYVSSATGKPMPLEFTVDGRVTEVRLDAAISVAG
FT                   VELYTGAAVAGLGIVQVPRYRIADELADGRLRIVLGAYPPPPMPVSVLYPHSRQLSSRV
FT                   RAFAQWLRERFDAAQAGRATARAARRALRVPPRARRRRLGRNRRKRCYRGGRVARFVFV
FT                   VANTPDAGGTR"
FT   gene            322390..322812
FT                   /pseudo
FT                   /locus_tag="BMA10229_0324"
FT                   /note="aspartate racemase; this gene contains a frame shift
FT                   which may be the result of a sequencing error"
FT   gene            complement(322957..323790)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0325"
FT                   /note="transcriptional regulator, LysR family; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT   gene            324037..325410
FT                   /locus_tag="BMA10229_0326"
FT   CDS_pept        324037..325410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0326"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99220"
FT                   /db_xref="GOA:A2RWT1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWT1"
FT                   /protein_id="ABM99220.1"
FT                   /translation="MPNPDDSAGADIRVRRNALTRGIPPSPPARQPRRAAGAAFVGTMI
FT                   EWYDFYIYANAAALVFGELFFPSHDPFTSTMASFATFAVGFFARPLGGLFFGHLGDRIG
FT                   RKKALMATLALMGAATVCVGLLPTYERVGLLAPVLLVLLRIVQGIAVGGEWGGAVLMAG
FT                   EHAPYGRRTFFASFAQLGSPAGLILSLVAFRAVASMEHGAFMSWGWRLPFLASIALLAV
FT                   GVFVRLKVDESPEFAHEKAMSRTVARPLAEALRTSRAMLLFCLCANTIGIAGLYFTNTF
FT                   MIAFTTQHVGVTKSLILDCLFIVAIIQFVTQPIAAWLGGKLGDARFLKLAALFAMASPY
FT                   PMFALVQTGRLAPMVIGIAIATVFLAGFYSVIAGFVSGAFPTRVRYSAISISYQMCGAI
FT                   AGGLTPLVGTWLAHRFAGQWWPLAVFYTCLAALSLGGVIALDARRHRRADVADAVLTR"
FT   gene            325435..326814
FT                   /gene="amaB-2"
FT                   /locus_tag="BMA10229_0327"
FT   CDS_pept        325435..326814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amaB-2"
FT                   /locus_tag="BMA10229_0327"
FT                   /product="N-carbamyl-L-amino acid amidohydrolase"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01879"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99729"
FT                   /db_xref="GOA:A2RWT2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWT2"
FT                   /protein_id="ABM99729.1"
FT                   /translation="MWEIDGRRLWNSLTELARIGGTARGGVRRLALTEADRRGRERFAQ
FT                   WCRDAGMAVRVDAIGNLFARRAGADDTQPAVLVGSHLDTQPEGGRFDGAYGVLAGLELV
FT                   RTLNDRGIVTGKPIEIVSWTNEEGARFTPAMLGSAVFTGALPLDAALAARDADDIALAE
FT                   ALEACGYRDALRSAWMRGAHGARGLEPALAPLHERVDAYFEAHIEQGPVLERHGATIGV
FT                   VTGGQAIRWLDATVTGAAAHAGTTPMPYRKDALFASAELALAIEALVARHAPDALATIG
FT                   QSAIDNASRNTIAERVTFSIDLRHPDDARLDAIERELRRVCAQIAGRRGVAVDISRHWS
FT                   SPATPFDPACIALVEAAARGGGYAHERIVSGAGHDAVHLARCVPSAMVFIPCVGGLSHN
FT                   AAERALPEHVEAGANVLLGAVLARAGVRERAARSARSPRPAPAMQAAHSGTDAGTFAQP
FT                   H"
FT   gene            326845..327867
FT                   /locus_tag="BMA10229_0328"
FT   CDS_pept        326845..327867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0328"
FT                   /product="putative acetylpolyamine aminohydrolase"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00347"
FT                   /db_xref="GOA:A2RWT3"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWT3"
FT                   /protein_id="ABN00347.1"
FT                   /translation="MLTYFHPDQLKHSPLTYLSRGKMRAPHEVPERAVRLLGAVTSLGF
FT                   DVRAPEDFGAAPLAAVHSEPYLRFLADAHREWRRIPEDWGPEVMSNIYVREPNPLRGVL
FT                   AQAGYYLADGSCPIGEHTYRAAYWSAQSALAGAAALGRGARDAYALCRPPGHHACRDAA
FT                   GGFCYLNNAAIAAQALRARHARVAILDTDMHHGQGIQTLFYDRDDVLYVSIHGDPTNFY
FT                   PAVTGYETERGAGRGEGCNVNLPMPHGSPEAVFFAQLERARSRVERFAPDVLVFALGFD
FT                   VYREDPQSKVAVTTEGFGRLGALVGGLRVPTLIVQEGGYHLETLERNAAALFRSYEAAR
FT                   "
FT   gene            complement(328411..330942)
FT                   /locus_tag="BMA10229_0329"
FT   CDS_pept        complement(328411..330942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0329"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99299"
FT                   /db_xref="GOA:A2RWT4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWT4"
FT                   /protein_id="ABM99299.1"
FT                   /translation="MRRRATGSRRTRQARCASARRASSAFHPARIRPQRQRLNRPGRRR
FT                   LRARRAHGNHRALPHRHAPAHRDPASIRPSRTEHPDSSVIAQCFRRPATPVHRAHRHNF
FT                   PCPRANGGDMQTRLDTRKVFTYLFAFFIAFLASCSDHDDISGGGEPPASALAFRLDRGG
FT                   QINAFYRQDKIAAHLLMRASTKPRLLVVFPAGNSGTGLWFGDTPQPVNWSQDTPIAPVT
FT                   TQDAAGRPLYGIGVDVSADVSSLSIRQALLSSVRFLRDYNGGATVPSDIVVQPSVSDNV
FT                   ATWQRNRVDGAPGYALRVTVLDGGTVAADGTGRLMLQSPSGAPTLRLRVEAFSGETPLQ
FT                   PITHANLFTSAVNPDPQSQNVFEFLSFSDKLLAGSWQYDTYFGRDTLISVRMLMPVLQP
FT                   DVIEAGLGSVLDRLSPDGKVAHEEGIGEFALIDNLKHGRPNDPTPTYDYKMIDGDYLLA
FT                   PIMEDWLIEDPRGQARAAAYLAQKGDDGVTNGSRFVANLLRVARTAQPFAQQALAANLI
FT                   HLRPGEIVGNWRDSTDGIGGGVYPYDVNVALVPAALRATSNFLARGLLDPYLSADQRAV
FT                   LASAGAAADVWERAAPPYFQVAVTPNDARAKLAAYAPQAGVPAGMVPNTALQFDAIALD
FT                   ANGNPIPIMHSDGGFVLLFGNPSPALLARIVTDVMRPFPVGLVTDVGMLIANPAYADPT
FT                   LWPRFTSSAYHGTVIWSWQQAMWVAGLDRQLARTDLPGDVRTLLTQARQQIWQVIANAK
FT                   DMRLTEMWSWSYANGQYRTEAFGTRSTDVTEANAAQLWSTTYLAVRDPQLRAGKYWWEA
FT                   RAAGGDAPRRGSTAAAENAANGLNAVKGAAS"
FT   gene            complement(331090..331869)
FT                   /locus_tag="BMA10229_0330"
FT   CDS_pept        complement(331090..331869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0330"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99954"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWT5"
FT                   /protein_id="ABM99954.1"
FT                   /translation="MRARARTSLQSRAWHRRSISAIDRMNRSPSTCRPNAALKSKAPLP
FT                   KRLRRCRPHGVHTFDSPANDRAARCASISPVARFAASRCERRAQARSRRFARSATKRIA
FT                   DGGATGVPASDRWSPTAPSFACAFKARASRAQSKQARRRAERATASRARGHRRERRARA
FT                   PFSDAEPTTSRRSRALFPSPAARYAAREAASPDSRPSAARRAVRARSHGPSPHGRMTKD
FT                   SGMIDPHDAPRPTSGAPTIHSDRITQFASPIRRRAPH"
FT   gene            332168..332800
FT                   /locus_tag="BMA10229_0331"
FT   CDS_pept        332168..332800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0331"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00571"
FT                   /db_xref="GOA:A2RWT6"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWT6"
FT                   /protein_id="ABN00571.1"
FT                   /translation="MHQTGNERACGAHDQPHAEIRRVRRFDPIAFEAAVRALLEASGIE
FT                   IDSAHTGRTAQRVRELWQRRLLDGYEVDPAQALGAGFDDPREDMVIVRSIAVHGVCPHH
FT                   LLPFRGVAHVAYLPGGRLHGFGRIARMIDAISHRYTYQEWITHRIATALVTHGQARGAA
FT                   CLIEAEQLCLLMGENRRGDERVITQCYAGEFERDVQARNEFLRGIHR"
FT   gene            complement(333070..334131)
FT                   /locus_tag="BMA10229_0332"
FT   CDS_pept        complement(333070..334131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0332"
FT                   /product="putative regulatory protein NasS"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99962"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWT7"
FT                   /protein_id="ABM99962.1"
FT                   /translation="MNTARIKAAAADMPERARLRIGFVALSDAAPLVAAQRLELGARYG
FT                   LTLELCRQPSWASIRDKLLSGELDAAHALYGLVYGVQLGIGGPRADLAVPMVLNRNGQA
FT                   ITFSNRLADAYRASGELKAALATLGRRPVFAQTFPTGTHAMWLYHWLASHGVDPLRDVR
FT                   SVVIPPPEMVDALAAGELDGLCVGEPWNAVAEARGAGRTVAATSEVWPDHPEKALACRR
FT                   EFVALYPNAARLLVRTLLDACAWLDDPAHRMQAARWLAQPDTIGVPVEQIAPRLLGDYG
FT                   AGPFAQPPAPIRFHAHGTANRPAASDGLWFLSQYRRWGMLSGDVDDAAIANGVAHTALY
FT                   DEAVALGGARRGE"
FT   gene            complement(334149..334745)
FT                   /gene="nasT"
FT                   /locus_tag="BMA10229_0333"
FT   CDS_pept        complement(334149..334745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasT"
FT                   /locus_tag="BMA10229_0333"
FT                   /product="response regulator NasT"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF03861"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99505"
FT                   /db_xref="GOA:A2RWT8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWT8"
FT                   /protein_id="ABM99505.1"
FT                   /translation="MGTTDQPSKLRVLLVTDTDKPIGELRDTLARLGYEMLDEVATPAR
FT                   LPAAVEEQRPDVVIIDTESPSRDTLEQLAVMNATAPRPVLMFSHDADQQLIRAAVGAGV
FT                   SAYLIEGLSAERLAPILEVALARFSHDEQLRQRLAEVESELAERKLIDRAKRMLMDRRK
FT                   LSEQDAYATLRRSAMDQGIRIVEAARRLLAAHSQS"
FT   gene            complement(334847..335869)
FT                   /gene="cobA-2"
FT                   /locus_tag="BMA10229_0334"
FT   CDS_pept        complement(334847..335869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA-2"
FT                   /locus_tag="BMA10229_0334"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR01469"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99282"
FT                   /db_xref="GOA:A2RWT9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWT9"
FT                   /protein_id="ABM99282.1"
FT                   /translation="MCSVIGNGAGAASQDSFRAVRRRAAPLDNGVPRVRPPRRPGAPDA
FT                   VLFWRGAFAANAPHARHGNTKMNTMGKVTLLGAGPGDLDLLTMKAAKALAAADVLLLDD
FT                   LVDPGIVALAPRARVIRVGKRGGCRSTPQAFIERLMCRYALRGAHVVRVKGGDVLLFGR
FT                   AGEELAALRAARVPVEIVNGISSGFAAAASLGVSLTHRDHCQGVTFVTAHLQDHGEPDW
FT                   ASLAATGTTLAIYMGMSRIERIAAGLLSTLDDKTPAAVVQWAGAPAERRWTGTLGHLAS
FT                   GAAEAGLGSPAVIFVGRAIGEALAIGDAHAAPHANAHALADDAHAALHAAERRRISHAA
FT                   "
FT   gene            335828..336052
FT                   /locus_tag="BMA10229_0336"
FT   CDS_pept        335828..336052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0336"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00401"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWU0"
FT                   /protein_id="ABN00401.1"
FT                   /translation="MRCGTGAVADDAAHRAISGPACGARWATRGDGGRRAPSRAGVPAR
FT                   RACATRAWRASRVRRPRRADSRSADRLIG"
FT   gene            complement(336029..336382)
FT                   /locus_tag="BMA10229_0335"
FT   CDS_pept        complement(336029..336382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0335"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99877"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWU1"
FT                   /protein_id="ABM99877.1"
FT                   /translation="MCVRQGGAWPVRRGGRPGRRRACPGACIPGARIDSHIDSRIDPHR
FT                   GRDAARRRLSRAARPGRRATHRVHARAHAARVTPEHAARAEPEPTRITAPLARRRAPLA
FT                   APPAGRSADQPIG"
FT   gene            336666..337991
FT                   /locus_tag="BMA10229_0337"
FT   CDS_pept        336666..337991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0337"
FT                   /product="putative nitrate transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98686"
FT                   /db_xref="GOA:A2RWU2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWU2"
FT                   /protein_id="ABM98686.1"
FT                   /translation="MSDKATRIELLDWRTVPMRAFHLTWIAFFVCFFAWFACAPLMPLI
FT                   AREFRLSADQVANVNIAAVAATIAVRLVVGPLCDRFGPRRVYAGLLACGAIPVFAVTLS
FT                   HDYLTFLLCRLGIGAIGASFVITQYHTSVMFAPNVVGTANAAAAGWGNAGAGAAQAAMP
FT                   LVVAAALLLGLPDACAWRAALAVPGAAMLVMAIVYWRGTQDCPQGDFVALRARGVTIDS
FT                   GKKGGFASFAAACGNYRVWMLFVTYGACFGVEVFMHNIAALYYVNHFALSLKDAGLAAG
FT                   IFGLLALFARALGGWLSDRVAARRGLDVRATLLFALILGEGLGLLWFAHAGSVPVALVA
FT                   MVAFGLFTHMACGATYALVPFIDRRALGGVAGIIGAGGNAGAVAAGFLMKGVGDIQQTL
FT                   TLLGLFVTVSAFCALAVRFSSEHKAREAALRERALAASGFTH"
FT   gene            338035..340590
FT                   /gene="nirB-2"
FT                   /locus_tag="BMA10229_0338"
FT   CDS_pept        338035..340590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB-2"
FT                   /locus_tag="BMA10229_0338"
FT                   /product="nitrite reductase [NAD(P)H], large subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01077; match to protein
FT                   family HMM PF03460; match to protein family HMM PF04324;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR02374"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99432"
FT                   /db_xref="GOA:A2RWU3"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWU3"
FT                   /protein_id="ABM99432.1"
FT                   /translation="MKIVVIGHGMVGHKLLECIAAGAPGALAAPRVAVVCEEPRPAYDR
FT                   VHLSEFFAGKSADDLSLVEPGFFERHPNFRLLLNTKAVAIDRAARTVALSTGETLAYDK
FT                   LVLATGSTPFVPNVPGRERAGCFVYRTIEDLEAMRACGARANSGVVVGGGLLGLECAKA
FT                   LRDMGLAAHVVEFAPRLMAVQVDEGGGRMLREKIEALGVQVHTGKNTLEIVDGETGAHR
FT                   MAFADGTHLDADMIVFSVGIRPRDEIARACGLEIGPRGGVAIDERCRTSDEDIYAIGEC
FT                   AAWNGQTFGLVAPGYDMARVVARQLAGGEGAFAGADLSTKLKLMGVDVASIGDAHGRTP
FT                   GSRAYQFADERRGVYKKLVVSECGKALLGAVMVGDAADYGTLLQMMLNRIELPRSPEFL
FT                   ILPQADGAAKPALGVDALPDAAQICSCNNVTKAQLREAVAGGATSLGALKGCTGAGTSC
FT                   GGCVPLVTQVLKAEMKKQGLAVNNHLCEHFPYSRQELYHMVRVERFKTFGALLKKHGRG
FT                   LGCDVCKPAVAGILASCWNEFVLKKEHAALQDSNDYYLANIQRDGTYSVVPRMPGGEVT
FT                   PEGLIAVGEVARKYGLYTKITGGQRVDLFGARVEQLPLIWEELIAAGFESGHAYGKSVR
FT                   TVKSCVGSTWCRYGVGDSVGLAIELENRYKGLRAPHKLKFGVSGCTRECAEAQGKDIGV
FT                   IATEKGWNLYVCGNGGMKPRHAELLAADLDRATLVRYVDRFLMFYIRTADRLQRTSVWR
FT                   DNLEGGLDYLIDVVVHDKLGLAAELEAEMQHVVDTYECEWKRAVTDPATRRRFRHFINS
FT                   DAPDSTIAFVEARGQIRPVTPDERDAEGQADRQPETETA"
FT   gene            340628..340978
FT                   /gene="nirD-2"
FT                   /locus_tag="BMA10229_0339"
FT   CDS_pept        340628..340978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD-2"
FT                   /locus_tag="BMA10229_0339"
FT                   /product="nitrite reductase [NAD(P)H], small subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM TIGR02378"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99922"
FT                   /db_xref="GOA:A2RWU4"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWU4"
FT                   /protein_id="ABM99922.1"
FT                   /translation="MNRQPQASAWTPVCALDEIVPNTGVCALVNGEQIAVFHVDDGGGG
FT                   RAFAIGNVDPHSQAAVLSRGLIGSLGERIVVASPLYKHHFDLRTGECVEAPEKSVSAYP
FT                   SRVEDGYVWVAA"
FT   gene            341022..345278
FT                   /locus_tag="BMA10229_0340"
FT   CDS_pept        341022..345278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0340"
FT                   /product="putative sulfite reductase [NADPH] flavoprotein,
FT                   alpha-component"
FT                   /note="identified by match to protein family HMM PF00175;
FT                   match to protein family HMM PF00258; match to protein
FT                   family HMM PF00384; match to protein family HMM PF00667;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM PF04879"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98513"
FT                   /db_xref="GOA:A2RWU5"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWU5"
FT                   /protein_id="ABM98513.1"
FT                   /translation="MTSASVKTVCPYCGVGCGMVLHVEDGEVVKVSGDAEHPTNLGRLC
FT                   TKGSSAHVALRNAGRLERAFVRDARELDPAPVPIADAIAETARRLRATLDAHGPDALAF
FT                   YVSGQMSLEAQYLVNKLAKGYVRTPHIESNSRLCMASAGSGYKLSLGADGPPGSYQDFE
FT                   RADLFFVIGSNMADCHPILFLRMMERVKAGAKLVVVDPRRTATAQKADLFLKIRPGTDL
FT                   ALLNGLLHLLHANGRTDADFIAAHTEGWDAMPGFLADYTPQRVAALTGLAEADIRLAAQ
FT                   WIGDAREWTSCWTMGLNQSTHGTWNTNAICNLHLATGKICRPGSGPFSLTGQPNAMGGR
FT                   EMGYMGPGLPGQRSALDGDDRRFVEEIWGLPAGTIRPDAGGGTVDLFARMAAGDVKACW
FT                   IICTNPVATVANRKNVITGLQAADVVIVQDAFLDTETNRYADILLPGALWAEAEGVMIN
FT                   SERNLTLMRQALEPPGDAWPDWRIVAAVARGMGYGDAFDYGSAAEVFDEIRRFANPNTG
FT                   YDLRGASHAALRATPLQWPCPPEDGRDRHPIRYLNDGASRPRVTLPDGRVPPLAFPTPS
FT                   GKARFFARSHVAPAEMPTPEFPIVLNTGRLQHQWHTMTKTGKVAMLNKLDARPFVEIHP
FT                   DDAAALSIAANDAVEIRSARGRAVLPAVVTDRVQPGACFAPMHWNDVYGDDLCVNAVTN
FT                   DAVDPVSLQPELKFCAVALARVDAPDSADAGAHAGAHAAPLHETGSREAQAQAAPRAHE
FT                   AACADAAPEEHDMSDIDTFAALLGVPAATSAPQLTDAQRVYVAGFVSGLRSAEGRRAGG
FT                   VPMLPASAPFDAKARLWLDGLLAGLFSRAPLGATARVDARAAAAAAVPAPSGAADAVSA
FT                   PSGVRIVRTRPKVVLLWASQTGNVESLTERYATQLMDSGFEIRVACMSDYPAASLAKAQ
FT                   YALLMTSTFGDGDAPDNGQAFWTALAAAGAPRADGLRYAVLAFGDRNYDPFCGHGRRLD
FT                   ARLAELGATRLVERVDCDAEFQPAADAWLERAIARIKEEDAALHAVPADGMIPSGAIPT
FT                   KTRPAASRLVANLRLNEPGAAKDTRCVSLSTDGAAIEYETGDALGVWPTNCPELVDELL
FT                   ALTRLKPDAPVTVAGMGELRLADALAKHLDITRPHPDALAFVASRSRAGDALARLLGDD
FT                   RKTDLKHWLWGQQLADVLHEFPLELSAAELVGMLKRLQPRLYSIASSPSAHRGEIHLTV
FT                   SAVRYGNGRRQRKGVASTFLADRAADAPVPVFVQKSAHFRPPASGDAPIVMVGPGTGIA
FT                   PFRGFLHERRARGAKGRNWLFFGEQHADTDFYYRDELAQMRADGFLTRLDVAFSRDQTE
FT                   KVYVQDRMLEQGAALWAWLEEGAHFYVCGDASRMAKDVDAALKTIVARHGGMTDEQAAD
FT                   YVARLAKDKRYARDVY"
FT   gene            345346..345477
FT                   /locus_tag="BMA10229_0341"
FT   CDS_pept        345346..345477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0341"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98995"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWU6"
FT                   /protein_id="ABM98995.1"
FT                   /translation="MYGRRRRVRSRAAREGARLRVARAREPAHAAERCGGARRARAG"
FT   gene            345527..345643
FT                   /locus_tag="BMA10229_0342"
FT   CDS_pept        345527..345643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0342"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98564"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWU7"
FT                   /protein_id="ABM98564.1"
FT                   /translation="MRGAGAGGRRACRAGERLGSARRSRSAAALLVRSGWEA"
FT   gene            complement(345843..347555)
FT                   /locus_tag="BMA10229_0343"
FT   CDS_pept        complement(345843..347555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0343"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99328"
FT                   /db_xref="GOA:A2RWU8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWU8"
FT                   /protein_id="ABM99328.1"
FT                   /translation="MPKPAEPLHRRPPLTPAALPRWRSRCVLALLCAGFGALAARALWV
FT                   QVVRSDFYITQGIKRYRHTFEAAPARGRIVDRNGAELAIDEPVADVWIAPDAFRRATHA
FT                   QMRALASLLGVPIDTLAAKALGTRQFLYLKRWIAPELAARIERLAVPGVHVAAATRRYY
FT                   PSGGDAAQLVGFVGADGHGLEGVERTADAALAGVGAKRDMIVDRMGRPVQAGDAASAGV
FT                   PGADVRLSIDRRVQHLAQRAVERAVARTAAAAGCAIVVDAKTGEILALVNAPTFDPNER
FT                   TAAADDGRLRERVLTDVFEPASTLKPVTVALALSEGVVAPDTRIDTSPGVLDIEGATIH
FT                   DTGDFGELTVTQIIAKSSNIGMAKIAERLRAQDMWRTFARAGIGARPLAGLPAVARGTL
FT                   RPARSWKPIERLTMSYGYGLSVSLAQLADVYTAFAGDGSRIPLSLAHAGALAARVRVVP
FT                   PAVARQIRAMLETDGEEGTARIARLPDYRIGAKTGTARKLCGKRYARGKYRALFVGLAP
FT                   MSDPRLIVAVMIDEPSRGSYYGGPAAGPAWAEIMDNALHLLGVPPDRPAARHA"
FT   gene            complement(347922..348923)
FT                   /locus_tag="BMA10229_0344"
FT   CDS_pept        complement(347922..348923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0344"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /note="identified by match to protein family HMM PF00144;
FT                   match to protein family HMM PF00768"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98709"
FT                   /db_xref="GOA:A2RWU9"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWU9"
FT                   /protein_id="ABM98709.1"
FT                   /translation="MTTEPLSTTVARGSRRAACALLRTPSRLFAALFVSAACAAPNGAR
FT                   AAPAPAPAIQAASWLVVDADSGKTLGAHNVDARREPASLTKLMTAYVAFDALERAALRW
FT                   DDTVTVAADDIASVGRDEARMYLTPGQRVRVRDLMRGLIVASANDAALVLAKRIGGSPA
FT                   GFATMMNDTARRLGMRDSHFVSPSGITTPNHYSTAHDLSILAQRLNRDFPAFYTFSSQR
FT                   HFAYGAFAKTNKNRLLGADPSVDGMKTGHTNAAGWCMVVTAKRPVGGARARHRVIAVLL
FT                   GEPTEKQRLADARALLDQGFASLGADAPAANAVQRANARPGEHRAQARARML"
FT   gene            348946..349098
FT                   /locus_tag="BMA10229_0345"
FT   CDS_pept        348946..349098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0345"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00604"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWV0"
FT                   /protein_id="ABN00604.1"
FT                   /translation="MENGRRRGIGKAARESGWNGEAQIAGDATTRANYIFIASDGTDAK
FT                   CVLLS"
FT   gene            349080..349211
FT                   /locus_tag="BMA10229_0346"
FT   CDS_pept        349080..349211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0346"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00110"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWV1"
FT                   /protein_id="ABN00110.1"
FT                   /translation="MCFIVVICRPGAREGFVRTASTAYAVRSPRRRTARRKSRRIDA"
FT   gene            349253..349432
FT                   /locus_tag="BMA10229_0347"
FT   CDS_pept        349253..349432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0347"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99608"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWV2"
FT                   /protein_id="ABM99608.1"
FT                   /translation="MNPFRKAAKPESSGLRTIAVPLFTSALTRAGTAGRRTHTPKTAAG
FT                   VGARADAVEPDRSA"
FT   gene            complement(349541..350968)
FT                   /gene="xylB-2"
FT                   /locus_tag="BMA10229_0348"
FT   CDS_pept        complement(349541..350968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB-2"
FT                   /locus_tag="BMA10229_0348"
FT                   /product="xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01312"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00303"
FT                   /db_xref="GOA:A2RWV3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWV3"
FT                   /protein_id="ABN00303.1"
FT                   /translation="MTYLGIDLGTSEVKAILTDADSAPLAVERPHPHWSEQSPQAWWHA
FT                   TLDAIAAVRAMHPRGFAALRGIGLSGQMHGATLVDRAGQVLRPAILWNDTRAAAECVEL
FT                   EALVPESRAITGNMAMPGFTAPKLLWLAKYEPAVFRAAHKVLLPKDYVAWRLSGEFVSD
FT                   MSDASGTLWLDVGRRDWSERMLAATELSREQMPRLVEGSAAAAQLRDALRREWGVAGPV
FT                   TIAGGAGDNAASAIGMGVANAGSGFLSLGTSGVLFAGNDRFAPNPGDAVHAFCHCLPER
FT                   WHQMSVILSAAASLDWFAKTHDVAVDTLPALAERADASRAPLFLPYLSGERTPHNDARA
FT                   RGVFFGLASEHRAGELAYAVMEGVAFAMADGYAALRRAGTTLDDASFIGGGSKSAFWAQ
FT                   LCANATGLAMHRHASGAVGAARLARLAATRDALDDVCVAPAIAETYRPDPAATGLLGER
FT                   LERYRRLYRALKAEFAG"
FT   gene            complement(350965..351963)
FT                   /locus_tag="BMA10229_0349"
FT   CDS_pept        complement(350965..351963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0349"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99636"
FT                   /db_xref="GOA:A2RWV4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWV4"
FT                   /protein_id="ABM99636.1"
FT                   /translation="MNGGRPAVHAQERQMNPDLEIVPTRRDESFRAWSHDYPHTVAKWH
FT                   FHPEYEIHLIQGSRGKFFVGDHIGDFAPGNLVVTGPNLPHNWISELGPGERVPSRDVVL
FT                   QFSRDAAEKMVAAFAELQPVLDLIDEASRGVQFPDEIGLAVAPLMLELASAHGCRRVEV
FT                   LMALFDRLASCAARRTLAGPGYRIDAQHYMSSTINQVLAYLRQNLPGALREADVAEFAG
FT                   MSVSTFTRFFRRHTGSTFVQYLNRLRINEACELLMCSALSVTDICYRIGFNNLSNFNRQ
FT                   FLAMKGMPPSRFRALHRLNEPHDAPEPHEPHASLAPATARAVIHSHRSLHP"
FT   gene            complement(351960..353153)
FT                   /locus_tag="BMA10229_0350"
FT   CDS_pept        complement(351960..353153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0350"
FT                   /product="putative sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF03459; match to protein
FT                   family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99330"
FT                   /db_xref="GOA:A2RWV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWV5"
FT                   /protein_id="ABM99330.1"
FT                   /translation="MARIVCTGLTKRYDGGAPVLHPLDLEIGDGEFIVLLGPSGCGKST
FT                   MLRMIAGLETITGGTLAIGGAVVNDLAARERNVAMVFQNYALYPHMSVYENIAFGLRRL
FT                   KVPAAEIDRRVREVARVLGLDALLDRKPRAMSGGQQQRAAIARAMIKTPDVFLFDEPLS
FT                   NLDAKLRAQLRGDIKRLHQRLKTTTLYVTHDQLEAMTLADRIVLMRGGRIEQLGTPAEL
FT                   YGCPHTMFAAGFVGTPAMNFADGVIERTAGHVALAAGGARWTLAARRFAGLPDGLRVKL
FT                   AIRPNYLRIAPGAHAPAATLALEGRVELVELLGAEALVTFGCNGAPFAALVPASAAPAL
FT                   GAVVTFTFDERDLHLFDAATGRNVMLPEAGAPADAERPGAAMRPSPGAPHRFTMSRP"
FT   gene            complement(353157..354191)
FT                   /locus_tag="BMA10229_0351"
FT   CDS_pept        complement(353157..354191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0351"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98698"
FT                   /db_xref="GOA:A2RWV6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWV6"
FT                   /protein_id="ABM98698.1"
FT                   /translation="MKALVLEKARELALRDIDLPLEVGPADVKIRVHTVGVCGSDVHYY
FT                   MHGGIGPFRVDAPMVLGHEASGTVVEVGRDVTYLRVGERVCMEPGVPRFDSKATLHGLY
FT                   NLDPSVRFWATPPVHGCLAPYVVHPAAFTYRLPPNVSFAEGAIVEPLAIGLQAAKKAAM
FT                   KPGDIAVVVGAGTIGAMTALAALAGGAARVILADVVKEKLALFAANRAVTTVDASTQSL
FT                   ADAVAHATDGWGADVVFEASGNANAYAGIVDLLCPNGCLVLVGMPLAPVPLDVVSLQAK
FT                   EARIESVFRYANVFPRALALIASGAIDVKPFISRTFPFSDGLRAFEAAASGQPHDVKIQ
FT                   IEMD"
FT   gene            complement(354213..355025)
FT                   /locus_tag="BMA10229_0352"
FT   CDS_pept        complement(354213..355025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0352"
FT                   /product="putative sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00561"
FT                   /db_xref="GOA:A2RWV7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWV7"
FT                   /protein_id="ABN00561.1"
FT                   /translation="MGRLIARGGTVAIGGAIALVAVFPLAWALLNSFKRLLDIVTLTPR
FT                   FIFTPTLDNYRQVLSSPEVLIGLGNSVAIVGVAVALGAALGVPAAYAIARYPVRGKRDI
FT                   QFFLLSLRFLPPVAVAIPLIAIWVDLGLYDTKLSMIVTYLLVTLSTITWLSIPVFRRLP
FT                   REIEEAAALDGYGPYAVFWRVALPVCASTLLGGIVFSFVLVWNELMIALALTSSRAATL
FT                   PVVASAFTSLGQEVPWGVINASTVLLALPPLVFVGMLSRLLNSMLKGR"
FT   gene            complement(355013..355891)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0353"
FT                   /note="putative sugar ABC transporter, permease protein;
FT                   this gene contains a frame shift which may be the result of
FT                   a sequencing error; identified by match to protein family
FT                   HMM PF00528"
FT   gene            complement(356060..357340)
FT                   /locus_tag="BMA10229_0354"
FT   CDS_pept        complement(356060..357340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0354"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   sugar-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00484"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWV9"
FT                   /protein_id="ABN00484.1"
FT                   /translation="MNTIRLLGAAALVGACAPLAAAAATPVCKVPTLKVLAQKSLGLSV
FT                   MEKSLPDYEKTSGTRIEINYFGENDRRAKSRLDASTGAGSYQIYYVDEANVAEFASAGW
FT                   IAPLIKYYPKEYDYDDFLPGRRAVASYKGVAYFAPLIGGGDFLFYRRDLLDAAHLPVPK
FT                   TLDELVAAVRKLNAPPKLYGWVARGQRGSGMNVWRWAPFMLAQGGAWTDPHGQPAFNSP
FT                   AAVQATERYRDLFKYAPPGAATYDWSNALEAFRSGKVAFMIESTPFADWMEDPSKSSVA
FT                   GKVGYARPPAPLPSAAYGHGLAISSVGAKDDCTRQAAGRFIAWATSKEQEQARLRNGVF
FT                   SDYNRTSTIGSDYFRQHVKPQILAGLNDTNPVTKATIWATPQWPDIGDNLGVALEEVFT
FT                   GTQTDVRGALDDAAQYAKDAMAHGARK"
FT   gene            358117..358587
FT                   /locus_tag="BMA10229_0355"
FT   CDS_pept        358117..358587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99827"
FT                   /db_xref="GOA:A2RWW0"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWW0"
FT                   /protein_id="ABM99827.1"
FT                   /translation="MKQAGIRIGTHAIALALGFALGIYALPILTAERGASETELRPVAD
FT                   RALYTGRFERSLTRGDPLHWTDGKLSVTRAALAFEGRVAPGPDYKLYLVPGFVASKEAF
FT                   LAAKPHARRVGELKTFGDFVAPLAADVDIDAYTTVVIWCERFSQFIGAAQYR"
FT   gene            complement(358848..358970)
FT                   /locus_tag="BMA10229_0356"
FT   CDS_pept        complement(358848..358970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99480"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWW1"
FT                   /protein_id="ABM99480.1"
FT                   /translation="MSSGCWMLDAGCWMLDAGCWMLDAGCRLPVAGCRQMPTAE"
FT   gene            complement(358982..360118)
FT                   /locus_tag="BMA10229_0357"
FT   CDS_pept        complement(358982..360118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0357"
FT                   /product="putative transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98861"
FT                   /db_xref="GOA:A2RWW2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWW2"
FT                   /protein_id="ABM98861.1"
FT                   /translation="MSSDRPATRLATRLAFLVAGFGVACWAPLVPFAKARLGVDDAVLG
FT                   ALLLCVGLGSVIAMLITGPLGTRYGSRPIIVAGGVALAAILPLLSVANTTPALGFALLA
FT                   FGAALGSLDVAMNVHAIEVEHAAARPLMSGFHALFSVGGIAGSSVMTFLLSMRVGAFAS
FT                   TLLCSAPMLAAILVARPRLLRAARAAARPRFAMPRGVVPLLAMLAAITFLAEGALLDWS
FT                   ALLITDKGLVAAAQGGLGYLLFSIAMTAGRLGGDAIAARVGDRSTMFWGGLLAVAGFVM
FT                   LLAAPIAGVAMAGFLLIGLGASNIVPVLFRRAGAQQAMPSALAVTLITITGYAGHLAGP
FT                   AGMGFVARSVGLESAFWMLAALLGIVPLCARVVTANRT"
FT   gene            complement(360152..360976)
FT                   /locus_tag="BMA10229_0358"
FT   CDS_pept        complement(360152..360976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0358"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99509"
FT                   /db_xref="GOA:A2RWW3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWW3"
FT                   /protein_id="ABM99509.2"
FT                   /translation="MHVSILVHARYTARMNDAIPLARRDAIAGRLALGQPVQAAALAAE
FT                   FHVSEDAIRRDLRALAAEGRCRRVYGGALPVTPACAPMAARIDAARERKAALARTAASL
FT                   IERGELLFLDSGSTALALVEYLPEDAELTIATNSIDIAAAVLRRADLSLIMIGGAVDQA
FT                   VGGCVDASAVQSVARMNIDRGFLGACALSPQRGLAAFGLADATFKRAVVAASARCVVLA
FT                   TTDKLAARAPHRVAALDEIDCIVVEHDLPREDRAALSSAGASILAANPPAQP"
FT   gene            360981..361151
FT                   /locus_tag="BMA10229_0360"
FT   CDS_pept        360981..361151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00214"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWW5"
FT                   /protein_id="ABN00214.1"
FT                   /translation="MHFVRGLRKGAPLSQRRAPLPTTNRFDRDKAGATEIGRACEADRP
FT                   PPAASGFLAFI"
FT   gene            361447..362469
FT                   /locus_tag="BMA10229_0361"
FT   CDS_pept        361447..362469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0361"
FT                   /product="metal ion transporter, MIT family"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99749"
FT                   /db_xref="GOA:A2RWW6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWW6"
FT                   /protein_id="ABM99749.1"
FT                   /translation="MKPEMIIQTYGADTSGMVCGFRFAPDSAGEPVDAGVAAEWAAGRG
FT                   ARPDEFLWLHFNLAHGASERWMRAHLDLPETFHEFLREGSHSTRIEQQDGVLRAVVNDV
FT                   MFSLDLEASEIATMWAYVDRRMMVTARAKPLRSIDTLRESVRQGERFRSPAELLIHLLR
FT                   DQADLMMHIVRRASTDVDRIEDRFLSERLSANRGQLSAMRRTLTRLQRMLAPEPGSIFR
FT                   LLAKPPAWLLSADVQELRESTEEFSVVLADLAGLIERIKLLQEEIASRLDEQNNRTLFT
FT                   LTLVTVIALPINIVAGFFGMNVGGIPFSENKHGFWMMVLLVAGFTALAAWWTFWRRGDR
FT                   "
FT   gene            362625..363098
FT                   /locus_tag="BMA10229_0362"
FT   CDS_pept        362625..363098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0362"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF06983"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99235"
FT                   /db_xref="GOA:A2RWW7"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWW7"
FT                   /protein_id="ABM99235.1"
FT                   /translation="MAIQKITPFLWYSTQAEEAAAFYAGVFPDSRVARVTAVPGTGSTK
FT                   LVEFVLFGQPFFAMSHPRTESFNHAISFLVSCRDQAELDRYWSALLEGGGSPDDCGWLR
FT                   DRFGVSWQIVPDDLIAMMADPDPVKAARVAGAMMSMRKFDVAALRAAYAGAAG"
FT   gene            complement(363256..363534)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0363"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(363771..364127)
FT                   /locus_tag="BMA10229_0364"
FT   CDS_pept        complement(363771..364127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0364"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00587"
FT                   /db_xref="GOA:A2RWW9"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWW9"
FT                   /protein_id="ABN00587.1"
FT                   /translation="MNMQTFLLYLLITVLMAPLLAVYGLPFIAVARGFSRIARARIGDR
FT                   LRRAIACAIAAAGIAPSYDAYRAPLPIYARRLLDGASVDAGFALASFGVTWIVVMLVAR
FT                   LCTRRRAAPQTHGA"
FT   gene            complement(364141..366114)
FT                   /locus_tag="BMA10229_0365"
FT   CDS_pept        complement(364141..366114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0365"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99032"
FT                   /db_xref="GOA:A2RWX0"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWX0"
FT                   /protein_id="ABM99032.1"
FT                   /translation="MIHIRLKRASFLLLLGAQAVSLGAAAGTLSGTVSSAGTPLAGAMV
FT                   TVFDAAQARRDTVYTDHNGRYRITVDFAGELRMRARTPYFKDAAQDLALAPDASKTLDF
FT                   SLARQTVADELSASLPASAHLATLPWSSQDSRTAFISQCNYCHQVGNALTRTPRDEAAW
FT                   GATVRRMEGYAALLTDRQARDITHTLYQGMNAHAVAAVEKYLYDDRLAPAKIREWAAGD
FT                   GLTFIHDADVGFDDHLYGADEGHDKIWELDRKTGKLTEWKEPDVDLPVGGIFSGVQLPI
FT                   GVFSGKHGPHSLAQAPDGRFWITNALSSTLASFDPATKRFKLYELGHSHLYPHTLRIDR
FT                   AGIVWFTIVASNEVARFDPKTGRFTIIHLPDGGIWRAMSHYLFPLVVKMAAWFPGQNLH
FT                   LALTHHKWAFQGRDAFPFPYGIDVNPVDGSIWYAKLYANKIGRIDPKTLAVTEFDTPLG
FT                   GPRRLRFDPQGNLWIPAFDDGGLMRFDTRTHRFETFKLPLLAHNEYEVPYALNVQPKTG
FT                   DIWITSNMSDRIFRFVPSTQTFITYPLPTRVTWLRDMTFTQDGAVCSSSSNLPAYGIEG
FT                   GRASFICLYPDGERGGTAANAAGNANAAANLARVRAAAARGTPERTAPARAALARAGSN
FT                   RDGAIQTAAIQADGTRTDRSAH"
FT   gene            complement(366215..367117)
FT                   /locus_tag="BMA10229_0366"
FT   CDS_pept        complement(366215..367117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99358"
FT                   /db_xref="GOA:A2RWX1"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWX1"
FT                   /protein_id="ABM99358.1"
FT                   /translation="MAVGNHHPIKARHVKFDFGETPLQWIPGDPESTHIIDTLNLLFPE
FT                   GELWFCRVYNKALPLIDDPALHADADGFLRQEAVHSRSHHAVAKQCYARHGVDTQPYTR
FT                   RLTWLFSKVLGEAPLGLKIGHTRFWLRQQLGIIAALEHFFAYLGRWVLNARELDEARAD
FT                   PAMLDLLRWHGAEEVEHGTVAFDLHRYMGGGYFGRAFHMLLAIALLVLFVSMGSKFMHT
FT                   RDPGAGRYPGFVRAWTRGSRRRHLPSFWKTIGAALRYFNPAYTPHGEGSTELALDYLAR
FT                   SPAAQAAAHGGNWGAKKTT"
FT   gene            367464..367580
FT                   /locus_tag="BMA10229_0367"
FT   CDS_pept        367464..367580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0367"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99987"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWX2"
FT                   /protein_id="ABM99987.1"
FT                   /translation="MRQMVAETATALFFRIISNRRTFNSMRIDRELIQVKDG"
FT   gene            367793..368008
FT                   /locus_tag="BMA10229_0368"
FT   CDS_pept        367793..368008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0368"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98676"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWX3"
FT                   /protein_id="ABM98676.1"
FT                   /translation="MPDGARCRRHRGRRRAPSRAVARTMSRAAESCLAWARVSAVQPSI
FT                   GIGAFREAMRRRASRAGRATPRALFA"
FT   gene            368354..370087
FT                   /locus_tag="BMA10229_0369"
FT   CDS_pept        368354..370087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0369"
FT                   /product="putative potassium efflux system protein"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99291"
FT                   /db_xref="GOA:A2RWX4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWX4"
FT                   /protein_id="ABM99291.1"
FT                   /translation="MPHDVSLIALLAAGFGLAMIFGYLASLLKMPPLVGYLLAGIVMGP
FT                   GTPGFVGDLALAQQLAEIGVMLLMFGVGLHFSLGDLLSVRKIALPGAIVQIAVATALGA
FT                   GLALWWGWSVGGALVFGLSLSVASTVVLLRALEGRGLIESVNGRIAVGWLVVEDLVMVL
FT                   VLVLLPPLAALLGGGGAPAHGDAAVHAGEAGGSLWAALGVTLLKVAAFVALMLVVGKRV
FT                   FPRILWLVARTGSRELFTLCMIAAAVGVAFGAAKLFDVSFALGAFFAGMMMRESEFSRR
FT                   AADETLPLRDAFSVLFFISVGMLFDPRVLIDEPLHVLEVAAIVVLGKTLAAVALVLAFR
FT                   YPLNTALTVGVSLAQIGEFSFILASLGRGLGLLSAEGQSLILAVALLSIALNTLLFAAV
FT                   DPVLAWIRKRSAFARRLESRDDPLAALPMSTPQAHLTGQVVIVGYGRVGTRIAHALDAR
FT                   GIAYVVVEQNRETVEKLRADGVAVEPIVLVQAHIARAGMLVVTLPDVFDVRQIVDISRT
FT                   LNPAIEIALCTNSDEEAALLANEGMGEVFVSETGLAHGMTEHVLARMGAGEAHARRSAA
FT                   H"
FT   gene            complement(370122..370895)
FT                   /locus_tag="BMA10229_0370"
FT   CDS_pept        complement(370122..370895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0370"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99653"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWX5"
FT                   /protein_id="ABM99653.1"
FT                   /translation="MRMTTSRTTLITGAAGGIGQALVRGFLAAGDRVLALDRDRAALAA
FT                   FVDALGDAAVAPIIDDLTDAERLAAALANEPVDVLVANAGTAASATLRTTTSASWRADL
FT                   DANLTATYASVEAVLAGMRARRRGAITIIGSVNGVAALGHPAYSAAKAGLISYAKSLAI
FT                   EYGRDGVRANVVCPGTVKTPAWEARVRQNPQVFEQLKKWYPLEDFATPDDVANAALFLS
FT                   SDAARAITGAMLPVDGGLLAGNRVMAQELTLESFY"
FT   gene            complement(370954..371955)
FT                   /locus_tag="BMA10229_0371"
FT   CDS_pept        complement(370954..371955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0371"
FT                   /product="putative periplasmic sugar-binding protein"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00231"
FT                   /db_xref="GOA:A2RWX6"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR026266"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWX6"
FT                   /protein_id="ABN00231.1"
FT                   /translation="MGLRWPQAALVCASLAAGLSAAAPAHAQGAAPVKIGFVVKQPDDP
FT                   WFQDEWRFAEQAAKDKHFTLVKIAAPSGEKVSTALDSLAAQKAQGVIICAPDVKLGPGI
FT                   AAKARRYGMKLMSVDDQLVDGRGAPLADVPHMGISAYRIGRQVGDAIAAEAKRRGWNPA
FT                   EVGVLRLAYDQLPTARERTTGAVDALKAAGFAAANVVDAPEMTADTEGAFNAANIAFTK
FT                   HRNFKHWVAFGSNDDTTVGAVRAGEGRGIGADDMIAVGINGSQVALNEFAKPKPTGFFG
FT                   SILLNPRLHGYDTSVNMYDWITQNRAPPPVVLTSGTLITRANEKTARAQLGL"
FT   gene            371935..372234
FT                   /locus_tag="BMA10229_0372"
FT   CDS_pept        371935..372234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0372"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98945"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWX7"
FT                   /protein_id="ABM98945.1"
FT                   /translation="MGPAQSHERLLRAPFSIWMRPCEPRNGMHVVRLIVGGASTGFQIL
FT                   RGVPKEWDRAVGRRGVGRMSSLDAGCRMPDVRCPMSDVRCRASGSKVRRRTSKV"
FT   gene            complement(372358..374142)
FT                   /locus_tag="BMA10229_0373"
FT   CDS_pept        complement(372358..374142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0373"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99255"
FT                   /db_xref="GOA:A2RWX8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWX8"
FT                   /protein_id="ABM99255.1"
FT                   /translation="MRLNKKPKSSDPYVAVAKNPMLSSSLPMWRSKFVVILVFLAFGAL
FT                   IARAFWVQVANQDFYVGQGQKRYQRTIKLGAMRGSIVDRNGALLAVSLTTYEIWANPKQ
FT                   VDEAAHAPLAKLLDMPLAEVRRRLTGDRSFVLLKRQVDPETAARIEKLDIDGVTQIADS
FT                   KRFYPEGESAAHVVGFTNVEDRGQEGVELAANGRLSGTAGQRQVIRDRLGRIVSDTGPL
FT                   VPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLDAQNGEILALANYPTFD
FT                   PNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQTIIDTSPGAYKIGPN
FT                   VIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYGIGRAPELTFPGVAS
FT                   GRLRPYKRWRPIEQATMAYGYGLSTSLLQIAQVYTAYAGDGTIHPVSLLKASADPQSAD
FT                   AHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTARKQVGASYVKGK
FT                   YRALFAGMAPMSNPRLIIAVMIDEPAARSYYGGTVAGPVFSSVMSGSLQLLGVPPDAPV
FT                   AADKPAGTGAKPQAKAKT"
FT   gene            374447..375484
FT                   /locus_tag="BMA10229_0374"
FT   CDS_pept        374447..375484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05344"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99820"
FT                   /db_xref="InterPro:IPR008008"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWX9"
FT                   /protein_id="ABM99820.1"
FT                   /translation="MLSESHEPRPRCPRCGGGHINSAGFRTRPIGRLPMFECQMCRRYF
FT                   SRTAGTPLGEKHLKKLDLFVSLLSQPISCLEAGKQMGSLPDDIGERVKVWRAWLLQLDP
FT                   SGQWERRIRLGGRPTELNPAPLAFDEIGAREDRALTVHLTREFDDVNSLSQQPLACPDC
FT                   GSRNTRFDECPNGAFPRFMCLHCRRRFTRRRGTPFLNTKMSSLERMRLFIRHLSLPLSV
FT                   MQAADLVGTSHGMIHKWLRMFIEFADQLEPSGSLSTRIQLGVEPTETTPCPFCGRAGSA
FT                   WQTERGHWTCAGCGRLFSMRRTVVERNGVLEIVDESMAGDDEFITPQRTIARHDRHDSE
FT                   YGKRS"
FT   gene            375855..376301
FT                   /locus_tag="BMA10229_0375"
FT   CDS_pept        375855..376301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0375"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99742"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWY0"
FT                   /protein_id="ABM99742.1"
FT                   /translation="MASRRNGRAALTKAQLLPLSTEKIRALSLENHLALSVVRAGAGDF
FT                   EQMSCLLRAVYLAYFMRNETTAGMDADVYRRAEAVMDRCIGRVERGETWILESNEVAEL
FT                   ERVLVLHDQQLAAVPLHRYQSAWERLQRFITSGQRSPIPAAATA"
FT   gene            376392..378089
FT                   /locus_tag="BMA10229_0376"
FT   CDS_pept        376392..378089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0376"
FT                   /product="phage integrase family protein"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98881"
FT                   /db_xref="GOA:A2RWY1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR022169"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWY1"
FT                   /protein_id="ABM98881.1"
FT                   /translation="MIMKTRETHSIDENNPDFPDEAELAALRGWYAGLDTRAAVARYLG
FT                   DRRAAGGSSRGILGRIRQRLVAFARSRHRVDLAAALVARPTSASAASVARVIEALRNLP
FT                   VPAPLITDAVEMWLPPRIVQALHGHDIRTLADLTVRIPRRRRWWSAIDGLGVAGARHVE
FT                   AFFAAHPVLTDRARALITATPSGVIVPWEQIRVPHEVDGSRGQFRAPQVACLLSASNDY
FT                   EAIQSWLSLHESAATQRAYRKEAERLILWAIVERGRPLSSLTTDDAIAYRGFLRRPTPR
FT                   ERWVGPSRPRHSVEWRPFSGPLSARSAAYALTVLSAMFRWLVEQRYVLANPFAGVKVRG
FT                   AAARTGLDVARGFTEGEWLLIRALADGLEWSYGWGAPAAHRLRFLLDFGYATGLRASEF
FT                   VGATLGDIRRDEHGDHWLHVIGKGGKLGKVALPALARSALDQYLVQRGLPVTPSRWDPA
FT                   TPLVANLEEDGAGIESTRLWRVLRRFFRFAADAIQDERPATAEKLRRASPHWMRHTHAT
FT                   HALARGAELIMVRDNLRHASISTTSTYLHGDEIQRARQFDQAFEARKV"
FT   gene            complement(378163..378843)
FT                   /locus_tag="BMA10229_0377"
FT   CDS_pept        complement(378163..378843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99346"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWY2"
FT                   /protein_id="ABM99346.1"
FT                   /translation="MSAAEPHYIDAQRTIAPVDAPLAAPHEYAAVLRSDFVSSYHDGRD
FT                   VWTDEAAMRPASAILHAHLGRPADVLDAGAGRGRDTAYFLEQGHRVTAVDLVEPPEWAQ
FT                   LAQRWGERVCFVARPVSELDGEARFDGALDNGCLHHQHPDAYRAYLARIHALLRPDGRF
FT                   TISVFESDGPGRLYANHAQRLYREFTEPELAELLRAAHFTPVDSQRVPRPKAGLHYLRV
FT                   GRDS"
FT   gene            complement(378840..380537)
FT                   /gene="toxC"
FT                   /locus_tag="BMA10229_0378"
FT   CDS_pept        complement(378840..380537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="toxC"
FT                   /locus_tag="BMA10229_0378"
FT                   /product="WD domain protein"
FT                   /note="identified by match to protein family HMM PF00400"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99579"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWY3"
FT                   /protein_id="ABM99579.1"
FT                   /translation="MITHRAPISGIAAHRDQYVLTAGYDNQVILWDAKTQRPLARAMHD
FT                   HLANQGAFSPDGAYVVTSSSDYSARLWTVPDLRLVAVFADQEDDVEMSVFHPDKPLVAT
FT                   ASRDHRVRVYDFGGKLLHTFSGHTADVISVEWMRGADEIVSSSDDGTIKRWSLANNGLV
FT                   ADIDLDGIETDTIAIAADGRIFAGNDEGEIISIGVDGARATIAAHDAGVKRLVLDGERG
FT                   LLVSLSYDRTMRLWKVGAAGEPRALGGAALPPEVWPRSCSFEGDEHIVFSTFHSSYRRY
FT                   NWKTERWDAAELPPTHGVNAVQPVDGHLWTIGDAGIVRVDQREHARTGSLCNFLAPAGE
FT                   LILTGGQLGKVFDARSGRELHQHRSPLNCGVAFARDGAAHAVIGTYTGEGIVLRIDGTR
FT                   ATHVADLPLHANAVKGIAISGDLIFSVAADASATWYRASTLEPAFELKRAHDKIANGCA
FT                   GLGDGYFASVSRDLKLRIWSPDSHAEVIATPHTHSIKCVAASADGRYVATGSYNGRVAV
FT                   YDRVETRWALDARVTTAGVSSLAYDPAARAFLASSYDGNVYRIPLERA"
FT   gene            complement(380534..381190)
FT                   /gene="toxB"
FT                   /locus_tag="BMA10229_0379"
FT   CDS_pept        complement(380534..381190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="toxB"
FT                   /locus_tag="BMA10229_0379"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="identified by similarity to SP:P51618; match to
FT                   protein family HMM PF00925"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00607"
FT                   /db_xref="GOA:A2RWY4"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWY4"
FT                   /protein_id="ABN00607.1"
FT                   /translation="MRHSMNDGRISPTMSASVRTRVNVPIRPRTAQQRFDAEMVTFQGL
FT                   CDSAEHLALVFGPLADAPLVRVHSECLTGDVFGSARCDCGEQLDESVAMFGREGGILLY
FT                   LRQEGRGIGLYNKLDAYRLQISQGLDTFAANRALNFPDDLRDFRVAAQMLQALGVTEIS
FT                   LVTNNPDKVSQIEKHGIRIRRVLQTGVFVNTTNHGYLRAKIDHHRHAINLSQELQ"
FT   gene            complement(381197..381493)
FT                   /locus_tag="BMA10229_0380"
FT   CDS_pept        complement(381197..381493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0380"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98438"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWY5"
FT                   /protein_id="ABM98438.1"
FT                   /translation="MRQPNARQHSARRPSAARAGRERIGRTWRTKKKTDREMIGDTVIG
FT                   TDAQSAMLLHNRTQQPIKSSPRTRETATNRKSIQAFDITIQKLPCSSRCVSQC"
FT   gene            complement(381508..383046)
FT                   /gene="oprM"
FT                   /locus_tag="BMA10229_0381"
FT   CDS_pept        complement(381508..383046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprM"
FT                   /locus_tag="BMA10229_0381"
FT                   /product="outer membrane efflux protein OprM"
FT                   /note="identified by similarity to SP:Q51487; match to
FT                   protein family HMM PF02321; match to protein family HMM
FT                   TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99103"
FT                   /db_xref="GOA:A2RWY6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWY6"
FT                   /protein_id="ABM99103.2"
FT                   /translation="MRTAVRAAAVAAAFFAAGCTLAPRYERPAAPVSGAFPADGVYAAQ
FT                   PGAAPGARSANGQAAVDIGWREFFVDPRLQRLIEIALKNNRDLRVSVLNVEASRAQYQI
FT                   TRAGLFPTLSGTGTGTIQRTPAGVSITGQPLISRTYNVGVSASWELDLFGRVQSLKDQA
FT                   LAQYFATAQARKAAEISLVASVADQYLTLLSTDDLLQVTQNTLKSARASYDLTKLQFDN
FT                   GTGSELDLRQAQTVVETALASQQAQARARAQALNALVLLIGEPLPDDLPADLPLNAQNL
FT                   LTDIPAGLPSDLLTRRPDIMQAEETLRAANANIGAARAAFFPKISLTSAFGTASTTLGG
FT                   LFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHVQKRIEIANYEKAIQSAFREVSDGLA
FT                   ARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVDSYLSVLTAQTDLYSAQQQLISARL
FT                   ARWTNLVDLYRALGGGWLERAGETPRPADAPVDYGKAAPAPAASASARTAAVIG"
FT   gene            complement(383181..386282)
FT                   /locus_tag="BMA10229_0382"
FT   CDS_pept        complement(383181..386282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0382"
FT                   /product="hydrophobe/amphiphile efflux family protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99173"
FT                   /db_xref="GOA:A2RWY7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWY7"
FT                   /protein_id="ABM99173.1"
FT                   /translation="MNAGAPHDSGAARARFTDVFVRRPVLSLVFSLLILLVGLRALMSL
FT                   PVRQYPALESATISVATDYPGASQELMQGFVTTPIAQSIATADGIEYITSTTTQGKSVV
FT                   KARLRLNANADRAMTEVMAKVQQVKYKLPADAYDSVITKLTDAPTAVMYLGFASDALSI
FT                   AQITDYVVRVAQPLVTTVPGVASAEILGGQNLAMRVWLDATRLAAHGLSAGDVAAAIRA
FT                   NNVQAAPGQVKGSLTIADISANTDLTDVGAFNEMVVKSAPNGGGLVRLKDVATVEIGGE
FT                   NYNSSALMNGRRAVYIAVNATPAGNPLEIVRGVGAVLPAIERNKPASVQIANMFDGARF
FT                   VNASIAEVRSTLTEAIAIVVVVIFLFLGSFRAVIIPVLTIPLSLVGSAALMLAAGFSLN
FT                   LLTLLAMVLAIGLVVDDAIVVVENIHRHIEQGEPPVRAALIGAREIASPVLVMMATLIS
FT                   VYAPIGLMGGLTGLLFKEFAFTLAGAVLVSGIVALTLSPMLGSLLLTSRMSEGRVAKAI
FT                   ERTLERVTHAYRRGLHASLAARPAILLIGAGVLAGIVLLFSGVKRELAPQEDQGSIMVA
FT                   VKAPQYANLDYMERYAPDIERVFRTLPEADTSFILNSYGGSNLGFAGVNLVDWDKRTRS
FT                   AAALQALIQARGDGIRGERVFAFQLPALPASSGGLPIQMVLRTPSGFADLYAQMERIKA
FT                   AAQKSGLFAVLDSDLTFDSRAVGVTIDRNQANTLGVTMKDIADTLAVLVGENYVNRFNF
FT                   KGRSYDVIPQVSRSERLSSEMLSRYYVKTGSGRMIPLSTVIQVTNGSQANALSQFNQMN
FT                   AATFSAVPAPGVTMGDAVAFLEAQKLPAGFSIDWLGESRQYVQEGNRLAVTFGFALIVI
FT                   FLVLAAQFESLRDPLVILVSVPLSICGALAPLYLGFATLNIYTQIGLVTLIGLISKHGI
FT                   LMVSFANDLQRHEGLDRRAAIERAAAVRLRPILMTTAAMVAGLVPLVFAAGAGAASRFA
FT                   IGITVSTGMLVGTLFVLPTVYTFVAKDHGAAMRSERAQLLAATR"
FT   gene            complement(386279..387376)
FT                   /locus_tag="BMA10229_0383"
FT   CDS_pept        complement(386279..387376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0383"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00112"
FT                   /db_xref="GOA:A2RWY8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWY8"
FT                   /protein_id="ABN00112.1"
FT                   /translation="MGRRLLLALALLAFIFGGLFLWRESRVQAADHPPAPPAALTVSAV
FT                   AVRAAPERVTLDAVGSLDAVRQVTLAPEVAGRVVALQFDAGSAVRKGQLIVQLFDEPER
FT                   AKLASIQAKAAYAKRQLDRSQALAQTGAEPRNLFDRHRFDFDAAAADIRETQAVITQKA
FT                   VRAPFDGVLGLRRVNLGQYLNAGDAIATLTDLDTLYANFTVPQKNLSQLRLGQSVSITT
FT                   DAYPERTLVARVSAIEPQIGTDTRNVAVQATLPNPDHLLRPGMYIQARLELPPRERALT
FT                   VPDTAVQTSQRGESVLVVGKPGRDGLGVVRLQPVRTGRRADGRIAIADGLRPGDVVVTS
FT                   GQVRLAAGDRVKVALDDGAGSGAAQ"
FT   gene            387527..388198
FT                   /locus_tag="BMA10229_0384"
FT   CDS_pept        387527..388198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0384"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00156"
FT                   /db_xref="GOA:A2RWY9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWY9"
FT                   /protein_id="ABN00156.1"
FT                   /translation="MDDNFSKQEIPVSERVLNVLKRRGPLQAAELGAYLGTTGEAARQQ
FT                   LKKLEAEGLVEAQNVPQGVGRPARIWRLTSLGHGHFPDAHADMTVDLIRIIRTTLGQPT
FT                   LDLLIAARETEMRRTYAHTLAGVTDPEERIARLAELRDREGYFAEWSRAPDGDGWLFIE
FT                   NHCPICAAATACQGFCRSELEIFREMLGDALTIERIEHIPAGARRCAYRIRPSGAGAGG
FT                   E"
FT   gene            388195..388332
FT                   /locus_tag="BMA10229_0386"
FT   CDS_pept        388195..388332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0386"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99177"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWZ0"
FT                   /protein_id="ABM99177.1"
FT                   /translation="MIGAPTEPRGAPRPSRTRSVSAAARASRAAATPAGAERVPSACRP
FT                   "
FT   gene            complement(388329..390095)
FT                   /locus_tag="BMA10229_0385"
FT   CDS_pept        complement(388329..390095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0385"
FT                   /product="N-acyl-D-aspartate deacylase"
FT                   /EC_number="3.5.1.83"
FT                   /note="identified by similarity to SP:P94212"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98706"
FT                   /db_xref="GOA:A2RWZ1"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWZ1"
FT                   /protein_id="ABM98706.2"
FT                   /translation="MTRYDTIIRNGLWFDGTLAEPRPRELGIRDGRVAAVSDTPLAADG
FT                   ASVIDATGKWVMPGFIDIHTHYDAEILVSPGLPESVRHGVTSVFLGSCSLSTVHANALD
FT                   CTDLFSRVEALPREQMLAVLSRVKTWDTAAAYVRHLESLPLGPNVAAFLGHSDLRTHVL
FT                   GLGRAVDDRVRPHEAELQRMERLLDDALDAGFVGLSSMTTPWDKLDGERYRSKSLPSTF
FT                   ATWREYRRLNRVLRRRGRVLQSAPNTTNPLNGLLFMAESCGYFVRKPLRTSLLVAADSK
FT                   AAPRGTIDVQLGGVRVANALFRGELVWQHLPVPFEVYADGIDFVIFEEFGAGRAALHLA
FT                   DALERNKLLQNEGYRREFRRQVGKGFDLRLWTRDLHDTRIVGCPDASVVGKSFGQVANE
FT                   RGVHPADAFLDLVVAHGQRLRWCMTIANHRADVLDRIAPHPALQIGFADSGAHLRNMAF
FT                   YNAPVRFLRRVREAERAGRPFMSVQQAVHRLTGELGAYFGVDAGTLRAGDRADIAIVDP
FT                   AHLDASVDASVDAYHEEDMAVFGGLRRLVNRSGAAIAATLVNGQLVYRDGAFAEGFGDT
FT                   RRSGRFLRAAAR"
FT   gene            complement(390573..390686)
FT                   /locus_tag="BMA10229_0387"
FT   CDS_pept        complement(390573..390686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0387"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99951"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWZ2"
FT                   /protein_id="ABM99951.1"
FT                   /translation="MPIDPNLRDRPCRRPTVACGPAVAARVSWRRRAGYRP"
FT   gene            390910..391422
FT                   /locus_tag="BMA10229_0388"
FT   CDS_pept        390910..391422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99936"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWZ3"
FT                   /protein_id="ABM99936.1"
FT                   /translation="MIYGSNELYAAMRQRRDRLPRAHPADGYGAPARLKSGMGCTECGA
FT                   LYDDGRWSWHAAAGALLQIVCPACRRIRERASAGELVLEGGYFARRRDDIVALLRRHAG
FT                   DDINARPLGRILSIDALPARMVVRTKGSPLVHRLTEALVRTHRGDLEIDYREGEDTLRA
FT                   HWMRDAA"
FT   gene            391476..393476
FT                   /gene="hflB"
FT                   /locus_tag="BMA10229_0389"
FT   CDS_pept        391476..393476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflB"
FT                   /locus_tag="BMA10229_0389"
FT                   /product="ATP-dependent metallopeptidase HflB"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00408"
FT                   /db_xref="GOA:A2RWZ4"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWZ4"
FT                   /protein_id="ABN00408.1"
FT                   /translation="MKSETGYMGFVVVLVFMVLLALQLATLSAPATQIAYSDFRKLAAA
FT                   AQLDDLEVSPTRITGVLRSASAAAALPASDAEAIKRAGTPWRFSTKRVTDERLIDTLAA
FT                   TGTRYRGADDDTWIGTLASWIVPIAVFALVWNLMLRRPRGGLQDWSGVGKSKPRVYVEA
FT                   KTGIDFDDIAGIDEAKAELQQIVAFLRAPARYQRLGGKIPKGVLIVGAPGTGKTLLAKA
FT                   VAGEAGVPFFSTSGSSFVEMFVGVGAARVRDLFEQAQQKAPCIIFIDELDALGKVRGAG
FT                   LASGNDEREQTLNQLLVEMDGFQANSGVILMAATNRPEILDPALLRPGRFDRHIAIDRP
FT                   DLTGRRQILSVHVKHVKLGPDVDLGELASHTPGFVGADLANIVNEAALHAAELDKPAID
FT                   MSDFDEAIDRAMTGMERKSRVMSEREKITIAHHEAGHALIAQTRAHSDPVKKVSIIPRG
FT                   IAALGYTQQVPTEDRYVLRKSELLDRLDVLLGGRVAEEIVFGDVSTGAENDLERATEMA
FT                   RHMVARYGMSERIGLATFGDADTQGLSPLVWQRGGERCSESTATRIDDEIQRLLAEAHD
FT                   RVSRTLKERRGALERIAGYLLEHEVVDHDKLVRLVNDEPTPEPGARDPGGDAAKRSGIG
FT                   AAPAKPPAEVGSAELRDPARKADNADHSVPQ"
FT   gene            393482..393607
FT                   /locus_tag="BMA10229_0390"
FT   CDS_pept        393482..393607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0390"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99106"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWZ5"
FT                   /protein_id="ABM99106.1"
FT                   /translation="MRDPPPAAHGVGRRGPSGVGSRESRVGAARGRRSPPVARAR"
FT   gene            complement(393615..394223)
FT                   /locus_tag="BMA10229_0391"
FT   CDS_pept        complement(393615..394223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0391"
FT                   /product="peptidase, S54 family"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99429"
FT                   /db_xref="GOA:A2RWZ6"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWZ6"
FT                   /protein_id="ABM99429.1"
FT                   /translation="MTLAIVVLNVIGFLVELAAPERVLSLFALWPPRAGAGLPPAAAPA
FT                   FHVWQLVTYSALHAGLSHLLFNMLGLVMFGRDVERALGRARFGTLYLASVVCGALTQLA
FT                   LARYSAAAAAPTIGASAGVFGVLAAYALLYPSRRVVLLIPPIPMRAWVFALLYAGGELL
FT                   LGVAGAASGIAHFAHLGGMFGAIALMLAWGRPRSEWPVQ"
FT   gene            complement(394220..394477)
FT                   /locus_tag="BMA10229_0392"
FT   CDS_pept        complement(394220..394477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0392"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99574"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWZ7"
FT                   /protein_id="ABM99574.1"
FT                   /translation="MFHVAACAVSAAAAVRSGPAAAAMVAARITWITLTALNGGPAAAR
FT                   AAAPRTRARRRAEWAAPARMAPRDALIMTVDASLFRPWPP"
FT   gene            complement(394523..395878)
FT                   /locus_tag="BMA10229_0393"
FT   CDS_pept        complement(394523..395878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0393"
FT                   /product="transporter, basic amino acid/polyamine
FT                   antiporter (APA) family"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98848"
FT                   /db_xref="GOA:A2RWZ8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWZ8"
FT                   /protein_id="ABM98848.1"
FT                   /translation="MKHSVRHPFHPSTPLPASASAPLRAAAPRQLPFALLTALVIGSMI
FT                   GSGIFSLPQNMASGAGAGAIVIGWAITGVGMLMLALVYQTLAHRKPELDNGVYAYAHAS
FT                   AGDFVGFNSAWGYWVSAWIGNVGYLVIVFGTLGYAFPAFGDGNTRAALAFQPHRFTTDF
FT                   WGNVHLPGVLDQVKSTMLITVWVFIGIEGASVYSARAKNRDDVGRATIVGFVVVLLLLM
FT                   AVSLLSLGIVSQPELAAMKNPSMAGVLEKAIGRTGVAIAGVGLLVSVGGALLAWTLLAA
FT                   EAMFTPAKDGVMPAFLSRENAHGVPANALWATNGLVQLFLLVTLVSNATYQALISLATS
FT                   MILVPYLFSAVYALVIAIKGEGYAPGEAVRVRDATIGAVATVYCGWLLYAAGPKYLLLS
FT                   ALLYAPGALLYAWAKRERGERPFKPFEAAILIALVAFASLAGWLVAAGRISL"
FT   gene            complement(396146..396631)
FT                   /locus_tag="BMA10229_0394"
FT   CDS_pept        complement(396146..396631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0394"
FT                   /product="YbaK / prolyl-tRNA synthetases-associated domain
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF04073"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99997"
FT                   /db_xref="GOA:A2RWZ9"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWZ9"
FT                   /protein_id="ABM99997.1"
FT                   /translation="MSMSVTLQECLRQKASRYEVIHHPYSHSNMEAAAAAHVPGDRLAK
FT                   TVLLEDAQGYVAAVLPTTHAVRLSELWAKTGRHLVLAKEVELRELFKDCDVGALPPVCM
FT                   AYGMQTFLDDSLARQPDVYFEAGDHEELVHMDRDEFLALMDKAERASFSHKIQGVVS"
FT   gene            396958..397446
FT                   /locus_tag="BMA10229_0396"
FT   CDS_pept        396958..397446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04008"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98780"
FT                   /db_xref="InterPro:IPR007153"
FT                   /db_xref="InterPro:IPR036902"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX00"
FT                   /protein_id="ABM98780.1"
FT                   /translation="MLQLLSVAIDKPDTANFILGQTHFIKSVEDIHEALVGAVPGIRFG
FT                   LAFCEASGKRLVRHSGTGAALTELACRNALAIGAGHCFLVFLGDGFYPLNVLNAIKAVP
FT                   EVCRIFCATANPTEVVVAQSDQGRSILGVVDGFSPLGIETDEDVRWRKDLLRNIGYKA"
FT   gene            complement(397434..397604)
FT                   /locus_tag="BMA10229_0395"
FT   CDS_pept        complement(397434..397604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0395"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00381"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX01"
FT                   /protein_id="ABN00381.1"
FT                   /translation="MRTGPGLHGEAATDDRQSITGNPQSTHRTQARKRARFGQSPRDPA
FT                   QDAATRGGYAL"
FT   gene            398101..398256
FT                   /locus_tag="BMA10229_0397"
FT   CDS_pept        398101..398256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0397"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98570"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX02"
FT                   /protein_id="ABM98570.1"
FT                   /translation="MKETNMSLAAQDLIELLRLAQGGAGALTLHLLREIAGNLIAFGVA
FT                   DCRGGC"
FT   gene            398654..398938
FT                   /locus_tag="BMA10229_0398"
FT   CDS_pept        398654..398938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0398"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98613"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX03"
FT                   /protein_id="ABM98613.1"
FT                   /translation="MKRATSLAFAALFALAASSAFAHGMPERVFKERKPIRADARQEPS
FT                   QRDASSAGCASGCPAGAALSRQDDRASGASPSSVGVEAAAGVHPAVNGG"
FT   gene            399174..400559
FT                   /gene="czcC"
FT                   /locus_tag="BMA10229_0399"
FT   CDS_pept        399174..400559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcC"
FT                   /locus_tag="BMA10229_0399"
FT                   /product="cobalt-zinc-cadmium resistance efflux protein"
FT                   /note="identified by similarity to SP:P13509; match to
FT                   protein family HMM PF02321"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99927"
FT                   /db_xref="GOA:A2RX04"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX04"
FT                   /protein_id="ABM99927.1"
FT                   /translation="MPKRIFAALVSAAIAASAVQAQAQPAPAPSAPDGPAAAPPDARAA
FT                   SVSVTPAVSPAPISTSTVSVAPPALSLDDALALAAANNPLLKSARSSADASVGALVQAG
FT                   ARPNPTVSFLQEGFGRQERTTTAVVSQPIELGGKRRSRVDAASYGRESALASLDGRAAA
FT                   LRADVTGAFYGVLAAQRQLQVADESAAIAARSADMADKRARAGKVSPVEATKARVAQTA
FT                   AQIELSNAQTRVAAALARLANATGSADVRGRAASGDLDALPAAEPLPQLLGRLDDAPLA
FT                   RAAKADMLRTNAQIAIERAKRVPDITVSAGVKHVVTGGAPDNQAVVGISIPLPLFDTNR
FT                   GALLEAVHNAAKASADFDAERARLRLDLTQAYANYERATGEARRLKADVLPAARQSLDA
FT                   MSRGYQLGKFGFLDVLDAQRTLFDAQSRYVQALADAHQSYADIERVVGAPARDASRPLA
FT                   QLR"
FT   gene            400570..402039
FT                   /gene="czcB"
FT                   /locus_tag="BMA10229_0400"
FT   CDS_pept        400570..402039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="BMA10229_0400"
FT                   /product="heavy metal resistance protein CzcB"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00393"
FT                   /db_xref="GOA:A2RX05"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX05"
FT                   /protein_id="ABN00393.1"
FT                   /translation="MQRKPLILAGAAAAGALAIVLALARAPSTSSAPAASGAAAAAPAS
FT                   GATGPHGGAMFAQGALSAEIVLSEKPDDARLVVYPFVDGKPVEQGAAVSATLTRHDGER
FT                   VALQFAQAGAKYTSAQPIARPHVFDASIDVRIGARSASFPFSRADGAIALDDAQLGAAR
FT                   IGIARAGPAQIITSFQLPGEIKFNEDRTAHVVPRVAGIVERVAVSIGENVKPGQVLAVI
FT                   ASTDLADRRSELMTAERRLQAARTSYAREKTLWEERISAEQDYLQAQVQLREAEIAAAN
FT                   ARQKLAALNASAASGALNRYELRAPFAGTIVEKHIAPGEAIAADANVFVVSDLSSVWAE
FT                   MAVPAQRLNDVRVGRHATVSAAAFESKSSGPIAYVGALLGEQTRTAPARVVLPNPDGAW
FT                   RPGMFVNVTVDAGAQNVPVAVESDALQDVDGAPAVFVRTPKGFVAQAIETGRRDERRVE
FT                   IVKGLAPGQTYAAANSFVLKAELGKGVADEH"
FT   gene            402085..405318
FT                   /gene="czcA"
FT                   /locus_tag="BMA10229_0401"
FT   CDS_pept        402085..405318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcA"
FT                   /locus_tag="BMA10229_0401"
FT                   /product="heavy metal efflux pump CzcA"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00914"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98942"
FT                   /db_xref="GOA:A2RX06"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX06"
FT                   /protein_id="ABM98942.1"
FT                   /translation="MFERLIRFAIAHRWLVMLAIVAAASLGVYSYQKLPIDAVPDITNV
FT                   QVQVNTSAPGYSPLEAEQRITYPVETAMAGLPNLEQTRSISRYGLSQVTVIFKDGTDIY
FT                   FARQLVNERIQEAKDKLPPGIAPAMGPTSTGLGEIYLWTVEADAGARKPDGTRYTSADL
FT                   RELQDWVVRPQLRNVPGVTEVNSIGGYVKEYRVAPNPTKLMSYGLTLADVVRALERNND
FT                   NVGAGYIEKRGEQYLVRVPGQARSAEDIANIVLVNAGGVPVRMKDIGAVDLGRELRTGA
FT                   ATANGEEVVLGTVFMLMGENSRTVAKAVAARMADVNRTLPAGVRAIAVYDRTVLVEKAV
FT                   RTVKKNLLEGAVLVIAVLFLFLGNIRAAVITALVIPLSMLMTFTGMVNAKVSANLMSLG
FT                   ALDFGIIVDGAVVIVENCIRRLAHAQQAAGRPLTRDERFAEVFAASQEARRALIFGQLI
FT                   IMVVYLPIFALTGVEGKMFHPMAITVVMALAAAMALTVTFIPAAVALFIGRRVEEKENR
FT                   LMSAAKRLYAPVLDAFVARPGQVLAGATAVVALSLVLATRLGSEFIPSLNEGDLAVSAQ
FT                   RIPGTSLTQSVAMQQSIEKTLKARFPEIDRVFARTGTAEIAADPMPPNLSDGYIMLKPA
FT                   DQWPDPRKSRDALRGEIEAVLAQLPGNAYEFSQPIQLRFNELISGVRSDVAVKIFGDDM
FT                   ATLNATGEQIAAALQKVPGASEVKVEQTTGLPVLTVNLDRDKLARYGVTVGDVQDTVAA
FT                   AVGGRKAGLLFQGDRRFDIVVRLPDELRTDVEAIKRLPIALPLAAPAGASGPLAQAPYV
FT                   PLAELATVDTSPGPNQISREDGKRRVVVSANVRGRDVGSFVADARERIASDVRVPAGYW
FT                   LSWGGQFEQLQSASERLKIVVPLALAMVFVLLFVMFNNAKDGLLVFTGIPFALTGDVVS
FT                   LWLRGIPLSITAAVGFIALSGVAVLNGLVMISFIRNLRDEGAPLDAAVREGALTRLRPV
FT                   LMTALVASLGFLPMAFATGTGAEVQRPLATVVIGGILSSTALTLLVLPVLYRVAHAAPP
FT                   RATLGARAAGWLARLAPAAVLRRRRESSR"
FT   gene            405325..406014
FT                   /gene="irlR"
FT                   /locus_tag="BMA10229_0402"
FT   CDS_pept        405325..406014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="irlR"
FT                   /locus_tag="BMA10229_0402"
FT                   /product="transcriptional activator IrlR"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486; match to protein
FT                   family HMM TIGR01387"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98946"
FT                   /db_xref="GOA:A2RX07"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX07"
FT                   /protein_id="ABM98946.1"
FT                   /translation="MRILIVEDEPKTGMYLRKGLTEAGFIADWVEDGVTGLHQAETEEY
FT                   DLIILDVMLPGHDGWTVLERLRRAHSTPVLFLTARDDVGDRVKGLELGADDYVVKPFDF
FT                   VELVARVRSILRRGQARESTVLRIADLELDLTRRKATRQGDVVLLTAKEFALLWLLMRR
FT                   EGEILPRATIASQVWDMNFNSDTNVVDAAIRRLRSKIDDAYEPKLIHTVRGMGYVLEVR
FT                   SASAPSR"
FT   gene            406011..407405
FT                   /gene="irlS"
FT                   /locus_tag="BMA10229_0403"
FT   CDS_pept        406011..407405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="irlS"
FT                   /locus_tag="BMA10229_0403"
FT                   /product="sensor histidine kinase IrlS"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR01386"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00031"
FT                   /db_xref="GOA:A2RX08"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX08"
FT                   /protein_id="ABN00031.1"
FT                   /translation="MIRRLLPRTLRARLTALIILSTAATLALSGVALYSALHNRLVGMS
FT                   SYEMSATLAAMRTHLANVANVDDIPRKSDLWIDQLHGHQNLDLAIYDTDGRLRFATRGF
FT                   VAPRPALGAPQTRVPASAAPAGATFSYLADDAPLRGGNPRTARIVVQYDGKNDHALLRA
FT                   YAYTVVVIEVLAVVLTAALAYGIAMLGLSPLRRLVARAEQMSSSRLAQPLPELDTSGEL
FT                   KEMEHAFNAMLKRLDESFVRLSQFSSNLAHDMRTPLTNLLAEAQVALSKPRTADEYRDV
FT                   IESSIDEYQRLSRMIEDMLFLARSDNAQSHLAIRTLDAAAQAERVAGYYEPMAEDAEVS
FT                   IVVRGKAEVRADALLYHRALSNLISNALNHAPRGSTITIECAQAADAATISVSDTGRGI
FT                   EAPHRERIFERFYRVDPARHNSASGTGLGLAIVRSIMENHGGTCGVDSEPHVRTTFWLK
FT                   FPAHAA"
FT   gene            complement(407509..407781)
FT                   /locus_tag="BMA10229_0404"
FT   CDS_pept        complement(407509..407781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0404"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98602"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX09"
FT                   /protein_id="ABM98602.1"
FT                   /translation="MNTKTTIVWVTAAALTALALSPAAFAQGKTRDEVRQELIRAQHEG
FT                   VVPAGKNDYPPSAALVARNKELHAISVHGGKTDLALDQHDQTVAR"
FT   gene            408191..408454
FT                   /locus_tag="BMA10229_0405"
FT   CDS_pept        408191..408454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0405"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00187"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABN00187.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            408478..409311
FT                   /locus_tag="BMA10229_0406"
FT   CDS_pept        408478..409311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0406"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99837"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABM99837.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(409492..409608)
FT                   /locus_tag="BMA10229_0407"
FT   CDS_pept        complement(409492..409608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00466"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX12"
FT                   /protein_id="ABN00466.1"
FT                   /translation="MSPKRDGRPAMRAPRALEHRARRTAESEATERRGRTEV"
FT   gene            409735..409983
FT                   /locus_tag="BMA10229_0408"
FT   CDS_pept        409735..409983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0408"
FT                   /product="putative liporotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98739"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX13"
FT                   /protein_id="ABM98739.1"
FT                   /translation="MKAPIIAIAFGIALAACAPLRQDSRPGEAGPPIAAPNRGGGNTPP
FT                   SGARRAANEVVDYAGRPCVNQTLYVKTHPCIFPRLQR"
FT   gene            410380..411849
FT                   /locus_tag="BMA10229_0409"
FT   CDS_pept        410380..411849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0409"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94852"
FT                   /db_xref="GOA:D0IUQ8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0IUQ8"
FT                   /protein_id="ACX94852.1"
FT                   /translation="MSTLDLDAPISTPIRTASDVSRLINASGARANHARVIVLLALGGV
FT                   FLDAYDLTTLSYGIEDVTREFGLTPALSGLVSASIMIGTILGSLLGGWFTDKVGRYRVF
FT                   MADMLCFVVAAIVAGLAPNVEVLIAARFVMGLGVGIDLPVAMAFLAEFSKFGGRGNKAS
FT                   RLAAWCPMWYAASSVCFLIVFGLYFALPAEHARWLWRASLIFGAVPALAIIAVRGRYMN
FT                   ESPLWAANQGKLRDAARILRESYGIRAHAADDTPRAAPSQPPVSFRVLFRQPYLPRTLV
FT                   ASAMNLCIPFEYTAIAFFLPTILTQFLGAGVFETIAATLALNVLFALTGGLLGMRLAYR
FT                   LPSRRVAIAGFALQAAALVTLALLGHPQTALGIGAAVLMLGLWLFAEGFGPGAQMMIYP
FT                   ALSYPASIRGTGLGFGRALTGIGSAFALFVLPILNARLGAGMFWIVAIAAFVPIVFLAA
FT                   IRFEPTARDVDVDIDAGSRAQGDRARVRAAA"
FT   gene            412069..413328
FT                   /locus_tag="BMA10229_0410"
FT   CDS_pept        412069..413328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0410"
FT                   /product="monooxygenase, DszC family"
FT                   /note="identified by match to protein family HMM PF02770;
FT                   match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00490"
FT                   /db_xref="GOA:A2RX14"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX14"
FT                   /protein_id="ABN00490.1"
FT                   /translation="MSHAPADPTRSTGADYASLAARFRPIFARIAEGAIERDRTRALPH
FT                   EPIRWLKEAGFGALRVPVHAGGAGASVPQLVQLLIELAAADSNLPQALRGHFAFVEDWL
FT                   NAPPDAARRAWFDRFASGQLVGNAWTEVGDVALGEVRTKVAKRDGGWVVNGEKYYSTGA
FT                   IFADWIDVYAQRTDDGGPVIAAVAARQDGVILGDDWDGFGQATTGSGTTRFVDAHVDEA
FT                   NVIDFARRFKYQTAFYQLFHLATLAGIGRAVERDASALVRGRRRVYSHGNAPRVSDDAQ
FT                   ILQVVGEISAWAYAAEAIALRAAQPSQRAYEARVGGDAAAEHDANVAAEIESAQGQLVV
FT                   SELVLRAATHLFDALGASATRATNALDRHWRNARTVASHNPLVYKARIVGDRAVNGTEP
FT                   PYVWQIGAGPGGPREPEQAA"
FT   gene            complement(413430..413579)
FT                   /locus_tag="BMA10229_0411"
FT   CDS_pept        complement(413430..413579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0411"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99012"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX15"
FT                   /protein_id="ABM99012.1"
FT                   /translation="MISPSTNGAFASGSPSKATRGSTWDSVLNIHHTLTFSGAGGLNVA
FT                   GPQT"
FT   gene            complement(414065..414790)
FT                   /locus_tag="BMA10229_0412"
FT   CDS_pept        complement(414065..414790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0412"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04140"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99738"
FT                   /db_xref="GOA:A2RX16"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX16"
FT                   /protein_id="ABM99738.1"
FT                   /translation="MFAMEHEVRPSMATTRRHATATALAAAARPCAAPHADSFLGILIE
FT                   VFARVVAALALGVFAYAAYLQWRLDPSRITLILLAVSTTLTVGLSLFAEPPKKRDWSPL
FT                   ALFFSVGGTFYYLVFQLTASRQLLPEAAGAAIQLIGLFWQLFAKVSLRKSFGILPANRG
FT                   IVSRGAYRFVRHPMYLGYLIIDAGFLLTNFSARNLIAVALQIGLQLGRIRREERLLSED
FT                   AAYRAYRRSVRYRVIPGLF"
FT   gene            415002..415337
FT                   /locus_tag="BMA10229_0413"
FT   CDS_pept        415002..415337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0413"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98724"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX17"
FT                   /protein_id="ABM98724.1"
FT                   /translation="MPARNFALAERFREDFVSFDAARAAAFSDWPAISRFRFNGASSGL
FT                   FSIALKFICDCPIPIETTRRRSRVPADIGVGIDAREAAGPASARAGCVRFPPRIFACAA
FT                   RAFAAIP"
FT   gene            415465..416475
FT                   /locus_tag="BMA10229_0414"
FT   CDS_pept        415465..416475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0414"
FT                   /product="ribose ABC transporter, periplasmic
FT                   ribose-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98485"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX18"
FT                   /protein_id="ABM98485.1"
FT                   /translation="MLFAVALAIGAAPACASPAAGAAPPGPRAGHAPLSLAGKRIGITA
FT                   AGTDHYWDLQAYQGAVDEVKRLGGTPIALDAGRNDSRQIAQIQTLIAQQPDAIIEQLGT
FT                   ASVLEPWLRKIRQAGIPLFTIDTASPSSLNVVTSDNFAIGSQLALKLVNDIRGEGNVLV
FT                   FNGFYGVPVCAIRYDQLKAVLKWYPKVKIIEPELRDVIPNTAQNAYAQISQLLQKYPKG
FT                   AISAIWAAWDIPQVGATQAVDAAGRREIRTYAVDGSPEAVALVRNPTSSAAAVVAQQPA
FT                   LIGRTAVRNVARYLAGDRSLPAYTFVPSVLVTKDDAGVARPALGQTPAAAGLARR"
FT   gene            416472..418289
FT                   /locus_tag="BMA10229_0415"
FT   CDS_pept        416472..418289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0415"
FT                   /product="ribose transport ATP-binding protein rbsA"
FT                   /EC_number="3.6.3.17"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99098"
FT                   /db_xref="GOA:A2RX19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX19"
FT                   /protein_id="ABM99098.1"
FT                   /translation="MKAALTTAAASAAAAPDAAGAPLALDVRRVVKRFGGVAALRGASL
FT                   AVTRGTVHGLIGQNGAGKSTLVKLLAGLHAPDEGEITVGGVPFASGGGGSRASAGAARR
FT                   HSTGIGFIHQERLLPATFTVAEALFFPHPPTLGGRASRLARLLPLDVKRMRRDCRAVLH
FT                   TQFGLDLAPDRLIGELSVAEQQIVQITRALLGRHEILVFDEPSAALVSSEVDRLLRTIE
FT                   RLRANGHTILYVSHYLDEIARVCDRVSVLRDGADVAHFEARAVSRDTLVAAMIGAPQPA
FT                   AAAPSAATARAAARADARVSTRADAWGDDPHRAPAGADPARPGARAAPGAIALEARDLA
FT                   LPGRFGPLSLAVRRGEIVGLTGGLGSGGKDVIRALFGLARGVRGSIAVDGRPARVRRPH
FT                   DAVAHGIALVPENRAAHGVALTLPVRENVVLADLSSVSRFGLVHGRREADVARALIRRL
FT                   DIRPARPDLPARFLSGGNQQKVALAKWLGRASTVYLLDEPTVGVDVGAKAQIYRLIDAL
FT                   ARAGAAVLLFSSDLTELLDVTDRVYVMARGEIVAQCASAETTTQDVLAWATLARDARPG
FT                   GGAGAHDAAARTGTPGAAGAASSAAKVAT"
FT   gene            418286..419017
FT                   /pseudo
FT                   /locus_tag="BMA10229_0416"
FT                   /note="ribose transport system permease protein RbsC,
FT                   internal deletion; this gene model represents a disrupted
FT                   reading frame with multiple genetic anomalies"
FT   gene            419010..419990
FT                   /locus_tag="BMA10229_0417"
FT   CDS_pept        419010..419990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0417"
FT                   /product="ABC transporter, carbohydrate uptake
FT                   transporter-2 (CUT2) family, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00312"
FT                   /db_xref="GOA:A2RX20"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX20"
FT                   /protein_id="ABN00312.1"
FT                   /translation="MRDATDRLSRLAALGALAAVLAFFAVAAPGFATLANVERVLVNNF
FT                   ALLAIAALGMTLALSIGAIDLSLGTAIDVASLAFVCALAHRAGCASAALAGLGAALALG
FT                   AANALLVTRLGIAPFLATLGTLFIGQTIQQLATDGGQPIYLLSTAPPPAFDALAHGVWL
FT                   GVAAPLWIVAALAGALHVALECSTLGRQARALGAQPGVARHSGLRVGALAAGVFVASAL
FT                   VYGVAGLVLSSTVRSYAPQAGNAYLLNAIGATFIGATLSEARRPNVAGTLLGVLLVSFV
FT                   ANGLLLIGWNFYWQQVASGALVFAVLALGSGVGRERRARDAGQSG"
FT   gene            complement(420202..422967)
FT                   /locus_tag="BMA10229_0418"
FT   CDS_pept        complement(420202..422967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0418"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07660; match to protein
FT                   family HMM PF07715; match to protein family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98933"
FT                   /db_xref="GOA:A2RX21"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX21"
FT                   /protein_id="ABM98933.1"
FT                   /translation="MRTRAACLIEIFSPGLSCFRCSRDMGNEGCIPPIVNESSIMDSIC
FT                   NRRPRRAHAGVCADTAHAPAGLPEAAQPAARLGAGRPRDAAAPRCARQATSHTSHASHT
FT                   LHAPCMPQFAPRRVVARVAAAALFSACAAPGVSGAAEPAAATRGYDIPAGPLDAALTRF
FT                   GREAGILLSFPGELTTGLRSPGLHGRADPAAALDRLLTGTGLVALRQPSGGYTLARLPG
FT                   PAAAGADAALAADTTLPTVAVRASGPHADSYRPPREAAGLRSDAPLAEVPQAVAIVAQQ
FT                   VLRDQRPRNLDDALANVSGITQGNTLGSTQDTVMKRGFGDNRDGSVMRNGMPIVQGRSL
FT                   NATTDSVEVLKGPASLLYGIMDPGGVINVVTKQPQLARRHAISALGSTYGGGRNGGELT
FT                   FDSTGAIGESRVAYRLIVDQTNEQYWRNYGEHRETLVAPSLAWYGRDTQVVLSYEYRRF
FT                   LMPFDRGTALDPRTNAPLAIPARRRLDEPFNDMRGESNLAQLAIDHQLAPDWKVHVGYS
FT                   YNRETYDANQIRITAVDPLKGTLTRSNDATHGSRSTDSYGIAYVDGRVTLAGMRHDVQF
FT                   GVDGEYRQVYRADMLRQPIKTPFSYLNPTYGLVPPSTSVSASDSDQSDTLHTASLFFQD
FT                   SIHLSERWMLVGGARWVRYSQLAGRGRPFQVNTNLSGTKWLPRAGIVYKWNDALSLYGS
FT                   YTQSLKPTSKIAPMAGGYVIDGSTAPEEGASWELGAKLDMPGGLAGTLAFFDIDKKHVL
FT                   VSQYDDATNQTAWRTSGRARSRGIELDVSGRIGARWNVIASYAYIDAKTTEDPLYADNR
FT                   LWNVARHTASLAAVYDVGTVLGGDDLRIGAAGRYVGARPGDSANSFTLPAYATADAFAT
FT                   YDTRLGKQKLQFQLNVKNLFNRTYYPSSVNRFFVSVGDARQVSLLTTLQF"
FT   gene            complement(422974..423918)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0419"
FT                   /note="FecR family protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF04773"
FT   gene            complement(423973..424467)
FT                   /locus_tag="BMA10229_0420"
FT   CDS_pept        complement(423973..424467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0420"
FT                   /product="RNA polymerase sigma-70 factor, ECF family"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF08281; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99118"
FT                   /db_xref="GOA:A2RX23"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX23"
FT                   /protein_id="ABM99118.1"
FT                   /translation="MRLQREIAALYTGHRGWLHGWLSKKLGCGERAADLVHDTFIRLLA
FT                   RDEPIDAAEPRAFLTTVAQHVLYNHWRRERLERAYLDALAQWPEAVAPSPETRAVLFET
FT                   LVEVDRMLDGLPAVVRRAFLLAQLDGMTHAQIAAELRVSLATVKRYLVKAGAQCYFAIA
FT                   A"
FT   gene            complement(424756..424983)
FT                   /locus_tag="BMA10229_0421"
FT   CDS_pept        complement(424756..424983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99852"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX24"
FT                   /protein_id="ABM99852.1"
FT                   /translation="MTGKGGAAANPRAATAIVVAASGSISPASRRTALSTMKTTANATA
FT                   RRRDGGTMKAPKEPIASGGAVLAGSVESPV"
FT   gene            complement(424980..425339)
FT                   /locus_tag="BMA10229_0422"
FT   CDS_pept        complement(424980..425339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03640"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99237"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="InterPro:IPR014558"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX25"
FT                   /protein_id="ABM99237.1"
FT                   /translation="MIRNVLIALVCAAPVAALAEPPKAAGGMVVDDDGMTLYTFDRDTM
FT                   PGKSACTGGCTANWPAALADAYDKPGGALGFIAAAGGKHQWTYKGRPLYRFSGDAKPGQ
FT                   HTGDGFGGMWHVARP"
FT   gene            complement(425379..426248)
FT                   /locus_tag="BMA10229_0423"
FT   CDS_pept        complement(425379..426248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0423"
FT                   /product="YceI like family protein"
FT                   /note="identified by match to protein family HMM PF04264"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98609"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX26"
FT                   /protein_id="ABM98609.1"
FT                   /translation="MAGASGPPRTPGLARTPAAVTDAPGAATAGALAASPPAATRYRLD
FT                   PRHSGVTFRVDNFWHAHLTMRFARMRAELSDVGDDRLASRVDVTVDAASLGANVPFVAT
FT                   LVKGSAMLDVARYPEIRFVGTRFERTGATTGVLTGELTIRAMTHPITLAVRFDAGRQLE
FT                   PDTGARAEREGDESGESGESNPAERRAGQGRRAAELRDGRPRDAGPGVADSRDAMRRET
FT                   DSGSAHRGAEPPERIARAAPDAARPLAFVADGHFSRTAFGLSRWLPAVGDDVRLRIRAE
FT                   FVRARADP"
FT   gene            complement(426434..427258)
FT                   /locus_tag="BMA10229_0424"
FT   CDS_pept        complement(426434..427258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00194"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX27"
FT                   /protein_id="ABN00194.1"
FT                   /translation="MSDDPDLCVAPESDEPGLLALSAFVDGELPDAQSRAMARRLASDP
FT                   RAAGIAAHYRAQRAALRALFADPVAPRHGPCVAWPVRTPWWRRAAFAGGALAAGVALGW
FT                   LGGALAPRFAPSAALQWVAPAAAQRAFARDADLAYALYAPDARHPVEIAVGRDGAPLAW
FT                   LSARVGRRIAAPSLREYGFALLGARLLPGAGGPAAQFMYENAAGERLALYVSASAQREA
FT                   AVRPWRDGGRHTFYWVSERTAYALSGQLDEGRLRTIAADVCSELGGHPQRWR"
FT   gene            complement(427255..427776)
FT                   /locus_tag="BMA10229_0425"
FT   CDS_pept        complement(427255..427776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0425"
FT                   /product="RNA polymerase sigma-70 factor, ECF family"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98865"
FT                   /db_xref="GOA:A2RX28"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX28"
FT                   /protein_id="ABM98865.1"
FT                   /translation="MSFESDVVGWLPQLRRYARALTGDPAWADDLVQDTVERAFSRMRA
FT                   FRPDSNLRAWLLTILRHLYIDQLRARREFAVDDDEGPWRTLEAPAGQIDALVLRDVQRM
FT                   LYRLPLEQREVLLLVCVEELSYQDASAVLGVPVGTVMSRLSRARERMRALLTDAPLRPP
FT                   LSLTAARHHR"
FT   gene            complement(427792..427950)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0426"
FT                   /note="putative lipoprotein; this region contains one or
FT                   more premature stops and/or frameshifts"
FT   gene            428635..429630
FT                   /locus_tag="BMA10229_0427"
FT   CDS_pept        428635..429630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0427"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98538"
FT                   /db_xref="GOA:A2RX30"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX30"
FT                   /protein_id="ABM98538.1"
FT                   /translation="MPERSDRLDFYIRDEAARRAITEPHRHAYFQIQFNLGGDTEQRIG
FT                   GLTRAFPRGALAFVLPYREHLIAHPPGAHFVVINFSQTFLRADLDVDPLDLEDVCAQRA
FT                   PELAPFRFQEHLDFILTGAAFDDARRLAQRMLEANRARTFGSVPLLRGYLLQLIGLVCT
FT                   QYAGPLTKLAQSGAHRTGRRDAFARVLRHVRANLTNDALTLAGTARAACLSPNYLAHLI
FT                   RKETGSTFTDLVTARRIALAQSLLAHTTRRIADIAHAVGFRDEGYFSRRFRACVGVSPK
FT                   EYRDANGAPGPADALDSVNTAGPRAAPGRGETRGAAGAKSPARAAAKPRA"
FT   gene            429639..429815
FT                   /locus_tag="BMA10229_0428"
FT   CDS_pept        429639..429815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00498"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX31"
FT                   /protein_id="ABN00498.1"
FT                   /translation="MKTPHSSHRRAGGAGIVDVSTARAAAPAPARGRAAHRPHAPSLSL
FT                   SLSLFDTFSETRR"
FT   gene            429812..430516
FT                   /locus_tag="BMA10229_0429"
FT   CDS_pept        429812..430516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0429"
FT                   /product="FAH family protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99905"
FT                   /db_xref="GOA:A2RX32"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX32"
FT                   /protein_id="ABM99905.1"
FT                   /translation="MTDYVFAPPAVPSVEIAGCAARFAVRRVFCVGRNYADHAREMGAD
FT                   PNREPPFFFTKPADAIVPASGTVPYPTLTSELHHEIELVIAIGRGGRAIAADAALDHVW
FT                   GYGVGVDLTRRDLQAEAKKAGRPWDWAKGFDASGPVTALHPAASIGHPQRGRIWLAVNG
FT                   ALRQQGDLADMIWPIPDVIAYASRAVELRAGDLIFTGTPAGVAALQPGERVTGGVDGVA
FT                   SFEFVVGEKPAA"
FT   gene            430692..431600
FT                   /locus_tag="BMA10229_0430"
FT   CDS_pept        430692..431600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0430"
FT                   /product="CAAX protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98718"
FT                   /db_xref="GOA:A2RX33"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX33"
FT                   /protein_id="ABM98718.1"
FT                   /translation="MRPFIRSFVVLFMSGNTFWLAAPWAALFVAALAAVWFPKLRAASV
FT                   GLGALGYAGAFASGLIAPVALAPIALLAAAAYAVAPRRHAAVRVAGHAVFVALALALML
FT                   HWLPGFHNPRVIGPVRFTPDAAPFTMYLNLDKPLVGFWLLWVLPWLRPIDDRARAWRAG
FT                   IVAAAATSAVCLVFALGVGLVGWAPKWPESAWLWLANNLLFVCFAEEALFRGYLQGGLS
FT                   RLLANRVPAAGTVALVAAALLFGAAHAAGGWQWVALATVAGVGYGLAYRAGGLQAAVLA
FT                   HVGLNLAHFGLFTYPMLAVAR"
FT   gene            complement(431947..432651)
FT                   /locus_tag="BMA10229_0431"
FT   CDS_pept        complement(431947..432651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0431"
FT                   /product="MarC family integral membrane protein"
FT                   /note="identified by match to protein family HMM PF01914;
FT                   match to protein family HMM TIGR00427"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99333"
FT                   /db_xref="GOA:A2RX34"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX34"
FT                   /protein_id="ABM99333.2"
FT                   /translation="MARPRERPPITLVRPSRFPMIVDRLISEILFGFTGLMGIINPFGI
FT                   AFLFLERTESLTEAQRAALARKVAINAFIVLLAAFFVGISLEALRIGGGLAVAVAGWQM
FT                   LNEPDVPTGGDTAAQPVEPRNAMARAFFPLTIPLTTGPGSIATAIALNANRTHKLSEFV
FT                   LSSIVSVAVSALAALVIWQTYSRAAFLARYLGTEGTKVAMRVSAFLLLCVGVQIMLTGF
FT                   SEFLRPIADQVK"
FT   gene            complement(432708..433154)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0432"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            433432..434517
FT                   /locus_tag="BMA10229_0433"
FT   CDS_pept        433432..434517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0433"
FT                   /product="calcium/cation antiporter (CaCA) family"
FT                   /note="identified by match to protein family HMM PF01699"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99712"
FT                   /db_xref="GOA:A2RX36"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX36"
FT                   /protein_id="ABM99712.1"
FT                   /translation="MPISSSALPRWTLVAPLAAWLVLALSRVVPAEGFAIAFVAAALAG
FT                   AVFSAVHHAEVVAHRVGEPFGTLVLAIAVTVIEVALIVSVMLSAGPEKAGLARDTVFAA
FT                   VMIVCNGIVGLCLLVGGWRHGEQDFQGRGAAKALAVLASLSVLSLVMPNYLSAAPGPRL
FT                   STSQLAFAGVSSLVLYGVFVFVQTVRHRDYFLIDGSADESVHAVPPSGRTALTSIAFLF
FT                   VSLVAVVLLAKLLSPAVERTVLRLGAPEAAVGIVIAALVLLPEGLAAVGAARANRLQTS
FT                   MNLALGSALASIGLTIPTVAAVFIWTGAPLTLGIGAMETVLLSLTLLVSTLTLSLGRTT
FT                   VLHGVVHLSLFAAYLFLSITH"
FT   gene            complement(434631..434993)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0434"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(435039..436010)
FT                   /locus_tag="BMA10229_0435"
FT   CDS_pept        complement(435039..436010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0435"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98433"
FT                   /db_xref="GOA:A2RX38"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX38"
FT                   /protein_id="ABM98433.1"
FT                   /translation="MDMLDNMRLFVRVVEAGSFTAVAKEIDATTAQVSRAVSNLEAHVQ
FT                   TRLLHRTTRHLGLTESGQRYFERAKSILAEIDYANAEARNALLRPSGKLRIHAMTGLGQ
FT                   SHVVSSIVRYQEDNPDVSVELTLAQRMPNLVEEGYDVSIVSASHLPDSGYVAQTCGTSC
FT                   SVLVASREYLARHGTPTTPDDLAKHVCLRLDTPASPGGEWRLERDDGDETVYALPPAPF
FT                   QANVPDALSVAVRAGRGIGSIALYTALDDIREGRLVRVLPNYRLDTLSVYAVYATRRYL
FT                   DAKIRTFLDHLRTTLAPALENDLKELNRLNGGVGKKALREVA"
FT   gene            436031..436294
FT                   /locus_tag="BMA10229_0436"
FT   CDS_pept        436031..436294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0436"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99474"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX39"
FT                   /protein_id="ABM99474.1"
FT                   /translation="MGNNGRREAASAAMRGRGRLIDRMRGPWDRLGAGIAGGKLCDSSR
FT                   SDRANCTPMRAGALARAHFPHPETPTADRAIGGVGNLYHNDI"
FT   gene            436363..437556
FT                   /locus_tag="BMA10229_0437"
FT   CDS_pept        436363..437556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0437"
FT                   /product="membrane protein, HPP family/CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF04982"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99932"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX40"
FT                   /protein_id="ABM99932.1"
FT                   /translation="MSSSLAFAHRLARGLVRWLWRFVPIPVTLSRRERVRSCAGALVGI
FT                   GCVGVTMRALPGLPGDVPLLVAPMGASAVLLFAVPASPLAQPWSLIGGNLVAATVGVAC
FT                   AQWIADPVLAASVAIAGAIGAMFALRCVHPPSGAVALTAVVGGPAVHALGFRFVAEPIA
FT                   LQSAALLGAALVYHALTGHRYPHGGAARPHADSNAHAAAAPLHARFVRADLEAALKNRS
FT                   EWLDVAPEDLESLLRETELRAYARTFDELSCAEIMSRRPISIAPDTPLPAAMTLLERHR
FT                   IKALPVVDADARVVGIVTRADLSKAAPYATPGFLRNLSARLPRSLVGPAFVARAVMSTR
FT                   VHTVRTTTPIAELVPLFADHGHHHIPVVDADHQLAGIVTQADLIAGLYRQSQVRLAA"
FT   gene            437685..438110
FT                   /locus_tag="BMA10229_0438"
FT   CDS_pept        437685..438110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0438"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00317"
FT                   /db_xref="GOA:A2RX41"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX41"
FT                   /protein_id="ABN00317.1"
FT                   /translation="MGTSMTKPARELRKTDFEQLSEFRYQMRRFERFSERAAQSEGITP
FT                   LQYLLLLHIKGYPERDWATVGELAERLQAQHHGVVALVTRCEALGLVRRRPSDADRRQV
FT                   KVHLQAAGERVLARLAELHRAELKSLRGAFQVPQIDY"
FT   gene            438145..440049
FT                   /locus_tag="BMA10229_0439"
FT   CDS_pept        438145..440049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0439"
FT                   /product="chloride transporter, chloride channel (ClC)
FT                   family"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00387"
FT                   /db_xref="GOA:A2RX42"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX42"
FT                   /protein_id="ABN00387.1"
FT                   /translation="MSIAAPHKRDFASNARLPRIALLALAIGVLSTFAAFALLSLIHLF
FT                   TNLFFFQRFSFAEHSPALNTLGPWAAAVPVAGGIVVGLIARFGSEKIRGHGIPEAIEAI
FT                   LFGKSRMSPKVAVLKPLASGIVIGSGGPFGAEGPIIMTGGAIGSLIAQFVKVTAAERKT
FT                   LLVAGATAGMTAVFGTPVAAVLLAVELLLFEWRPRSFLPVALACAVAGFARAAFFGVGP
FT                   LFPVETAAPTAAALGSCALAGLLSGALACGLSVSLYKIEDRFGKLPVHWMWWPAIGGLA
FT                   VGIGGLIEPRALGVGYDVIGDLLHGHIALQIALAILVVKAVIWVIALGSGTSGGVLAPL
FT                   LMLGAGLGTLLGPVLPGGEPALWPLVCMAATLGATLGAPLTAIVFAFGLTHDANALLPL
FT                   LTATLVAHGFATVAMKRSIMTEKIARRGYHIYREYGVDPLERHYVDEVMTRSAVTIDAD
FT                   LSVEVVRARYFGATQAHRAYPVVRDGVLIGMLDRATLDGSPAAHDGDGQADDARAAKDG
FT                   QADDARAAKMRAADVQMIDMRVADMRVADVLPRRAPLFSLADETCRLVATRLAVHQLER
FT                   LPVVADPDTMRVVGIVSRSDLVKPALRHFDDEHKRERFRRAHPAAFVKRRFAPARKTG"
FT   gene            complement(440190..440330)
FT                   /locus_tag="BMA10229_0440"
FT   CDS_pept        complement(440190..440330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0440"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00357"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX43"
FT                   /protein_id="ABN00357.1"
FT                   /translation="MNRLGRGHRASAKVARAARRVRRRARGSAMTRAFCRAVYREFHRI
FT                   G"
FT   gene            complement(440684..442120)
FT                   /locus_tag="BMA10229_0441"
FT   CDS_pept        complement(440684..442120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0441"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99578"
FT                   /db_xref="GOA:A2RX44"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX44"
FT                   /protein_id="ABM99578.1"
FT                   /translation="MTSEISGKRRWYALVVLCLGVLMIVLDTTIVNVALPSIAAELRFS
FT                   ENALVWVVNAYMLTFGGCLLLGGRLGDLYGHRRLFLAGVTVFTAASLACGLAQTQLMLI
FT                   AARAAQGIGGAVVSSVALSLIMTLFVEPGDWAKAMGVYGFVYAGGGSLGVLLGGLLTSA
FT                   LSWHWVFLVNLPLGAVVYLLSSALLPKARAQATRAPLDIAGAVTAALMLAVYAVVNGNA
FT                   AGWLSARTLSWLGGAAALFAAFVAIEARVAHPLMPLALCMKRNVAIANLIGILWAAAMF
FT                   AWFFLAALYLQRVLGYGPLQIGLAFLPANLIMGVFSLIVSALLVVRFGIRVPIAAGLLA
FT                   AAAGLMLFARAPVGGDFVADVLPGMILLGTGAGIAFNPVLLAAMSGVDPADSGLASGIV
FT                   NTSFMMGGALGLAVLASVATARTDALLAARTAVPAAMAGGYHAAFMLGAAFAIVAALIG
FT                   MRLRAAPNPAAMQGLQGATQ"
FT   gene            complement(442203..443924)
FT                   /gene="prnC"
FT                   /locus_tag="BMA10229_0442"
FT   CDS_pept        complement(442203..443924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prnC"
FT                   /locus_tag="BMA10229_0442"
FT                   /product="halogenase PrnC"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01494"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99041"
FT                   /db_xref="GOA:A2RX45"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX45"
FT                   /protein_id="ABM99041.1"
FT                   /translation="MPAGFPDGFIDEDSTTGWRNTMSNNQVRKYDVVIIGTGIGGTTLG
FT                   AILARHGLRVAMIDSGTHPRFAVGESTIATTTLTLELMAMRFDVPELKHITSIAEVSEN
FT                   VMPSCGVKRNFGFVYHREHTEQNPQEVNQALVVNEVHYFRQDIDAYMLHVAIRYGCDAY
FT                   QNTVVDDIRIDAGGVTVTTRGGLTFEADFVADGAGYRSVLADKLGLRETPCRAKTHARG
FT                   LFTHMIGVKPFDACREVPKALQQPVPWHQGTLHHLFDGGWMWVIPFNNTPESKNPLVSV
FT                   GLMLDPRKHPKPDVRPEQEFADFIAKHPDMARQFADARAVREWVSSGRIQYSASACTGD
FT                   RFCLLSHATGFIDPLFSRGLFNTMQTTNALAGLLIEAAKDRDFSKARFAPVEKLQQGLI
FT                   DFNDRLVNCSYLSWGHYPLWNAWFRLWLLTGNYGQLHLQRVMMKYRQTGDARWLEPADA
FT                   LLPGAFTTLEPIMRLFEAAAVCVERYGAGELSGEAAERAIYALLEENAALLPPFFDFVS
FT                   PAERITWPSTPEKIAALLLEWVERLPEDVRAEYFDYDVRALLQQPVVKDTITADVA"
FT   gene            complement(443944..448614)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0443"
FT                   /note="putative polyketide synthase; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00109; match to
FT                   protein family HMM PF01212; match to protein family HMM
FT                   PF02801"
FT   gene            complement(448598..460090)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0444"
FT                   /note="putative polyketide synthase; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00106; match to
FT                   protein family HMM PF00109; match to protein family HMM
FT                   PF00550; match to protein family HMM PF02801; match to
FT                   protein family HMM PF08241; match to protein family HMM
FT                   PF08242; match to protein family HMM PF08659"
FT   gene            complement(460084..460959)
FT                   /locus_tag="BMA10229_0445"
FT   CDS_pept        complement(460084..460959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99851"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX46"
FT                   /protein_id="ABM99851.1"
FT                   /translation="MGDAAACRLAQRAAHARAVRRRHAAGRRQGPAARGRRRSLEPVRP
FT                   DGDDDLVDGRAGDVGTADLDRRADRQHANPDRRCVRQSGADRRAGRAVHRGRRARRGLP
FT                   EPARRNGGAVRRCAARRGRPGARAPLPHRRPRALARGRRSRASRAHGFPGEDSRPSRRS
FT                   ARHRAASRAASGDPGGRGGRAAARGRRSARRLLRARRRRRARRRGRRAGAGGRAARPSG
FT                   RRAAGLHDSRAVPADRRAADDAQRQAEPQGAREPRHPAARRVVGRAPRRRARRPPPISR
FT                   PACSRSAARC"
FT   gene            461277..463307
FT                   /pseudo
FT                   /locus_tag="BMA10229_0447"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            complement(463283..480853)
FT                   /locus_tag="BMA10229_0446"
FT   CDS_pept        complement(463283..480853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0446"
FT                   /product="putative polyketide synthase"
FT                   /note="identified by similarity to SP:Q05470; match to
FT                   protein family HMM PF00106; match to protein family HMM
FT                   PF00109; match to protein family HMM PF00550; match to
FT                   protein family HMM PF02801; match to protein family HMM
FT                   PF08241; match to protein family HMM PF08242; match to
FT                   protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99202"
FT                   /db_xref="GOA:A2RX48"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX48"
FT                   /protein_id="ABM99202.2"
FT                   /translation="MSFDQTLIADLLDQWLGGQSPDWGRLYPAGRPPIEHAPTYPFARN
FT                   VYWVHAADRTPEPGLAAAPARSRDAAPPLEAGTMPAAAIAVVGATAAATATTAVTARAA
FT                   TTVTNAIDATDATNATNATTATTATTAAAATTAVTASGATGASAAIVLKSAADEARRHF
FT                   TPSRERAPVVLRALAPAAADVADVTDVAASRAAQTQVFDGAAVEAARLAPDAIGAALID
FT                   SLARRLLVSPQSIGARDAFDALGVDSLIGQEWLRELNRTYGTSIDGATLAECGHIGALA
FT                   SRIAGARADAAAPAWVPRAEPPQRAAQCAPDAGTVSASVLASISTAASITASTSTLAST
FT                   SASTSASTSASTSAATSAATSAATSAATSAATSAATSASASTLASASTPASASTLASTS
FT                   TSTSTSASASASAAAAAATTHADDRSAPRITRDALVHALAASLAKALYMDVADIDIEQP
FT                   FMEMGLDSIVGVEWGHQVNRAYGIGINAIQVYDYPNIVTFAGLVESLTNAGGAAGGDVA
FT                   SGVGGSDSNADTDRDRDRDRDRDRDRDRDGDVDVDGDVNSDGVLTRPTGTAEPARAAAA
FT                   ATSPATAEIAAATAAAASSAIAAPPTTAEIMAAASAACAPRGELRREVIDSLAAALYMD
FT                   ASEIDVLQPFVEMGLDSIIGVEWIHALNRRYGTSIEAIQVYDYPNVEKLTELLSKSIDA
FT                   LSPPHARCESDSDVLPGEPMTAATAANDTNDTNDTNNANNANNANKCGVVAAEAAFAAP
FT                   PAAPAAACAAAAIAAPIAPTAPAPLAAPTAKPATLLDELVASLAQALFRPADTIDAERG
FT                   FEAAGLDPIVADEWLARVHRRYGVRVRADEALACPRIADFAALVAARQEAGGAQAAGAA
FT                   PVAAHDARCAARASADARAGDREPIAIVGMSGRYPGARDLDAYWENLAAGRSAIGEIPA
FT                   SRWDVARHFDAHPATPGKVYSKWIGLLDDVDCFDPAFFRISPAEAQEMDPQHRLFLQEG
FT                   YRAFENAGYSADTLDGRNCGVYLGIMNQEYRQLGAGGAVTMLEKSNSFAIGAARLAYHL
FT                   NLKGPAIPVDTACSSALVAIHLACQALRAGEIDMALAGGVTLYLSPDAYIEMCSSGMLS
FT                   PDGRCKVFDDSADGFVPGEGVGAVVLKRLGDAQRDGDPIIATIIGSGINQDGKTNGITA
FT                   PNMASQFELVSGVHGRYGIDPATIRYVEAHGTGTKLGDPIELTALGDAFRVRTAQTGFC
FT                   ALGSVKSNIGHTSAAAGVAGLHKVLLCMRHRTLVPTLHFAVPNRHFDFAASPFYVNTER
FT                   APWAPLAASPRRAAVSSFGFSGTNAHLVVEEYVHPAAAPEAGGPFLFPLSARTREQLAA
FT                   YAAQLRDHVRRAAHEDAGLADLAYTLQVARKPMAERVGLIARTKHELAALLDAFVDGRD
FT                   GGDGLIAGRRDRAGGTPPAPSPEALRALVDAGESRTILQRWALGATIDWACLYRDLDAA
FT                   ARPRRIAAPSYPFARERYWLPDPGTQHAPAARGARAAGPHPLLREIDSAQSAACFGATL
FT                   AGDEPFLRDHRIDGRPVMPSSAYLEMVREAAARALGEPADAMLVIEGIAWRNPLTVSGG
FT                   ARRLQLRARAEPGARALRFDVSSQAAGDAAAEPLAHCDGVARYVPRAPAGAPDLAALRA
FT                   RLASGPRSADEAACAALHARFARLGIEYGATHRVLLRLRVDGDEALAELAPAADGIAQH
FT                   ELHPGTLDAALQPMLALLGERVGDGVPVVPYRIERAEIHAPTHGARWAWLRMRPDAHEW
FT                   IFDVDLCDARGALCVALRGIAVTAWRRPDEVVRLEPVWRAAPVEADLHDERAGPDAQRV
FT                   VFVCGAHGAPRAWPADGIAPVRYAALAAGAPPGEPDALAGWFEAHALALFDEVRRLLAP
FT                   GMRQATLVQIVVPAAGPGAILHALGALLQTAHLENPLLHGQVIAIDDIDAPDLPRRLAR
FT                   DARRAADTRIRYVNGERQVACFDEAAAPDGARALPWRQGGVYLVTGAAGGLARALADAI
FT                   ARGIGGDAPRATLVLTGRSPARDDMRALVASLCALGAATDYRVLDVADRDAVARMVEAI
FT                   VGEFGALHGVVHCAGVLRDNYLLRKSADEFAQVLAPKVRGTVNLDLATRDVRSLDFFVT
FT                   FSSGAGVVGNPGQADYAVANAFMDAFAAHRASLGAARPGVSVSIAWPIWQAGGMRIDRQ
FT                   TEAELERRLAMRPMPTALGLDALHACLLGASPCPTVVHGARARILALARQGFAAPPAAP
FT                   PGFGAADRGADAPGADADAVKTRVRAAIDGALSAVLKLPDARLREPEYFESYGIDSINA
FT                   IRLTVELERTFGPLPKTLFFEYRHADELERYLVSVHGAAVGARIRSAARGAPAGPACAR
FT                   AGESGESGEPPGAPTRSPASEGGAAGAPRASAAPPLAERDIAVIGMAGRYPQADDLQQY
FT                   WDNLRDGRDCIEEIPPHRWDWRKHYDPARGHGAHHSKWGGFINDVDAFDPLFFNISPKE
FT                   AVSMDPKERLFLEQVWTAMEDAGLRPEDLRRDAQRGTGVYVGLMYENYQLLAAEAAAAG
FT                   SDVGMAGGSYASIANRVSFFLDLRGPSLAVDTMCSSSMVAVHLACRDLLAGEIGVAIAG
FT                   GVNLSLHPNKYRMLSAARFMSGDGRCASFGSGGEGYVPGEGVGVLLLKRRADAERDGDR
FT                   ILGLIKASAINHGGRSNGYTVPNAAAQGGVIANAIRAAGIDARAINYVEAHGTGTALGD
FT                   PIELAGLARGFADSGANGPCRIGSVKSNIGHCEGAAGIAALTKVLLQLAHRQIVPSLHS
FT                   RELNPDLPLDGSRWIVNQSLCDWERVVVDGVPLPRTAGVSAFGAGGTNAHLILSEYPAD
FT                   ACAAPAGVIEPAGRDAHDTHDMHDMQDMQDMQDALVVPLSARNAQRLHAYAQRLRAFVA
FT                   AHARGERGAPPRLVDLAFTYQRGRIAMPERLAIVARSLAELERALTAYVAGQRAGDGIY
FT                   AGRADRAAAGDARGAASERTAADFADRLAARWVAGEAVDWHALFDGRAPRRIAAPTYPF
FT                   ERGRYWIGASRAAAGAAEAAMRAGGGASRATTAPRALSESGGEVRQPDQTIRRVRLAPT
FT                   SSFTATARAPSPTQAAQATQAAQATQATQATQATQATQATQATQASQATRAAAAFAPAT
FT                   KASLEAALRDSLASALFVGVDEIDPSRPFSELGLDSIVGVEWIRDINRRYGVSIRTTDV
FT                   YDYPSVGEFAGLLERLLRESSVAGAPPAPATEPTMEPVTAPRPEAAGAAPCEPQPDEGR
FT                   GGAPGNVERIRRELMRSLADALFVDIAEIDVDRPFAQIGMDSIVGVEWIKGINQRYRVA
FT                   LKATDVYDHPTIASIAALVDARGASAASTASTASTASTASTASTASTASPEADVRLAAD
FT                   ARIASAASGAPESEPARAAHPGAAASRARADVAPDAGPAPRRLDAAAPDAQAARAEPVP
FT                   ERIAIVGMSGRYPGAPDLDAFWDNLAAGRDAIAEIPPSRWPVGAFYDPEPGKPGKVYCT
FT                   RIGLLDDVDRFDPDFFRISPAEAEEMDPQHRLFLQEGYRAIEQMGCAPASLSRRKCGVY
FT                   LGVMNHEYGELAMRHRGAASGIGSSYAIGAARLAYYLNLKGPAIPVDTACSSALVATHL
FT                   ACQALRNGEIDLALVGGVTVYLTPESYVAMCAAGMLSPEGRCKTFDDAADGFVPGEGVG
FT                   ALVLKRLADAERDRDPILGVIVGSGLNQDGRTNGITAPSGSSQTELLRDVYRRHRIDPA
FT                   GIGYVEAHGTGTKLGDPIELTALSAAFGDYTDRRGFCALGSVKTNIGHTSAAAGVASIH
FT                   KVLLCLAHRELVPTLNYANPNRHFDFADSPFYVNTDRRAWDAAGDAPRRAAVSSFGFSG
FT                   TNAHVVIEEYRPAAAAAPDASPPRVIVPLSARHPERLRAYARNLADWLAQAAARGAPER
FT                   LAAHLAYTMQVGRDAMAERVAFVADGRDELERQLRRYADTGETSNGVYAGRAEPHAQAS
FT                   NALMLDEAFGAAIDGWMRTGKHEPLAKLWAGGFDLDWARLYDGVPAAAMPRRIAAPTYP
FT                   FASGRYWIDVEPDGRAAGPDADAASPEADSGSDSEHAHEHEHEPAATLAYLPVWEELPP
FT                   AQPRAAPDAQAGGVLVVHRGGAWGLVDAIERECVDGRHAGATCMTLDLSGHAPSPEGRA
FT                   WRNAAPDAARLAAWLGEFGPVRAVFFAAGCSEARHDASGAHGWASAPDAHGEDERALLQ
FT                   LAQALMRSQAADASIEFVVLSLDHHRTDGTPSNPAGGGVAGIAYAIAQGDHRFRVTNVD
FT                   VSLDELRAARHAPAPHPVLAAVLRLAPSDRGALVRLRAGRGYRQAFVRLDWAAEAGASG
FT                   LKQGGVYVMLGGAGRVGRALTRRLIERYRANVAWIGRSPADSASVAHALRALGPAGPAP
FT                   YYAQADATDAARDRSRPAAPRPHRRRGVLRDGVRREPRDRERAGAPVRRDSGRQGARQP
FT                   HLLRGARARAARFSLLLLVGAVVLVLGRGAARRVRGGDDGGRRDRALDRARRRVSGRHD
FT                   PLGVLGNVGRGFRARLAASRRAVRRRGVRVLRAVRRPVHARQSAARGRLHAGVAGGRAS
FT                   DAGAAGRNRDARRAGAARAAGAASRRAGRRGRRIGGYRRMARAAHVRDAAPDARRPARA
FT                   CHARWWDETLRIFAARGWLRIVDGAPRVIAEPDAGEHVWRDWARYRFDTPAARGRRAQI
FT                   DLADVCVRALPDVLAGRLPAADVLFPGGSMERVEGVYRDNPISDYFNAVQADALIRHVR
FT                   AWIDAGRREPIRILEVGAGTGGTTALALERLRPYAAAIGEYCFTDVSQAFLQHAQAAFG
FT                   ARAGYLRTALFDVERPLDAQRMPAGRYDIVIATNVLHATRQVRGALRNVKACLRAGGVL
FT                   LLNEISEKSLFAHLTFGLLEGWWLHEDSSLREPGSPVLAPATWRRLLEDEGFGAIAFAA
FT                   RDAHALGQQVVCATSDGVIRQRAGEPSGHSSRQGHRNRQDHQGRQESSTHAGEAGAPAP
FT                   ASAGRAGAAPAASPAGTAREPVVAAIHRALQQSLKLSEARIGDHTPFLDYGIDSILGVR
FT                   FVDSLKQALDVPLNTAVLFDYPTVERLADFIVATYGARLAARGASAAPASVATASATLA
FT                   ASTASTASTAPTAPTAPTASAAPAAPAAPAAPNAPAAPAMPAEAVSRDAAAPRAEPAGA
FT                   RPADIAVIGMAGQFPDAPDVDAFRALLEHARDGAPGVSGGMLENRDRFDHAFFHITPDE
FT                   ADAMHPYQRLVLQESWKALEDAGYNPAALAGARVGVFVGAEPADYRSTTFSGSSDALIA
FT                   SRVSYHLNLRGPAYVVNTGCSSGAVAIHLACESLRRNESDVVLACGIFAAMGPRMLGAL
FT                   GQAGMLSAGGRCRSFDAGADGTAFAEGIGVVALKRLADAIADGDPIHGIVKASGVNQDG
FT                   TSNGIMAPNGVAQEELIVDVYERFGIDPADIRYVEAHGTGTLFGDAVEANALVRAFRRF
FT                   TERSAYCALGTVKATIGHTAAAAGVIGLIRILLSMRARRLPGMPGLGRANPMIDLDASA
FT                   FSLGLVSREWPAGRDGRPRLAALNTFGHSGTNVHIVVQEPPQARARPARAADGPRVAVP
FT                   LSAMDREALRRYAARLCERLEAEGAALCVGDVAHTLRVAREPMAQRIVLFASTTGELAA
FT                   LLRAFVDGRDSPCLLDGAVTAAARAAGLDAAQLAQAARWLAGERVDWPPAGGTPMRVHL
FT                   PAYPFAGRRCGAAGWARAEAGASRDCAAAGPCEPPAGVAAAAMTVAAATPRVDATPSAA
FT                   ADRARGAARPAEWLAARVAARLGVPAARVDRRRSLLDLGLTSQDLVSLAGQLRDATGEA
FT                   LLPSVLFDYPTIERLAAHLADTCPAAFGAAELAELTETAETTEPAETGRAAAGDAASGP
FT                   APGVIALLERLEGGGLSLEETIYLIENTK"
FT   gene            complement(480843..489032)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0448"
FT                   /note="putative polyketide synthase; this gene model
FT                   represents a disrupted reading frame with multiple genetic
FT                   anomalies; identified by match to protein family HMM
FT                   PF00106; match to protein family HMM PF00109; match to
FT                   protein family HMM PF00550; match to protein family HMM
FT                   PF01212; match to protein family HMM PF02801; match to
FT                   protein family HMM PF08659"
FT   gene            complement(489055..494391)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0449"
FT                   /note="DszB; this gene contains a frame shift which may be
FT                   the result of a sequencing error; identified by match to
FT                   protein family HMM PF00109; match to protein family HMM
FT                   PF00550; match to protein family HMM PF02801"
FT   gene            494408..496285
FT                   /locus_tag="BMA10229_0450"
FT   CDS_pept        494408..496285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0450"
FT                   /product="transporter, monovalent cation:proton
FT                   antiporter-2 (CPA2) family"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00262"
FT                   /db_xref="GOA:A2RX50"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX50"
FT                   /protein_id="ABN00262.1"
FT                   /translation="MATYPDPTRSFNPFMLQSPLVPDSSRSRSCIAFMPNTTHENPPPL
FT                   RRFFYSPIITNLFNSNENKARAIPSAESRLKPHMEFHRRPASRRHALPGMPCRPDSRRG
FT                   ATHHVARAARSNSIFIRLSILQYSIACKRLTMNSDKEILREIPNQAHQSRQYRFRRFHI
FT                   TLFRTRPIPPADSPSGRKNGGRGVRPVGAPRPRLRPRERNDVARATTSTGVSMNSIFVF
FT                   LSQALLIVAVPPLLMNYLRVGAVVPLVVVQIVFGVVIGPSGLGRLSPETYTALFPPDSL
FT                   TFLSHVSAIALFFFAIVTGLHLDATGLRGHGRKLGFISTASMLAPMSLGVLAGIAISAR
FT                   YPQALDPHASVAEFVAGIGICCGVTALPVLAAILRETNLTSRRLGQFSLALAAVNDGML
FT                   WILLAAFLSVTGANAANGGRLFITSALIVLYFVSILFVVRPLLLVLANRLRTSVDTQIL
FT                   IACAVAVASAAATDRLGLHYLLGAFIAGAIIPGAWRDALLERMQPVTVNVLTPFFFIST
FT                   GLRVLIDVDAPGFLQITLIITLCTAIGKIAGTTLAARMTGESWGFCLGLGFLAQAKGLM
FT                   ELVVATILLDSHVISRTVFSALILMALISTAFAMPLLRLKPVRGAALSA"
FT   gene            496493..497851
FT                   /locus_tag="BMA10229_0451"
FT   CDS_pept        496493..497851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0451"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="identified by similarity to SP:P71019; match to
FT                   protein family HMM PF00698; match to protein family HMM
FT                   TIGR00128"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99630"
FT                   /db_xref="GOA:A2RX51"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX51"
FT                   /protein_id="ABM99630.1"
FT                   /translation="MRSTPAAHPAAAHVRFARACGRRPAVDRRGQSTRERSASHGAPPA
FT                   GPALTDARRAGGEMLNTFMFPGQGSQAKGMGGALFDRFADLTAQADAVLGYSIRALCVD
FT                   DPRDELGRTQFTQPALYVVNALTYYAKCEDSGETPDFLAGHSLGEFNALLAAGCFDFEA
FT                   GLKLVARRAELMSQARDGAMAAIVNASREQIERTLDEHGLVDTAIANDNTPSQLVISGP
FT                   AHEIARAEALFQHDRVRYLRLNTSGAFHSKFMRPAQQAFAAHLQSFRLADPAIPVISNV
FT                   SARPYENGRVSEGLAQQIASPVRWCESIRYLLALAAERGEAIEFTELGHGDVLTRLVHT
FT                   IRRQTPAPAAAPAAAATPARARPTPPGEPERLAQQTAAAPRASDSASASLGAAERVAAW
FT                   NRDYPVGTRVRSSLIHDDVLETRTPATVLFGHRAAVYMKGYNGYFDLAEVTPA"
FT   gene            497968..498144
FT                   /locus_tag="BMA10229_0452"
FT   CDS_pept        497968..498144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99490"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX52"
FT                   /protein_id="ABM99490.1"
FT                   /translation="MRRHRRLARPRETAARSAFGKTRSMTPGYGCRRDVDATAPRATSA
FT                   RARRTGQGPTIDQ"
FT   gene            complement(498274..498347)
FT                   /locus_tag="BMA10229_0453"
FT   tRNA            complement(498274..498347)
FT                   /locus_tag="BMA10229_0453"
FT                   /product="tRNA-Cys"
FT   gene            498899..499132
FT                   /locus_tag="BMA10229_0454"
FT   CDS_pept        498899..499132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98864"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX53"
FT                   /protein_id="ABM98864.1"
FT                   /translation="MRREAAWRARPLIPNEPRGPASGRHFSLQEPVLTDDTAAAPPSAF
FT                   YICAEFFSIIEHSVFYDFLPPHFRLATEKSMM"
FT   gene            499244..500413
FT                   /pseudo
FT                   /locus_tag="BMA10229_0455"
FT                   /note="polyketide biosynthesis protein, interruption-N;
FT                   this gene model represents a disrupted reading frame with
FT                   multiple genetic anomalies; identified by match to protein
FT                   family HMM PF01154; match to protein family HMM PF08540"
FT   gene            500445..501665
FT                   /locus_tag="BMA10229_0456"
FT   CDS_pept        500445..501665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0456"
FT                   /product="ISBma1, transposase"
FT                   /note="identified by match to protein family HMM PF01610"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00472"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX54"
FT                   /protein_id="ABN00472.1"
FT                   /translation="MLDRKALQALGCWTGYRLERVEWPQGDSRTLSLYLKPVSQIMYCE
FT                   QCGARCQQIHETTVRRVRDLPLFEYRVVLHVPRRRVWCERCGAARLEKLDWLGRYQRVT
FT                   QRFAKACEKLLQAASVQAVAAFYDLGWHTVKSIDKMRLRARVAEPDWSTIRYLAMDEFA
FT                   LHKGHRYATVVVDPIGRQVLWVGPGRSRETARAFFEQLPEGGAERIEAVAIDMTTAYEL
FT                   EIKEQCPQAEIVFDLYHVVAKYGREVIDRVRVDQANQLRHDKPARKVLKSSRWLLLRNR
FT                   HNLKPEQAVHLKELLAANQSLLCVYVLRDELKRLWFYRKPACAEKAWGQWFEQAQQSGI
FT                   AALQKFAQRLQGYWHGIVARCRHPLNTSVVEGINNTIKVIKRRAYGYRDEQYFFLKIRA
FT                   AFPGIPR"
FT   gene            501685..501816
FT                   /pseudo
FT                   /locus_tag="BMA10229_0457"
FT                   /note="polyketide biosynthesis protein, interruption-C;
FT                   this gene model represents a disrupted reading frame with
FT                   multiple genetic anomalies"
FT   gene            501810..502580
FT                   /locus_tag="BMA10229_0458"
FT   CDS_pept        501810..502580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0458"
FT                   /product="polyketide biosynthesis enoyl-CoA hydratase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98690"
FT                   /db_xref="GOA:A2RX55"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX55"
FT                   /protein_id="ABM98690.1"
FT                   /translation="MLSRPADYRTIRVRYDGDICFLQLHRPDAQNAINNRMIAECMDVL
FT                   DRCEHAAKIVVLQGLPDVFCFGADFSDIAEKPDALIDSDAIYGLWHRLATGPYITIAHV
FT                   QGKVNAGGIGFVAASDIAICDENVPFSLSELLFGLIPACVLPFLARRIGTPKAHYMTLM
FT                   TQPVTAQQAFSWGLVDAIGANTDTLVRKHLLRLRCLNKASVARYKSYAATLDDTLAAAR
FT                   PGAVRVSIEMFADPENRRKIARYVDTGKFPWEAD"
FT   gene            502617..503363
FT                   /locus_tag="BMA10229_0459"
FT   CDS_pept        502617..503363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0459"
FT                   /product="polyketide biosynthesis enoyl-CoA hydratase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98544"
FT                   /db_xref="GOA:A2RX56"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX56"
FT                   /protein_id="ABM98544.1"
FT                   /translation="MADCVVQVVMQDRENKNTFSDALIRGLGEAFDAIRQNGRCKAAIL
FT                   TGYGNYFASGGTQESLMYLSEGKGTFAEIAASASRNGANLYSLALNCPVPVIAAMQGHG
FT                   IGGGFVMGLFADFVVLGKECLYTTNFMKYGFTPGMGATLVLPHKLGLPLAQNMLMTARS
FT                   FYGDELQKLGVPFPVVPRAEVAACALEIAKNLAEKPRLSLVTLKDHLVAELRSRLPAVI
FT                   EQELAMHEKTFGQPEVKERIRSLFGQ"
FT   gene            503417..503656
FT                   /locus_tag="BMA10229_0460"
FT   CDS_pept        503417..503656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0460"
FT                   /product="acyl carier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00243"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX57"
FT                   /protein_id="ABN00243.1"
FT                   /translation="MDLQQVFDIIVRHTKEVIPGLDRHAFRTTDALKDLGANSLDRSEI
FT                   VIMTLESLSLRIPLVEFAGARNIGELAEVLYAKL"
FT   gene            503643..504887
FT                   /gene="pksF"
FT                   /locus_tag="BMA10229_0461"
FT   CDS_pept        503643..504887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pksF"
FT                   /locus_tag="BMA10229_0461"
FT                   /product="polyketide beta-ketoacyl synthase PksF"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99723"
FT                   /db_xref="GOA:A2RX58"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX58"
FT                   /protein_id="ABM99723.1"
FT                   /translation="MRSSERDEILVTGVGVVSAIGQGRQPFIDALLDGRHAFGVMRRPG
FT                   RQLPDDAGAGPAPAFFGAEIDSIALPPMLDAHRRTASYSAQAAVACVREAWDDAALGDV
FT                   DPLRIGLVVGGSNVQQREQALVHDTYRGRYAFLRPSYGLSFMDSDLCGLCTELFGIRGV
FT                   AFTVGGASASGQLAVLQACRLVESGSVDACIAVGALMDLSYWECQALRSLGAMGSDRFA
FT                   DEPDAACRPFDQDRDGFIYGECSGAIVVERAARMRRAHVSPYAKWLGGCIRMDGTREPA
FT                   PSLDGEMAVIEGALRDAGIGADSIDYVNPHGSGSTLGDATELDALGRSGLAHARINTTK
FT                   SLVGHGLSAAGIVELIATLLQMRARRLHPSRNLDRPIDERFDWVRSTCGSDIRRALKLS
FT                   IGFGGINTALCLERC"
FT   gene            504929..506542
FT                   /locus_tag="BMA10229_0462"
FT   CDS_pept        504929..506542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0462"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719; match to protein
FT                   family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99344"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX59"
FT                   /protein_id="ABM99344.1"
FT                   /translation="MGDYLAQDVRIERITVRDPEARTWFDRGLLWAYGFNFEAAVDCFQ
FT                   EAARIDPDCVLAYWGIAYASGCNYNKQWKVFHPRMIARCMKLARDAIRRAQACRAGASA
FT                   LEMALVRAIECRFQAEGAHDEALLRRWNDDYARAMRDVYLSCPDNLDVAALFADALINR
FT                   TPWKLWDMSSGKTADGADTDEAIAVLERALAQVDANGLAPHPGLLHVYIHTIEMSPTPE
FT                   KALRAADALRDLAPDVGHLLHMASHIDILCGHYHDAIVANDRAIAANQRVLDRHPQWLE
FT                   FRLYCVHDIHFKIYAAMMLGRFSAAWQGVLELEALITEALLRVEQPPMAYLLEGFLSVR
FT                   VHVLIRFGKWREILEQPFPANAALYCNTTAMLHYARGIAYANLKLAGPAAQARRAFSIA
FT                   ACVLDGEIAYHEDRFDEAFAHLRRAVELDDGLEYMEPWGWMMPTRHPLGALLLAQGHVE
FT                   EAERVYRADLGLDSTIYRSLQHPGNVWSLQGYVSCLRRLGKHETADALQPALDVARARA
FT                   DVEIGVSCFCAAPSKRGCCH"
FT   gene            506708..507712
FT                   /locus_tag="BMA10229_0463"
FT   CDS_pept        506708..507712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0463"
FT                   /product="iron-sulfur cluster-binding protein, Rieske
FT                   family"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98496"
FT                   /db_xref="GOA:A2RX60"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX60"
FT                   /protein_id="ABM98496.1"
FT                   /translation="MNGTQRFPMDIPFGWFCIGYSDEVAVGDVKPLRYFGKDLVMFRGE
FT                   SGEIGVLDAYCPHLGAHMGHGGTVEGDSLRCPFHHWAYRKDGFCTSIPYAKEMPLIAKR
FT                   EPIAVPYPVVERNGAIWVWHHPQQIAPTYEVLEHEEFVAPGWSKPVRRFWSFASNPQEI
FT                   AENGVDTAHFKCIHHMDAMPEGEVTYEGHIRRSRTTGETSMIFPDGVTRTVETGTNVIN
FT                   SGAGQKISRFTGFVTISLMEMATPVEADQVELRFCFAFPECPEGSPEWQGAMNTIDYFS
FT                   GQLGIEGGDIPIWSHKIHREKPILCDGDGAIMRFRRYFEQFYAPRVVPVTASA"
FT   gene            507879..509438
FT                   /locus_tag="BMA10229_0464"
FT   CDS_pept        507879..509438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0464"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00345"
FT                   /db_xref="GOA:A2RX61"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX61"
FT                   /protein_id="ABN00345.1"
FT                   /translation="MFCDFYFPLIATLASALAPPGLRAKIREARVLSASADLARLTQDG
FT                   CGDAERAYRIQLHADMQLAMALEFDAEESYRRSRKLMHAPKDEIRLLSFRNTGWQALFR
FT                   RRLGTAMACFANVTSEPAVDPCRRIEGLFGTMCVWFELGHLDEAGYLLDDIELAIERLL
FT                   ASHEDFALWRELAQTMRADLDLQRLVRHAPELSDHVYWQSARLSDPVRPPVERERLASR
FT                   PIAEQDVRSPLLRARLDFRTALRRLAGGQADALNDLMAHLDWADANGLTSYQNSARQEI
FT                   ALAGLIGNAPHVAEMVLAPLANEIRVGHHHGHLEILYCLAKVNQAQGRTHHSQQLYSRY
FT                   AMTAVHCARKGACDLARNSPQGHAPHVADDISARLPAKYRRAYHFLLSNLERSDLAIGE
FT                   IAEVIGVTVRSLQNTFKASLGATPSEIIRQERMKRIHRELQGEDARFGQRVLDSGNRWG
FT                   VPNRSTLLNAYKRQFNEAPSQTLHRKHPYKPGEDVASGVLASAAHPAAARQQHEASVST
FT                   AD"
FT   gene            509586..511085
FT                   /locus_tag="BMA10229_0465"
FT   CDS_pept        509586..511085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00533"
FT                   /db_xref="InterPro:IPR018773"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX62"
FT                   /protein_id="ABN00533.1"
FT                   /translation="MRRPPEPERALCRAWVGNRVVFFILMQASDPSSGYLSDVTFPDRF
FT                   HRELSPTWLNYASVLGGARPKELGRPFRYLDLGCGFAHSTVINAAAFPHAEFHACDFNP
FT                   AHIEAAARRASRLGIGNVAFHEASFDALLDRDLPPFDFIVMHGIYSWVDAGVRRVIRQL
FT                   LSRRLADAGLVYLSYNCQPGWAAEAPLRKLMLELAQAADGGIEARTGSAIAGMRKLGTP
FT                   SLRYFRDNPAAAEALAALANDPLDYLAHEFLNGTWKIHYSVDVVDEMAEAGLAYAGSAT
FT                   LADNHPMLLIDRQAADAIAALPNARLRHLAEDFAVNRRFRRDVFVRGARASTAPAEALR
FT                   HLDEIAIGCTTEIDRIDTRMTIPRGAISFQPDFIADLRALLRHGAMRIGEIVARLGAAR
FT                   RNSREIRQNLLFLVASGTLTPFAQPGGPTDTGARRAASPAAAAALAGSVDDAAPAFVPS
FT                   ELLGNGLAVSPDEAAQALRWIAGEAMPRPERLARVGVLRGA"
FT   gene            complement(511360..513048)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0466"
FT                   /note="catalase precursor; this gene contains a frame shift
FT                   which may be the result of a sequencing error; identified
FT                   by match to protein family HMM PF00199"
FT   gene            complement(513114..513257)
FT                   /locus_tag="BMA10229_0467"
FT   CDS_pept        complement(513114..513257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0467"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99294"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX64"
FT                   /protein_id="ABM99294.1"
FT                   /translation="MRRGRGVNVERRASIPGHAREFAGFVRRASAGHCVAAFRTSIGAI
FT                   EI"
FT   gene            complement(513345..513979)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0468"
FT                   /note="DNA-binding response regulator, LytR/AlgR family,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   match to protein family HMM PF00072"
FT   gene            514067..514330
FT                   /locus_tag="BMA10229_0470"
FT   CDS_pept        514067..514330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0470"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98679"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABM98679.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            514354..515187
FT                   /locus_tag="BMA10229_0471"
FT   CDS_pept        514354..515187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0471"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99148"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABM99148.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(515317..516336)
FT                   /locus_tag="BMA10229_0472"
FT   CDS_pept        complement(515317..516336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0472"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98701"
FT                   /db_xref="GOA:A2RX69"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX69"
FT                   /protein_id="ABM98701.1"
FT                   /translation="MRRVRGLAGLVLFNCIVGLSSWASRRDDAVLPYLVLANGIGLSAL
FT                   LLSLCADKLTRGKLAVLPKVLIVAPVSVLAGFEIAASTVGHVPHLIGRASVREWLGYGS
FT                   SFVVTGIACAFVSLFMQAARMRASLETQRREAAEARQAETAARLALLQAQIEPHFLFNT
FT                   LANVQSLIERDPARASTMLDSLNRYLRASLGRTRKAASTLGEELELIEALLQIASIRLG
FT                   ERLRYAIDVPAPLRELAFSPLLLQPLVENALLHGIEPSLDGGEIRVCGRRNGKLLELSV
FT                   IDTGVGLGNGETRLHGGVGLANVVARLTSLYGARGRVSVGATAGATRGVTAALQIPID"
FT   gene            516924..517466
FT                   /locus_tag="BMA10229_0473"
FT   CDS_pept        516924..517466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0473"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99542"
FT                   /db_xref="GOA:A2RX70"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX70"
FT                   /protein_id="ABM99542.1"
FT                   /translation="MFPTLHLPTYVYVLFCAFVYIGVKRCFARQVTPLLPLLSPIGFAM
FT                   LGATSLHARFPRAGVGADAAALASLAAGAALGWLHASRWRLRFGVEHSRLVVRLPGDAS
FT                   LLVTLLLTFAAETYMHYAVAAAKPWAATHAFALLSFAAWGLLVGMPLGRAINVVARCVR
FT                   YTNGPRDKDGAYTLDSN"
FT   gene            complement(517604..518740)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0474"
FT                   /note="putative transporter; this gene contains a premature
FT                   stop which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF07690"
FT   gene            complement(518827..518949)
FT                   /locus_tag="BMA10229_0475"
FT   CDS_pept        complement(518827..518949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0475"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98934"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX72"
FT                   /protein_id="ABM98934.1"
FT                   /translation="MMGPAAFIKLTQLSIAPFDAVESFESFELFDAYGRASTLD"
FT   gene            519405..519749
FT                   /locus_tag="BMA10229_0476"
FT   CDS_pept        519405..519749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0476"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00580"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX73"
FT                   /protein_id="ABN00580.1"
FT                   /translation="MKYLPLIALIVATSASAADTGVQNVGQSQKSAQDVSACIAKTWAD
FT                   KSQQQVVTQNVLTNGLAADVYVPGQQPPNGAAAVVRPAFSGNAKTWVGFRAGSSGAADG
FT                   AAAGDINSCL"
FT   gene            complement(519867..520679)
FT                   /locus_tag="BMA10229_0477"
FT   CDS_pept        complement(519867..520679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0477"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99816"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX74"
FT                   /protein_id="ABM99816.1"
FT                   /translation="MKQPRRLAQSQQDSKMPGEMTMRKAFRHAVALSLLSWLVAPRVHA
FT                   QYDPGATVGLGQGMIANNGVIGNLAIGSQGLERDARGDADRARAASPRTAPAALTYVGD
FT                   AGVHRQVQADIVNFLAHGDASKRDEAKRVVEQGELLETFDRLMSRPAFDRRNLGDVFAA
FT                   YLVMSWEVVNGADAHAQPAGVDAVRAKSSAALARDGRVRAMSDADKQRLAETLAYLAMI
FT                   AVTAQRDLRRSGNTAALEQLRAGVRLSTRKMIGVDVKGLRLTENGLAR"
FT   gene            complement(520870..521364)
FT                   /locus_tag="BMA10229_0478"
FT   CDS_pept        complement(520870..521364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04828"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00019"
FT                   /db_xref="GOA:A2RX75"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX75"
FT                   /protein_id="ABN00019.1"
FT                   /translation="MQTDDTPIYEGGCTCGAVRYRMTSRPLIVHCCHCRWCQRETGTAF
FT                   ALNALIESDRLLLLRGEVDIVDTPSNSGKGQKIARCPRCRIAVWGHYAGGGGAVSFVRV
FT                   GTLDAPERLSPDIHIFTSSKQPWVILPPAARAVPEYYSSDEIWSAESLARRTALRAKRD
FT                   R"
FT   gene            complement(521416..521598)
FT                   /locus_tag="BMA10229_0479"
FT   CDS_pept        complement(521416..521598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0479"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00469"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX76"
FT                   /protein_id="ABN00469.1"
FT                   /translation="MQVGVMTRKVDIMPPIARISQIRRAARGQAGRYGRREGDDDTGDK
FT                   AAIRQGASHESREEG"
FT   gene            521605..522906
FT                   /locus_tag="BMA10229_0480"
FT   CDS_pept        521605..522906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0480"
FT                   /product="putative UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="identified by match to protein family HMM PF00275"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99600"
FT                   /db_xref="GOA:A2RX77"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX77"
FT                   /protein_id="ABM99600.1"
FT                   /translation="MSNLIVHGGAPLRGEITPSANKNAVLPILCATLLTDRPLRLVGVP
FT                   DITDVRKILDIFRTLGSDVSIDYASGVLDLHHRATAFDPAVHRLPEEMRSSIMLVPPLL
FT                   ARFGVARLENDVKGCTLGVREIDPHVEVFERFGARIERTSDSLIVRADGPLTPNHHWLD
FT                   YASVTTTENFVLCAASANGTSTLVNAASEPHVQEFCRFLAMLGVPIEGIGTSHLSVQGG
FT                   RALAGGEYRFNEDFHEIATFLALGAITGGDIAVRNGSPEQFPLIDRTFAKFGVQVTHEN
FT                   GWSHALRDGPLKVKQPFTRNILTKVEAAPWPYLPVDLLPIFIALGVQAQGSVMFWNKVY
FT                   DGAMGWTGELSKFGAHVFLSDPHRLITFGGLPLSPARVESPYIIRVAIALLMVAASIDG
FT                   RSEILNAQPIRRAHPHFVENLRSVGANVEWTSGE"
FT   gene            complement(522971..523810)
FT                   /gene="hisP"
FT                   /locus_tag="BMA10229_0481"
FT   CDS_pept        complement(522971..523810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisP"
FT                   /locus_tag="BMA10229_0481"
FT                   /product="histidine ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00098"
FT                   /db_xref="GOA:A2RX78"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX78"
FT                   /protein_id="ABN00098.1"
FT                   /translation="MTGARDARGRHRSTKHDDDQGRRRMDKLTVDDLHKKFGDNEVLKG
FT                   ISLRAKAGDVISIIGSSGSGKSTFLRCINFLEQPCSGAITLGGETIRVTRDRRGAPRIG
FT                   DPKQLQLMRVKLAMVFQHFNLWAHMTVLENVTEAPVSVLGLSRAEADARAREYLRKVGL
FT                   APGVEAKYPSHLSGGQQQRVAIARALAMEPEVMLFDEPTSALDPELVGEVLKVMQALAE
FT                   EGRTMIVVTHEMGFARNVSNHVIFLHQGRIEEEGHPQDVLVHPKSERLSQFLSGRLK"
FT   gene            complement(523807..524520)
FT                   /gene="hisM"
FT                   /locus_tag="BMA10229_0482"
FT   CDS_pept        complement(523807..524520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisM"
FT                   /locus_tag="BMA10229_0482"
FT                   /product="histidine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99477"
FT                   /db_xref="GOA:A2RX79"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX79"
FT                   /protein_id="ABM99477.1"
FT                   /translation="MIQIIGQYWQNYLFSDGYRLSGLAITLWLLVVSLGLGFGLAVPLA
FT                   IARASRNRAVSGAVWLYTYVFRGTPLYVQLLLCYTGIYSLSVVHDHAWLDSFFRSAMNC
FT                   TLLAFTLNECAYATEIFAGAIKSTAPGEIEAGLAYGMSRFKLYTRVILPSALRRALPSY
FT                   SNEVILMLHATTLAFTATVPDILKVTRDVNSATYASFQAYGIAAALYAVVVFALIWLFR
FT                   RMEARWLAYLRPQGH"
FT   gene            complement(524517..525206)
FT                   /gene="hisQ-1"
FT                   /locus_tag="BMA10229_0483"
FT   CDS_pept        complement(524517..525206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisQ-1"
FT                   /locus_tag="BMA10229_0483"
FT                   /product="histidine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99834"
FT                   /db_xref="GOA:A2RX80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030199"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX80"
FT                   /protein_id="ABM99834.1"
FT                   /translation="MLFQGFGPLLWAGTIETVKLAVLSLAASLVLGLAGAAAKLSSNRA
FT                   LASVGTFYTTLIRAVPDLVLMLLLFYGIQILLNDVTDMLGAEQIDIDPFVAGIVTLGFI
FT                   YGAYFTETFRGAFLAVPRGQLEAGFAYGMGAWRVFARIMFAQMMRFALPGIGNNWQVLV
FT                   KATALVSIIGLADVVKAAQDAGKSTLNFFFFTLAAGAIYLAITTLSNLVLMYLEKRYSA
FT                   GVRRVAL"
FT   gene            525406..526476
FT                   /locus_tag="BMA10229_0485"
FT   CDS_pept        525406..526476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0485"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98600"
FT                   /db_xref="GOA:A2RX81"
FT                   /db_xref="InterPro:IPR021260"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX81"
FT                   /protein_id="ABM98600.1"
FT                   /translation="MLKHAPRAAALDCPDIERIRPRWATRRAHTEPRRGNGRETADGAR
FT                   RARVTANFRIRRNTARTRGIESPRRTDRRRTPVHSALRPTRCSGMDTQLWIICGLTFVI
FT                   HVIATLAYAVRIAGVRTRRIAVSFSLFGIIALVSRTANSFQGPFIAKRVELDISRHLGE
FT                   GLLADFRLFLLSATVASVVGALLIPTFQRYFSRAVHHFQANRSVSRLLLRVFSRDGVGY
FT                   IRGGARLPSPRNVTQLATGTGVSWQVIVLNVVAMAIWTVGVFASLYAGYLKPELRVTCA
FT                   NLSSIINGFATVAMAVIIDPQVSVMTDDVIEGRLCENHFRRAITTLAGARVLGTLCAQA
FT                   ALVPAALVIVRVAELI"
FT   gene            complement(526469..526603)
FT                   /locus_tag="BMA10229_0484"
FT   CDS_pept        complement(526469..526603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0484"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00459"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX82"
FT                   /protein_id="ABN00459.1"
FT                   /translation="MPRLRANGPAVRAQAQGRKRPGGRASIASNAGAGRPRPVDARAR"
FT   gene            complement(526675..527790)
FT                   /locus_tag="BMA10229_0486"
FT   CDS_pept        complement(526675..527790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0486"
FT                   /product="putative outer membrane porin"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99208"
FT                   /db_xref="GOA:A2RX83"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX83"
FT                   /protein_id="ABM99208.1"
FT                   /translation="MGFQSRKMMVALVAAGPALACAQTSVTLYGRVDGGVEYLNHIAKP
FT                   SGGSASRWSAESGDWGTSMFGLKGAEDLGGRTSAIFNLETAFQVMNGTTGGGRMWSRRA
FT                   YVGLKNDTWGTLQAGRNLFIDSDGVWEFDPFVQQAFSSASLVRGRNWQQTSNNVEYHSP
FT                   VFGGFDVQAQYAFGNQSRGFNYGAQGDFGRSEGVMVSYHSPLLDVRGIYDELRDSNGRM
FT                   SNIFSSSREYFIGANVKVQKFKIQGAYTHYSAPDTPAGLADRADHFWLGATYQADPQWA
FT                   VTGGGYYVRVRGGDGGDASHDPSGHAIMYALGTTYNLSKRTFLYGTLAYVRNGGNSNFS
FT                   LLATPRDATPNTSPLAGESQTGAYVGMMHTF"
FT   gene            complement(527843..528256)
FT                   /locus_tag="BMA10229_0487"
FT   CDS_pept        complement(527843..528256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0487"
FT                   /product="DoxD-like family protein"
FT                   /note="identified by match to protein family HMM PF07681"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99561"
FT                   /db_xref="GOA:A2RX84"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX84"
FT                   /protein_id="ABM99561.1"
FT                   /translation="MKQTFLAPQKDLLLLLSRILLVILFVIFGWEKLLNFSGTAQFMAA
FT                   EGTPLPSIAAVVAVAMEFFVGIALLLGFCTRPIALLLGLYTLGTAFIGHHYWSMPAAEQ
FT                   MNMMIHFYKNIAITGGLLALCAAGPGRYSLDRG"
FT   gene            complement(528448..529806)
FT                   /locus_tag="BMA10229_0488"
FT   CDS_pept        complement(528448..529806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0488"
FT                   /product="gluconate 2-dehydrogenase cytochrome c subunit"
FT                   /EC_number="1.1.99.3"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98986"
FT                   /db_xref="GOA:A2RX85"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX85"
FT                   /protein_id="ABM98986.1"
FT                   /translation="MLKRTLSFMLAGCLALPGLSSAADAAASGAPASAASSVPAASAAP
FT                   AAVRAADATLVERGRYLAVAGDCMACHTAKGGKPFAGGLPMRAPLLGTIYTTNITPDKE
FT                   TGIGDWSFADFERAVRHGVAKNGDNLYPAMPYVSYTKVTDDDVKALYAYFMHGVEPVRQ
FT                   PPRRNDIPWYLSMRWPLKIWNLLFLKEGVYQPKPERGVEWNRGAYLVQGLAHCGTCHTP
FT                   RAVTLQEKSLDETGGSFLAGSVLSGWDGYNITLDPNAGIGGWSQPQLVQYLRTGSVPGL
FT                   AQAAGPMAEAVEHSFSRMSNADIGAIATYVCTVPAVADGAAKARSAWGKPAEDGIRLRG
FT                   VALASTGIDPARLYLGNCASCHQMQGKGTPDGYYPQLFHNSTVGAPNPTNLVQVILNGV
FT                   ARKAGGEDVGMPAFRHELSDAQIAALANYLTVQFGNPAAKVSEQDVAKLRAAQ"
FT   gene            complement(529806..531419)
FT                   /locus_tag="BMA10229_0489"
FT   CDS_pept        complement(529806..531419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99764"
FT                   /db_xref="GOA:A2RX86"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX86"
FT                   /protein_id="ABM99764.1"
FT                   /translation="MADTQQADVVVVGSGVAGAIVAHQLAMAGKSVILLEAGPRMPRWE
FT                   IVERFRNQPDKMDFMAPYPSSPWAPHPEYGPPNDYLVLKGEHKFNSQYIRAVGGTTWHW
FT                   AASAWRFIPNDFKMKTVYGVGRDWPIQYDDIEHDYQRAEEELGVWGPGAEEDLLSPRKQ
FT                   PYPMPPLPLSYNERTIKTALNNHDPKYHVVTEPVARNSRPYDGRPTCCGNNNCMPICPI
FT                   GAMYNGIVHVEKAEQAGAKLIENAVVHKLEVGPQKKIVAARYKDPKGVEHRVEGKYFVL
FT                   AANGIETPKLMLMSTSHDFPNGVGNSSDMVGRNLMDHPGTGVSFYASEKLWPGRGPQEM
FT                   TSLIGFRDGAFRATEAAKKIHLSNLSRVDQETQKIFKTGKLLKPAELDAQIRDRSARYV
FT                   QFDCFHEILPQPENRIVPSRTATDAIGIPRPEITYAIDDYVKRGAAHTREVYATAAQVL
FT                   GGTDVAFNDEFAPNNHITGSTIMGADPRDSVVDKDCRTFDHPNLFVSSSATMPTVGTVN
FT                   VTLTIAALALRISDQLKKEI"
FT   gene            complement(531419..531934)
FT                   /locus_tag="BMA10229_0490"
FT   CDS_pept        complement(531419..531934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0490"
FT                   /product="putative oxidoreductase"
FT                   /note="identified by match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99155"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024651"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX87"
FT                   /protein_id="ABM99155.1"
FT                   /translation="MNNDTNPHARRSIDADEPMGGGLTRRQWLQRSLALTALGLAGSLT
FT                   LRALADAPSAAPLDAFMTLSEALTGKTGLNRAVGERLLRALQKGSFELGDRLPKLAGAL
FT                   AANALAPDQEALALRILEAWYLGIVENVVVTYEEALMFGVVSDTLVIRSYCPNKPGFWA
FT                   DKPIERQA"
FT   gene            532422..532715
FT                   /locus_tag="BMA10229_0491"
FT   CDS_pept        532422..532715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98684"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX88"
FT                   /protein_id="ABM98684.1"
FT                   /translation="MENPALAPRRGIARAIHAAPRFSASFDVRIRKIVALPNGLNAGSP
FT                   VQATPGCQGVPKRMPRATARLEHAARITHHAPRECANARPSASTMPSGTGVT"
FT   gene            complement(532859..533086)
FT                   /locus_tag="BMA10229_0492"
FT   CDS_pept        complement(532859..533086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0492"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00166"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX89"
FT                   /protein_id="ABN00166.1"
FT                   /translation="MKRAIECAAGEAARLAAVDARAGRPARRVPEQSTRARFSSFHRRM
FT                   RRRNARRVRRARRRASGAGRRASWRQAFIR"
FT   gene            533475..535094
FT                   /locus_tag="BMA10229_0493"
FT   CDS_pept        533475..535094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0493"
FT                   /product="serine metalloprotease MrpA"
FT                   /note="identified by match to protein family HMM PF00082"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99640"
FT                   /db_xref="GOA:A2RX90"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034176"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX90"
FT                   /protein_id="ABM99640.1"
FT                   /translation="MSVLVPLAGCGGGGDGGGSGTPSAAAQPTPAPAPAPAPAPAPSSG
FT                   SSQSTNSSTSTAACPVTQAASTAAGETLVTRTVSHEAPVDHLIVKLQRTAAASASGARI
FT                   MAAANDAARLDSVIQRVMSQWSAKSGAVRSYAQNIAPTNAVQVERTMSDGAALLALGQK
FT                   MSADNAGALAQTFAADPDVAYAEPDRRVFARTVATDPDYAQQWNYFDPAAGINLPDAWN
FT                   VTNGLPSVVTAVLDTGYRPHPDIIANLLPGYDFISDINTGNNGHGRGPDATDPGDWVTQ
FT                   QELTDPSSPFYQCASAPSNSSWHGTQVAGIIGAAANNGIGIAGVSWYGKILPVRVLGKC
FT                   GGTTSDIADAMRWAAGIPVAGAPTNLTPAKVINLSLGGSGPCGDTFQQAINDVIARGTT
FT                   VVVSAGNDGQATTLDRPANCKGVISVGATDSTGQRAWYSNFGSDITLSAPGSNILSTSN
FT                   AGTTVPTTDAYGTHSGTSLAAPQVAGVASLMLAVNPNLTPAQIAQKLASTARPSPATAS
FT                   CLARAPGAGIVDAGTVVASATK"
FT   gene            535672..535788
FT                   /locus_tag="BMA10229_0494"
FT   CDS_pept        535672..535788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0494"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99836"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX91"
FT                   /protein_id="ABM99836.1"
FT                   /translation="MAPGGACAASAAPASDSDSPLIQPNARDAMRRETRVRR"
FT   gene            535834..538620
FT                   /locus_tag="BMA10229_0495"
FT   CDS_pept        535834..538620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0495"
FT                   /product="magnesium-importing ATPase"
FT                   /EC_number="3.6.3.2"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00690; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01524"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99523"
FT                   /db_xref="GOA:A2RX92"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX92"
FT                   /protein_id="ABM99523.1"
FT                   /translation="MTQRTPSKHKQRGFLHYGARGDGDAGRPMRIEYASAQPLADTLAH
FT                   LRTSECGLTTPDARQRLLGDGPNEIAHDKPPHWSRQLLAALNNPFVYVLLVLAAISLLT
FT                   DVYFADPGDRDYVKITILLSMVTISVLLRFVQEFRSLRAAEKLKAMVRTTATVQRRADD
FT                   ASAPIRHDVPMREVVVGDIVHLSAGDMIPADVRLISSRDLFISQAVLTGEALPVEKYDT
FT                   LGAVAQKSADPASRSSGAAVRLERVEHGGSLLDLANVCFMGTNVVSGTATAVVVATGGD
FT                   TYFGALAKNVVSHKRIETSFDRGVSSVSWLLIRFMLVMVPVVFMINGLTKGDWLSALTF
FT                   ALAVAVGLTPEMLPMIVSANLARGAIAMARRKVVVKRLNSVQNFGAMDVLCTDKTGTLT
FT                   QDKIILEHHLDVSGRKNEDVLRLGWLNSFHQSGQKNLIDIAIVERANQLGEWIKPQGYR
FT                   KIDELPFDFVRRRLSVVVEDPRGTHLLVCKGALEEMLAVSTHVQDDEGVHPLDFVARKR
FT                   LLAQANAYNEDGFRVLIVATRTIARGDEREQYRTADERDLVVRGFLTFLDPPKESAAPA
FT                   LAGLRENGVAVKVLTGDNPTVTLNVCRQVGLAPGKPLLGTEIEALHDAALEKAVEHTTV
FT                   FAKLTPLQKARIVKALQANGHTVGFLGDGINDAPALRDADVGISVDSGADIAKETADII
FT                   LLEKSLMVLEEGVIKGRETFGNILKYLNMTASSNFGNVFSVLVASAFLPWEPMLAVQML
FT                   VLNLIYDTSQMLLPWDKMDPEFLKKPRKWEANNIGRFMLWVGPTSSVFDITTYVLMWTV
FT                   FGAGALYHAQGGAAGQLVMNSGWFVESLVSQTLVVHLLRTQKIPFLQSTASLPVLLSTT
FT                   IAIAIGCWLPFSPFSEALGFIRLPGSYWLWLAATMIGYIALAQIVKTLYVRRYKRWF"
FT   gene            538696..539439
FT                   /locus_tag="BMA10229_0496"
FT   CDS_pept        538696..539439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98573"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX93"
FT                   /protein_id="ABM98573.1"
FT                   /translation="MKRMLPLAAASALFAPAGAHADHPFTSDDTNTQGDGNWQYELNVE
FT                   RTSKQPDIGRQQLWNTTLTRGFGERVDLYVQAPYTHVQTRSDEDGSGLGDLEIGAKWRV
FT                   LERGPLSIALKPRFTMPTGDDARGLGNGRASAGAMLLAQYDVARLQVLVNAGLMYQPNR
FT                   QGNLASIWQACGAIVYRATDKLRLGVDIGVSRNPERGAGAHPAYVIAGAIYTPRDWLDV
FT                   DLGYRRGLNDQIYDHALMAGLTVRW"
FT   gene            complement(539598..540017)
FT                   /locus_tag="BMA10229_0497"
FT   CDS_pept        complement(539598..540017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00474"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX94"
FT                   /protein_id="ABN00474.1"
FT                   /translation="MKTNAAKDGRDACGAWREDDVHAPWACDARAQARADGEDAAGRAG
FT                   GDSGCDPALVAVLLRLREAAVDARGAPWSLAKLAKRAGMPMSALRRALTRLDAAGVTET
FT                   IVREDGTGCAALTAQGRQWCDALFGGGAAARGGDA"
FT   gene            complement(540028..541446)
FT                   /locus_tag="BMA10229_0498"
FT   CDS_pept        complement(540028..541446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0498"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98675"
FT                   /db_xref="GOA:A2RX95"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX95"
FT                   /protein_id="ABM98675.1"
FT                   /translation="MKRYEQLADDIEAMIRRGVYRPGERIPSVRQASVQHRLSITTVVR
FT                   AYLVLESRGAIESRPQSGYFVRARQDAPALALHASAPVAVSSAVDVSRLVLSTLRSIAR
FT                   DDAVPLGSPYPDATPFPAQRIARHAHAIARRRARWGVIDDLPPGNPELIRQIARRYLEG
FT                   GVAVDPGEIVVTIGATEAINLCLQAVAKPGDTIAVESPTFYAMLHAIERLGMRAIEVAT
FT                   HPGEGIDIDALARILATERIAACMVMPNFQNPLGFLMPDERKRALVELLARHDVPAIEN
FT                   DVYHELYYGAARPSTLKAFDARGLVLHCASFSKSLSPAYRVGWAMPGRYRDQVEKLKFL
FT                   NTLATPAIDQLAIAEYLRHDGYDHHLRRIRKLYAQQASMMAALVRRFFPDGTRLSQPKG
FT                   GYVLWIELPDGVDAMALYRLALAQKITLGPGHMFSTTLAYRHCIRLNYSYAWSPQIEAA
FT                   VKTLGRLAAVCAKR"
FT   gene            541583..543949
FT                   /locus_tag="BMA10229_0499"
FT   CDS_pept        541583..543949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0499"
FT                   /product="molybdopterin oxidoreductase, alpha subunit"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM TIGR01701"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00577"
FT                   /db_xref="GOA:A2RX96"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX96"
FT                   /protein_id="ABN00577.1"
FT                   /translation="MRRRPQPALRHFNDMKTKEPDARIEPYAHPAGGWGALKYVAINLF
FT                   KEKVPGGNYRALLRQNQPDGFDCPGCAWPDREHASTFEFCENGVKAVAAEATAKRVTPA
FT                   FFAEHTVSALFDQSDYALEQHGRLTDPMVYDAATDRYVPIAWNAAFELIANHLRALGEP
FT                   NRAAFYTSGRASNEAAFLYQLLVRYYGTNNFPDCSNMCHEATSRGLPATVGVGKGTVTL
FT                   DDFEQADTLLIFGQNPATNHPRMMGELRACAKHGATIVSINPLKERGLERFASPQHPAE
FT                   MLTMSSTPIASTFVQPRVGGDLALIKGVAKRVLELDDAARERGGARVLDVDFIAAHTAG
FT                   FDTFAADLRAQDWAALVGESGVPREQIDALARIYVRGERVIATWGMGLTQHKHSVATVH
FT                   MLSNLMLMRGNVGRPGAGLCPVRGHSNVQGNRTVGIEEKPSDAFLERLGRVFDFAPPRG
FT                   HGYDVVETIEAMLDGRIGVFIGLGGNFAMATPDTPRTWQGLRRCGLTVHITTKLNRSHL
FT                   VHGREALILPTLGRTEIDLQNGVAQGVSVEDSMCMVHASYGMNPPASPNLLSEVAIVAR
FT                   LGHALFGGDKIDWLGYMNDYAKIRDAIEASIEGFDDYNARIARPGGFHLRIASREREWL
FT                   TPSGRANFIVHALPADTPIQRARARHGKRLMTLMTTRSHDQYNTTIYALDDRYRGVFGE
FT                   RRVVFAHPDDLAMLGFEAGERVDLETVWDDGIERRVAGFLLVAYDIPRGCLGAYYPETN
FT                   PLVPLDSVGDVCNTPTSKSIPVLMHRSAGDAAHAA"
FT   gene            543962..544870
FT                   /locus_tag="BMA10229_0500"
FT   CDS_pept        543962..544870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q8XTY1; match to
FT                   protein family HMM PF05249"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99757"
FT                   /db_xref="GOA:A2RX97"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX97"
FT                   /protein_id="ABM99757.1"
FT                   /translation="MIVRPREHGFRMLFVWNGSVLKSILPQLALMSAVSIVALLTNGRI
FT                   LGEKVPLNPTPFTLAGLALAIFAAFRNNASYDRYWEARKLWGGVLSAARALTSQALGYD
FT                   ALADGASFARATAGFVYALKHQLRGTDPTHDLRRRLPADWLDPVLAAQFRPVAILHALR
FT                   GRLAGRHRDGALTDAQLWMLDAQLNELAAKLAGCERIASTPIPFPYHVLLHRTVYAYCV
FT                   MLPFGLVDSIGIATPFVSVFVSYTLIALDAIAGEIAEPFGDGPNHLALDALTRQIERSL
FT                   FELAGLPLPDEMRAGPNHRLS"
FT   gene            545119..545571
FT                   /pseudo
FT                   /locus_tag="BMA10229_0501"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF05360"
FT   gene            complement(546007..547320)
FT                   /locus_tag="BMA10229_0502"
FT   CDS_pept        complement(546007..547320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0502"
FT                   /product="manganese/iron transporter, NRAMP family"
FT                   /note="identified by match to protein family HMM PF01566;
FT                   match to protein family HMM TIGR01197"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99308"
FT                   /db_xref="GOA:A2RX99"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A2RX99"
FT                   /protein_id="ABM99308.1"
FT                   /translation="MLSSTTMSRSAGDFATAGDASSRTVRAARDALEGRRKGVAAALPF
FT                   VGPAVIASIGYMDPGNFATNIQAGAAYGYELLWVVLAANVIAMVFQAMSAKLGIVTGRN
FT                   LAELCREHFPRPVVWGMWATSEIAAMATDLAEFLGGALAFGLLLHLPLIAGMAATAVLT
FT                   CAILTLEKRGFRPLEAAIAALVGVIGASYLGELLIAPQDWHAAAYHLVVPQLRDGTALT
FT                   LAVGIIGATIMPHTLYLHSGLTQRRTTPRDARERRLLLRFSNREVAVALGVAGFVNIAM
FT                   VMMASSAFHRTAPGMADIGDAYHTLIPLLGPAAGALFLVALFASGVSSSVVGTLAGQVV
FT                   MQGFLRRRVPIWVRRLVTIAPAFAIVALGCDVTRAMVLSQVVLSLVLPLPMAALLLLSS
FT                   RRALLGEHALRAPTLVAASAAAAAIVALNVYLIWAAFN"
FT   gene            complement(547419..548675)
FT                   /gene="oxdD"
FT                   /locus_tag="BMA10229_0503"
FT   CDS_pept        complement(547419..548675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxdD"
FT                   /locus_tag="BMA10229_0503"
FT                   /product="oxalate decarboxylase"
FT                   /EC_number="4.1.1.2"
FT                   /note="identified by match to protein family HMM PF00190;
FT                   match to protein family HMM PF07883; match to protein
FT                   family HMM TIGR03404"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98821"
FT                   /db_xref="GOA:A2RXA0"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017774"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXA0"
FT                   /protein_id="ABM98821.1"
FT                   /translation="MTNLSRRKMLAGTAGALAAAGIAVSAKAASFGNPDSPAEGAVNAR
FT                   NPQSLTDPGPQNPALMKEFPSFQSPPATDINGMPIFWASFNNAHKRIQNGGWAREVTQE
FT                   DFAISETISGVNMRLARGGIREMHWHQQAEWAFMLDGRCRITVLDEEGRPSVQDVKTGD
FT                   LWYFPPGLPHSLQGLGVDGAEFLLAFDNGRASEFNTLLVTDWIAHTPPDVLALNFGVPA
FT                   DAFRRIPLDNLWIFQGDDPGPLAAAQRASASSRGAPKHPFIFSMGDMKPNVKTRGGEVR
FT                   IVDSTNFAVSKTIAAALVTVKPGGMRELHWHPNADEWQYYIRGDARMTVFDTGPKAQTA
FT                   DFRAGDVGYVKKSLGHYVQNTGTTDLVFLEIFKADRYAEVSLSDWLAHTPPQLVEAHLH
FT                   IAPDVIARFPRNRPDVVPA"
FT   gene            548967..550559
FT                   /locus_tag="BMA10229_0504"
FT   CDS_pept        548967..550559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0504"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00044"
FT                   /db_xref="GOA:A2RXA1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXA1"
FT                   /protein_id="ABN00044.1"
FT                   /translation="MKHMLSKLAASAALAALAPVLAPAHAATPPGIFVIATQLGEFTTL
FT                   DPSEIYELVPSEYVANTYERLVRVDLREPSKFEGRIAQSWSVGADGLTYTFKLRTGLKF
FT                   HSGNPVTADDVAWSLQRTVLLDKGPAGVLADLGLTKDNVARKVRKLDDTTVSIETDRRY
FT                   APSFVLNVLSADPASIVDKQLLLSHEKNGDFGNAWLKNADAGSGPYRLVKWTPNESLVL
FT                   QRFDGYRAPYPMKRIVLRHVPEASAQRLLLENGDVDAARNLSPDSLAALSKAGKIHVAS
FT                   WPVSALLYLSLNTRNPNLAKPEVQEAMKWLVDYDGIQRNIVRTTYKVHQTFLPDGFLGA
FT                   LDANPYRQNVAKAKALLAKAGLPNGFAVTMDMPNDYPYVEIAQALQANFAQGGIQVKLI
FT                   PGDAKQAIGKYRARQHDIFIGEWSPDYMDPNSNARGFAWNPDNSDNAKHKLLAWRNGWD
FT                   VPQLTAKTDAALAEPSAAKRAQDYQALQKAVLANSPFVILFEKVVQVATRPGVTGPEIG
FT                   PINDLVSYRTLKK"
FT   gene            complement(550755..551420)
FT                   /locus_tag="BMA10229_0505"
FT   CDS_pept        complement(550755..551420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0505"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99038"
FT                   /db_xref="InterPro:IPR039558"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXA2"
FT                   /protein_id="ABM99038.1"
FT                   /translation="MARRARRIGMDGDHGGDMEAASRPGASSATRAWQDITIVDDLLPP
FT                   DEHAQIHRFLAAGQWSHGWRSHNGAQTQPFWNRHFAGATDPAQLDVGPGASDELARAAP
FT                   LVHACWRRLSQTYLTQHALQSCYANGLPYGADGALHADLLAMGACTAVYYPHERWDPDW
FT                   GGETVLFNKDRTDILCAVYPKPNRLLIFPGFVYHVARGVSRACPTMRITLMFKTQWRP"
FT   gene            complement(551481..554876)
FT                   /locus_tag="BMA10229_0506"
FT   CDS_pept        complement(551481..554876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0506"
FT                   /product="serine protease, subtilase family"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF03797; match to protein
FT                   family HMM TIGR01414; match to protein family HMM
FT                   TIGR02601"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98558"
FT                   /db_xref="GOA:A2RXA3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034061"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXA3"
FT                   /protein_id="ABM98558.1"
FT                   /translation="MLMTRHKKRKTMKRSGAKLLAPVVVAAAAAVAARPGWAQAAPYPD
FT                   PGRRGDPASWRTPEFTNAWGLGAMHAEYAYAAGYTGANVAIGVLDSGYYAQHPELPDSR
FT                   FVPVTAAGVSGVLNPNNNNHGTLVSGVVGGARDGVGMHGVAPDATVYEGNTNATDGFRF
FT                   GVSDPKFPASDAKYFAEAYDALAAKGVRIISNSWGSQPANENYSTLNKLTDAYKLHEAV
FT                   RTATGRGTWLDAAAKVSRDGVINNFSSGNTGYDNASLRGAYAYFHPELEGHWMTTTGYD
FT                   QLSGQVYNQCGIAKWWCVMAPTGVPSTSYSGGAAAPTGATYANFNGTSAAAPHASAALA
FT                   LIMERFPYMTSEQALSVLFTTAQNMEPDPSRPDYTNNGLFSTVHPAKPGASGVPNAFGG
FT                   WGLVDLRRAMNGPGQLLGTFDAALPAGTADVWSNDISDVALAARKREDDAEHRAWLDTL
FT                   RTKGWEHGLPAGASNGDRIDYALGVARETAYQAREYQGSLVKSGGGTLTLAGANTYRGP
FT                   TTVDGGELRIDGSIAARAVVNPAGRLTVNGRAADIAVNGGVATIAGTSANLSIDRQGRA
FT                   AVTGTTADVRVASGFASLGGTSGNVAVGALGVAAITGRTADVAVDGGRASLDGASGNVA
FT                   VGNGGVVSGSGTVRTLTAAANGTVAPGHSVGTLTVSGDVRFAPGSIYAVEVSPGGAGDR
FT                   IVAGGRAQIDGGALALALENTPPPLTPEQSRSVLGRRFEILNAAGGVAGRFDAPSGYLF
FT                   VNPVLAYGPTTVSLTIDRNATPFASVARTANERGVADALETADPGSAVYNSVLFAASAQ
FT                   APQATLAQLTGEIYPAAYAALVNESRQVRETALERLWTARGAPGRAGAWARLLGAWGSA
FT                   RGGDVNGYTSSTGGFLAGADAALLDSVRAGGFAGYSHTGVNLRNQPSSASFDSFHLGAY
FT                   AGWQPGALGVRIGAAHAWHRGGVDRAVQYGAVAENETTALHAETTQVFGEAGYRFALDG
FT                   AATLEPFFGVAYVHLKNQGTTETGGAAALRVRQGNHDVTFSTLGVRGETRLGLTSRLQL
FT                   TLQGSAGWQHALTDGQPSGTLAFATGSDTFTVSSVPVAKDAAVLNVGAGLELGKNGWLR
FT                   VGYSGSLASRQSEHAVQGSLHWKF"
FT   gene            554901..555149
FT                   /locus_tag="BMA10229_0507"
FT   CDS_pept        554901..555149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99407"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXA4"
FT                   /protein_id="ABM99407.1"
FT                   /translation="MFPIWIIDFFSFLFIGGPIEPPHSLCIRTRHFVERPSPRGRAGAA
FT                   AAPRATGRGRARRGVGPPARPFPWNRAIEQPTIFMKM"
FT   gene            complement(555919..556398)
FT                   /locus_tag="BMA10229_0508"
FT   CDS_pept        complement(555919..556398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00146"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXA5"
FT                   /protein_id="ABN00146.1"
FT                   /translation="MSDFIKIAKVAAQIDWQWDGEWWVREASRLGFKHEKSSASLEVYA
FT                   DPDGNAWRARVKEGKILFIEITFEKFVDVESLSVSEYEDKVDEFFARFEAAVAELTPAL
FT                   GKPVFSDGAAAKGFPDDQEANWLALWRVKNARLMLEQKHESREFPFRLCFVIAPA"
FT   gene            complement(556405..561030)
FT                   /locus_tag="BMA10229_0509"
FT   CDS_pept        complement(556405..561030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0509"
FT                   /product="YD repeat protein"
FT                   /note="identified by match to protein family HMM PF05488;
FT                   match to protein family HMM PF05593; match to protein
FT                   family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99110"
FT                   /db_xref="GOA:A2RXA6"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXA6"
FT                   /protein_id="ABM99110.1"
FT                   /translation="MGEVQSSAPSDSQQKLAALAQRGSNADAVQTVSNMGLAINAAQVT
FT                   AAGTSAWAAGTFQCFAGRVIAPLGGAMLGGALAEALGADRPVTWVLDKMGLPAVAKPGK
FT                   APARVGHKIVHENAFIGALTGLLAGIAVGVAIAAAAAAIVATGGAAAVAIAAAGPFVVG
FT                   FVSGAVGGFVGAAVAKGIGHTGSVTGAIAHGSPNVSFEGAPVARVTDPVTCSKDPGMPP
FT                   PQIAQGSLTVSVNGLPLARIGHKITCSAVIQEGCTTISADETTGTFGKIDANVSLLEQL
FT                   VLTATDVIMMRSATKEGGLLDGVLRELLGEPIDMATGDYADYRTDFTWPHVLPLTLSRA
FT                   YAGRQPVEGLLGDRWISNWSQRLRYRRPADGPATVTFFDADGQQLVYPVPHEPFNAINF
FT                   WAPHYALHGSRARAVVFDERSQQSLIFEPAHAEDDVARLTRIEDRNGNTIDFEYNALGR
FT                   LCTVRHSGGMTLWVTCDSRGLLQSVSEQPGGEGELVRYRFDGKRLTDVHSRFQGEFHFG
FT                   YTDEGWLNHWRDSGATQVALRYDERGRVIATRTNTALYDDRFEYDDEARLTTYIDALGH
FT                   RHQRWFDAQNRLIRSRDPLGRVMCASYDENGWLASRTDPLGRVSTYRHDCRGRPLQVTD
FT                   AFGRVSRYGWNGAGQLVEQQDHNGKVQWHYSAEGNLVALRARSGETRFRYDARGLLVGR
FT                   TDPDGAVHAWRYDGAGRPERWTDPLGRHTYLEHDRYGRLIARIDAAGHRTTYGYERGPS
FT                   NPREQLASITYPDGAIARFQYDSEGLLTEAVNPLGQRTRYAWGAFDLLASVTDPGQATT
FT                   RYHRDGAARLIGVTNAAGQHWKFERDPAGQLIAQTDWSGRRTRYVLNPMGQVTEKHLPD
FT                   GVAIRYEYDSQDRLVALTGPRRRHVFAWTASGLLTRAEVWTRNDEAGEWRRDDRLDLEY
FT                   DDACRLVEESQHGRAVGYEYDPMGRTRSMATPSGRTLWQYDAAGQLGSMESNGHRFHFD
FT                   YDGLGLETLRRYTPTQAHVARHPQWVEPYSEGYAQQQDHDGRWRLTKQACATWAELRER
FT                   GAARTRHYEWDAAGRCVGMHEARRGLPIAQDRWRYDARGQVVDAHYERTETRSGRERYE
FT                   YDALGNVSTRQIDAGEAMTHVYHGDQLVSAGPSRYEYDARGRMIARTERRDGFRPRTWR
FT                   YQWDDFDQLEQVLTPEGERWRYRYDAFGRRISKACLSTPKAGRPARIDYLWCGSRLIEA
FT                   WRAYGERDGTQYEIQRWHYRPGTHSVLAQERLKYDDKPDLQNSEWFALACDPNGAPHTL
FT                   YSSDGRIMWSARRELWGRVADDPDRDTVRHAVREQLRTSLLTGDAFDPPDCELRFPGQW
FT                   ADEESGLHYNFHRYYDPATGQYLSPDPLGLAGGLRTHAYVHDPLQWVDPLGLQGYQGSG
FT                   KPEFIGNRKLPQNDLPWIKYQKRVTGRPYEETWRVGDHNVNLDGKRAGYTVEAKWTGKN
FT                   SAAWESSPYNPEHEFYNESKILDQAGRLLEFNDASGGSGVRYAVSNAEAQQHFTQLFEQ
FT                   HFPTEMQGGTLSVWHVPGNGM"
FT   gene            complement(561082..561516)
FT                   /locus_tag="BMA10229_0510"
FT   CDS_pept        complement(561082..561516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08786"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99577"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXA7"
FT                   /protein_id="ABM99577.1"
FT                   /translation="MRYSVNEGHLELPGQWLDRSVNALLPAMAEVTGSNLVLTRDELPY
FT                   GVEFADYVDVQRAKYRKELSGLQMQRDEPGVLDGRPCQFLAFTWNKDDLLIHQMAVIVL
FT                   DAPLVLTYTSPGRLPDGVRDAIGAALASFRFHRGAQLPAS"
FT   gene            complement(561608..563593)
FT                   /locus_tag="BMA10229_0511"
FT   CDS_pept        complement(561608..563593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0511"
FT                   /product="Rhs element Vgr protein"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM TIGR01646; match to protein
FT                   family HMM TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00383"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR010609"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXA8"
FT                   /protein_id="ABN00383.1"
FT                   /translation="MKMSDIAGFLSLQNSRLLTIKTPLAGRSELVLSEFQCSEGLSVLF
FT                   DMRLGLVSRDPTIELKQMIGQAVTISLQPSGAIVGGSPRHFHGYVTQFSHTGADGGLAT
FT                   YSATVQPWLWMLSRRVDSRIFQDKSARDILDAVFSQYSALASYEFRAGRTLKPYSYCTQ
FT                   YRETDLNFVLRLMELEGLFFYFEHTEDGHKLIIDDDSTRAKPIDGPPSLRYASGEILED
FT                   EAVVTQWAAQRQLMSGAVSMKAYDYKVPAARRYVSGEADFNQGEVERYEIYDYVGLHGF
FT                   DSTDRGEELARFRLESLAASGKTFSGTSTGRTLASGRYFELSAHYDHDNGPMQDRQFLL
FT                   TNVRHHGVNNYQSSEGSGSYHASFQCIRKKIPFRPPLAHARPVIPGPQTAIVVGPKGEQ
FT                   IHTDALGRVKIQFHWDRIGQRNHGSSCWVRVSQPWAGGGFGSVQIPRIGDEVVVTFLDG
FT                   NPDRPLIISSVYNAQNMPPWALPAGATQSGFLTRSHKGTAENANAIRFEDKLGEEEIWL
FT                   HAERNQRIEVEHDESHTVGAKRTKTVGADEIVTIGGAQTHTITGARTQTIGADHTQTIK
FT                   GAHKQNVAGTHTQVIGGNASITTTGPQPGAAGTVGDIEIQSSQGKIHLKAATEIIIEVG
FT                   ASVIHLKADGTIEISGPTHIGLNSKS"
FT   gene            563883..565094
FT                   /locus_tag="BMA10229_0512"
FT   CDS_pept        563883..565094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0512"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98597"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXA9"
FT                   /protein_id="ABM98597.1"
FT                   /translation="MIIGLSDNGILLYSNTEYAKTMSKSPAFWEPYCHRSEAEFHLSNF
FT                   AARVLGRHAGVVFFDGIDAARLKQAIPDAHGDTLDLVAAVVRPPLMPIEPAETLDALTL
FT                   EQLSREWERRIAASAPSARPPLPAQGVAHARRFIDAPKTAFDAAAVGDTFGVLAGAVSI
FT                   VAIVGGGIALAPVLGAAAGAASLLLLAEDSSMPRYELKGDEVRKKKLETSWHCKLVETV
FT                   GPLLVLPELAVGGTRALASPPKAARQAGEAAEETAQAAQRLATQRHAFDAFKRASLDNP
FT                   DRAARRTGMHAMRTETSGLAAGVRRARQKMLAARRELLLLRTIEAPAYLASLYGAGVHG
FT                   MDPPEGGSRSTDWLRHRMDAQSSGDPDHPAHLLIPRHPTVDGSNGAPAMQLHVAVGHRP
FT                   EAAT"
FT   gene            565320..565601
FT                   /locus_tag="BMA10229_0513"
FT   CDS_pept        565320..565601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99907"
FT                   /db_xref="GOA:A2RXB0"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXB0"
FT                   /protein_id="ABM99907.1"
FT                   /translation="MSIGMGRGKLWAVRLFRWPSYGAIVCYLPILAAGVLLDAGSTPID
FT                   SGLAWAILGFAVVKLPCLFIIYRALKQVRWLDPASLPHEWEPSARRGA"
FT   gene            565636..565761
FT                   /locus_tag="BMA10229_0515"
FT   CDS_pept        565636..565761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0515"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98940"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXB1"
FT                   /protein_id="ABM98940.1"
FT                   /translation="MPFEPVQPARLAAPRDRRALATVAGSKRAARFNRLASTAHA"
FT   gene            complement(565730..565972)
FT                   /locus_tag="BMA10229_0514"
FT   CDS_pept        complement(565730..565972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00416"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXB2"
FT                   /protein_id="ABN00416.1"
FT                   /translation="MGPLARSCRPGGGGAEARRRAGRRGSGADAPGIGVQGDRIGSADC
FT                   AGRMAIERGARAKRASAAVRVAHADVTRARSTRAG"
FT   gene            566085..566975
FT                   /locus_tag="BMA10229_0516"
FT   CDS_pept        566085..566975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99460"
FT                   /db_xref="GOA:A2RXB3"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXB3"
FT                   /protein_id="ABM99460.1"
FT                   /translation="MPPAFVQTVETRFAELTPTAKRIASYMLANLERLGLETADQIARQ
FT                   TGTSGISVGRFLRSVGYRNLDDLKRELRGTAERSWMITDRLDEYRRVTGANAPARDEAA
FT                   PGGAPGALDDALARELDAIRHVYQLARTPGFAQVADRIAQADAVFILGIQSTRGISNAF
FT                   HSYLEYLRPRVFYSDGMSGSYVDSLNSEFADPYCIVTDTRAYSRIARRYCEAAGARGVR
FT                   FALVTDVYCPWARELPCDLLQVKTDVGQFWDSLAPLTCLFNLLISALVDRLGGTIDARV
FT                   ARNRELQRELDQFEP"
FT   gene            566995..567564
FT                   /gene="dppX"
FT                   /locus_tag="BMA10229_0517"
FT   CDS_pept        566995..567564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppX"
FT                   /locus_tag="BMA10229_0517"
FT                   /product="D-Ala-D-Ala dipeptidase"
FT                   /EC_number="3.4.13.22"
FT                   /note="identified by match to protein family HMM PF01427;
FT                   match to protein family HMM PF02557"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99928"
FT                   /db_xref="GOA:A2RXB4"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXB4"
FT                   /protein_id="ABM99928.1"
FT                   /translation="MKTSAHRLVEIAPHTHGVDVDLVYATERNLTGQPIYRRAHCLLLE
FT                   PAEAALRRAVAVAARSGLRLRIYDAYRPPRAQRILWDFLPDPNFVADLGRGSNHSRGTA
FT                   LDLTLVDANGDALDMGTGFDEMIAASNHFHDGLPEPVQRNRLLLLGVMHAAGFTHIASE
FT                   WWHYELPGSRALPLIDEEAGGPWRLM"
FT   gene            567713..569314
FT                   /locus_tag="BMA10229_0518"
FT   CDS_pept        567713..569314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0518"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98890"
FT                   /db_xref="GOA:A2RXB5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXB5"
FT                   /protein_id="ABM98890.1"
FT                   /translation="MTLSMPKLVAALAAASAFAAVPAREAHAAPPKDLFVMATLLDEFI
FT                   SLDPGEIYELVPEEYVANTYDRLVRVDLADPSKFNGDVAQSWSVSPDGLTFTFKLRAGL
FT                   AFHSGNPLTADDVAWSLQRAALLDKGPAAVLAGIGLTKANALANVKKLDALTVSVTTDR
FT                   KYAPSFVLNVLGSWPASIVDKKLLLSHQQGDDFGNGWLKTHEAGSGAYQLVKWTAGDSI
FT                   VLQRYDRYRLPLAMKRIVLRHVPEAASQRLLLESGDVDAARDLSPDDLAAVANSGKAKV
FT                   TPSPQATLLYLGLNTKNPTLAKPEVQQALKWLVDYDGIQRHVVKTTYQVHQTFMPEGLL
FT                   GALNANPYRLDVAKAKALLAKAGVPNGFTVTMDVRNDYPYTEIAQAVQANFAQAGVKVQ
FT                   LIPGDNKQTLAKYRARQHDIYIGEWSADYIDPHSNAQGFAWNPDNSDQSSYKMLAWRNA
FT                   WNIPRLTAQTDAALAEPSAAKRAQSYQAMQKEVLAKSPFVILFEKVAQVATRPGVSGLE
FT                   VGPINDLVSYRNLKKQ"
FT   gene            569335..570405
FT                   /locus_tag="BMA10229_0519"
FT   CDS_pept        569335..570405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0519"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99507"
FT                   /db_xref="GOA:A2RXB6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXB6"
FT                   /protein_id="ABM99507.1"
FT                   /translation="MSLPAPPLETPRTLPARRPGVRWALRALRWTLTLAVTFAGLLALT
FT                   FVIGRKVPIDPVLAVLGDRASAAAYAAERIALGLDKPLATQFLIYARDVLHGNLGMSLL
FT                   TSNPVLDDIRRVFPATLELATLATLIGVALGVPLGVAAAVKHNRPIDHVARFVGLIGNS
FT                   VPVFWLGLMGLLLFYARLHWVAGPGRLDPVYDGMVDPRTGSLLLDAALAGEWDVLRNAL
FT                   SHIALPAAILGYYSVAYLSRMTRSFMLDQLNQEYIVTARAKGLAERRVIWRHAFGNIAV
FT                   PLLTVIALTYSNLLEGSVLTEIVFAWPGIGSYLTGALLNADMNAVLGCTLVIGVMFITI
FT                   NLLTDALYRVFDPRAR"
FT   gene            570448..571389
FT                   /locus_tag="BMA10229_0520"
FT   CDS_pept        570448..571389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0520"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99842"
FT                   /db_xref="GOA:A2RXB7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXB7"
FT                   /protein_id="ABM99842.1"
FT                   /translation="MNASPDHSRPNPAATTLRAWLLSDAPASRRQATLGLAYRRWRRFA
FT                   GNPLNLLGLAILAALVAIALVAPFVMPHDPLRQVLADRLLPPGSPSHWLGTDQLGRDIL
FT                   SRLIAGSRLTLGIAILVVAIVVPIGLAIGTTAGYCGGLVDSALMRITDVALAFPKIVLA
FT                   LAFAAALGPGVVNAVVAISITAWPAYARLARAETLRIANADFIHAARLQGASDLRIVLR
FT                   YVMPLCLSSVIVRATLDMAGIILTVAGLGFLGLGAQPPSPEWGFMVASGRNVLLDAWWV
FT                   ATLPGASILVVSIAFNLLGDGLRDVFDPRHGA"
FT   gene            571391..572272
FT                   /locus_tag="BMA10229_0521"
FT   CDS_pept        571391..572272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0521"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00487"
FT                   /db_xref="GOA:A2RXB8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXB8"
FT                   /protein_id="ABN00487.1"
FT                   /translation="MPASSVSPNTPPLAEIERLRIGFRTHDGALVEAVRDLSFTLAPGE
FT                   RLGIVGESGSGKSLTGRALLGLLPAAAQWHARALRFEGRDLLALGARERRRLCGGAMGM
FT                   ILQDPKYSLNPVMTVATQMAEAFRLREPGLRGRALRERIVDALASVEIRDPARVADAYP
FT                   HELSGGMGQRVMIAMMVSTGPRLLVADEPTSALDVAVSMQVLAVLDDMIARHRTGLLFI
FT                   SHDLPLVTSFCDRVAVMYAGRVVETCAARDLVHAAHPYTRGLLAATPPLANPPDALPVL
FT                   ERDPAWLTQAAR"
FT   gene            572269..573036
FT                   /locus_tag="BMA10229_0522"
FT   CDS_pept        572269..573036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0522"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99159"
FT                   /db_xref="GOA:A2RXB9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXB9"
FT                   /protein_id="ABM99159.1"
FT                   /translation="MSDAPMIDIRDVSIRFPTRGGHVDAVRGASLAVGAGEAFGLVGES
FT                   GSGKSTLLRALTGLVPLAGGTLSIDSRAVEGKLDRAFRRDVQMVFQDPYASLHPRFTVD
FT                   ETLREPLAIHRLPDADARIARALAEVGLGPAFRFRYPHQLSGGQRQRVAIARALIVEPR
FT                   VLLLDEPTSALDVSVQAEILNLLKRLHRERGLTMILVSHNLAVVGFLCSRVAVMCDGAL
FT                   VEQLGIEDVRAARVGSEYTRTLLRATQGYRRAG"
FT   gene            complement(573612..573749)
FT                   /locus_tag="BMA10229_0523"
FT   CDS_pept        complement(573612..573749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0523"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99770"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXC0"
FT                   /protein_id="ABM99770.1"
FT                   /translation="MTNDSMSCVRRGRFQDRSGARRMQGDVRADGEGEEARLGGVARRT
FT                   "
FT   gene            573911..574213
FT                   /locus_tag="BMA10229_0524"
FT   CDS_pept        573911..574213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0524"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00198"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXC1"
FT                   /protein_id="ABN00198.1"
FT                   /translation="MTASMFALSFAAHAQQTGIVRFTGMIVEPPCSFSVAGGAGTHAQL
FT                   QPACPRPAKGSVTFVDPQSGAALRTVTFTELSRAIALPAGQTGDARPIVAVVSYL"
FT   gene            complement(574323..575195)
FT                   /locus_tag="BMA10229_0525"
FT   CDS_pept        complement(574323..575195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0525"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98511"
FT                   /db_xref="GOA:A2RXC2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXC2"
FT                   /protein_id="ABM98511.1"
FT                   /translation="MRRLPPLNALQIFATVARHRSFTRAADALCVTQGAISRQIQSLEA
FT                   HYGFALFMRHARGLTLTVEGEQLLPVVVESFARIEDISLKLTRQRTDLALKVPTCVMRW
FT                   VLPRIMRFQREHPDLHVQMTTTWRHDVDFQSEPFDAAIVYGISPGPDVAAVPLFDERLT
FT                   PVCAPDLLEGRPLARVEDLACHTLLHPTRDHRDWRRWLDYAGAAGVDPDRGPSFDSLDL
FT                   ATSAATQGFGVALGDLTLSEEDFAARRLAMPLDIVQRTGARYYFVYPESVAQQQKIRRF
FT                   SAWLDANRD"
FT   gene            575399..575761
FT                   /locus_tag="BMA10229_0526"
FT   CDS_pept        575399..575761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0526"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99508"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXC3"
FT                   /protein_id="ABM99508.1"
FT                   /translation="MTCAIRVLSNTNRRAASAAPLSRTIAGISAAHRAAGDKRPTLPAD
FT                   YVERRAPSRTSPMPVARRTAGARGARYRHRFAAHAHANARKRSADRHRSPTGRSLVPDD
FT                   RAREHADERRAQRRFA"
FT   gene            complement(575926..576870)
FT                   /gene="blaA"
FT                   /locus_tag="BMA10229_0527"
FT   CDS_pept        complement(575926..576870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blaA"
FT                   /locus_tag="BMA10229_0527"
FT                   /product="class A beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99563"
FT                   /db_xref="GOA:A2RXC4"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXC4"
FT                   /protein_id="ABM99563.1"
FT                   /translation="MRARRVPDSRPFNLPAIRLMNHSPLRRSLLVAAISTPLIGACAPL
FT                   RGQAKNVAAAERQLRELESTFDGRLGFVALDTATGARIAHRGDERFPFCSTSKMMLCAA
FT                   VLARSAGEPALLQRRIAYAKGDLIRYSPITEQHVGAGMSVAELCAATLQYSDNTAANLL
FT                   IALLGGPQTVTAYARSIGDATFRLDRREPELNTALPGDERDTTTPAAMAASVHRLLVGD
FT                   ALGAAQRAQLNAWMLGNKTGDARIRAGVPADWRVADKTGTGDYGTANDIGVAYPPNRAP
FT                   IVFIVYTTMRNPNAQARDDVIASATRIAARAFA"
FT   gene            complement(576988..577956)
FT                   /locus_tag="BMA10229_0528"
FT   CDS_pept        complement(576988..577956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0528"
FT                   /product="putative peptidoglycan-binding LysM/M23B
FT                   peptidase"
FT                   /note="identified by match to protein family HMM PF01476;
FT                   match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00258"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXC5"
FT                   /protein_id="ABN00258.1"
FT                   /translation="MTGVVSSMSKSEIDRSVAWLSGVAAAFVVAGCATTSPVTPTDTLA
FT                   AAASSASAAQPAAAPPGDAAQHPEHAAAPAPIATRYVVRRGDTLSAIAQANGCTVRELQ
FT                   AWNRMGRRTRIGIGQVLRIAPPGAENAVASEAADGAGATRAAGNAAGAARAADPASGAG
FT                   GALVADAPQPASAPESAADRAADHRVVQETKRHAQSIALAWPAKGAVVETFQPGRNRGI
FT                   RIVGRAGDPVRAAASGRVMYAGTGLNGYGTLILVQHNADFLTAYAHNRKVLVKTGDVVQ
FT                   QGEQIAEMGTGDSTRAGMLFEVRRDGKPVNPMPYLASRQQG"
FT   gene            complement(577981..578127)
FT                   /locus_tag="BMA10229_0529"
FT   CDS_pept        complement(577981..578127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0529"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99550"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXC6"
FT                   /protein_id="ABM99550.1"
FT                   /translation="MSRIEAACVACRRLIISFSIRFDRFDFAPRDARCDFVIILASGYT
FT                   RSG"
FT   gene            578344..578490
FT                   /locus_tag="BMA10229_0530"
FT   CDS_pept        578344..578490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0530"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00028"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXC7"
FT                   /protein_id="ABN00028.1"
FT                   /translation="MHRDLERQQPGRVASHALALRIDERAAMMRGNSSHEHAEPAKRTS
FT                   GTA"
FT   gene            578553..579464
FT                   /locus_tag="BMA10229_0531"
FT   CDS_pept        578553..579464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0531"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99405"
FT                   /db_xref="GOA:A2RXC8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXC8"
FT                   /protein_id="ABM99405.1"
FT                   /translation="MRFDLTDLRLFLHVCEAGSITGGAERAHMTLQSASERIRGMEEEL
FT                   GVPLLQRAKRGTRATEAGRALEHHARVVLQQIDHMRGELQQFGAGLRGHIRLLSNTAAL
FT                   SEYLPDALAEYLPRHPKLSVSVEERSSQEIVHAIRGKTADFGIVADSVGLDGLEQMPFR
FT                   EDWLIAVAAVDHSLAARERVAFAELVDADFIGMTDGSALQVHLADQAKALGKRIDYRVQ
FT                   LKSFDAICRLIERGVGIGIVSRHAALRAQQTMQIRLIELTDPWAHRRLTICARSFDELP
FT                   KYTREFIAFLAHDPGKDESFAA"
FT   gene            579475..579597
FT                   /locus_tag="BMA10229_0532"
FT   CDS_pept        579475..579597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0532"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98738"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXC9"
FT                   /protein_id="ABM98738.1"
FT                   /translation="MAAGARRTSFYPRAADKKWRELRRVLTRAARLPSDQWKVE"
FT   gene            complement(579966..581120)
FT                   /locus_tag="BMA10229_0533"
FT   CDS_pept        complement(579966..581120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0533"
FT                   /product="putative outer membrane porin"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00306"
FT                   /db_xref="GOA:A2RXD0"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXD0"
FT                   /protein_id="ABN00306.1"
FT                   /translation="MKKHVISAAALLAFAAPVFAQSSVTLYGVIDEGFNYTSNVNVNGV
FT                   GKSNYQLASGFVQGSRWGLRGSEDLGGGLKAIFTLENGFDVNNGRLGQGGRMFGRQAFV
FT                   GLSHAQYGSLTLGRQYDSLVDYLAPLTANGNWGGTLFSHPFDNDNTDNSFRVNNTVKYA
FT                   SPDWNGLQVGGTYSFSNATGFSNNRQYSIGAAYTLGGLQLAAAYLQANNPGKTAGGAIA
FT                   DNDANFTADRLRIFGGGVNYTFGPATVGFVYTKTDVKNPVSTVYLPTATFAGLGLSATK
FT                   FQNFEINGKYQLTPALFIGAQYVYTDGKFDAAAGSVKPKYHTVGLMADYNLSKRTDVYL
FT                   QGAYQKVAGDKTGTIADGGYVVGTDGPSASANQFAVRAAIRHKF"
FT   gene            581139..581387
FT                   /locus_tag="BMA10229_0534"
FT   CDS_pept        581139..581387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0534"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99716"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXD1"
FT                   /protein_id="ABM99716.1"
FT                   /translation="MVRRPRGCQAATISAFRRPIAGHVQRIPSLRPVSRDYCSRGNTVM
FT                   QKMQRPCWCITFFTFRCVLPTRASGFCQTRLSPRVNP"
FT   gene            581541..582695
FT                   /locus_tag="BMA10229_0535"
FT   CDS_pept        581541..582695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0535"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99108"
FT                   /db_xref="GOA:A2RXD2"
FT                   /db_xref="InterPro:IPR014550"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXD2"
FT                   /protein_id="ABM99108.1"
FT                   /translation="MNAAPAPRYVELDFFRGLVLLVIVVDHIGGSMLSRVTLHTYALCD
FT                   AAEVFVFLGGFATAIAYNSLATRHTEAAARQRFIKRAFEIYRAFLLTAGLMLFITAALN
FT                   AFAIDAPNMPTNDLDGLMHAPLAALRDILLLRRQPYLASVLPMYAFFALLVPLALPVAR
FT                   GRWWWLLVAVSAAIWLAARRIAGYLPTVDGVPWDFNPFAWQFLFVLGIVARCQPIYPVL
FT                   AKRPVGWFALAAAIAVVAAGAYYRLRIEPFPTDPSIKQNLGALRLANFIAIAWLAAKLV
FT                   HLGWMHRIARAMPWIGTIGRQGLLCFVAGTGISLLVDSLLYAATDGYLDLRLGLAADAA
FT                   AIGLLYVVAKLYAPLVARASDFVRQSPLLQPLRPFRLPLRRPKR"
FT   gene            582760..583605
FT                   /locus_tag="BMA10229_0537"
FT   CDS_pept        582760..583605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0537"
FT                   /product="putative esterase"
FT                   /note="identified by match to protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99845"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXD3"
FT                   /protein_id="ABM99845.1"
FT                   /translation="MRRFVSPLAALLAAALTAAAHAAPASSIVTRTFRSPALHRDWSYT
FT                   VYLPAGYNPEGARYPVLYLLHGNAGNANDWITQGRLQLTADALIERRDIAPVVIVMPQG
FT                   GTDWYVDRKEKMQSAFLDDLIPDVEAHYAVSNQRAGRAIGGVSMGGYGALRFAFLEPER
FT                   FCGAMLLSPAIYANEPPASSAARYVGVFGDRQFDPKVWHELNYPALWRGYFAQPLRLRM
FT                   FIAAGDDDLSIQAESSALYTSLRRAQNPAALRIVDGAHTWDVWRRLIGPALKYTLECVK
FT                   "
FT   gene            complement(583577..584524)
FT                   /locus_tag="BMA10229_0536"
FT   CDS_pept        complement(583577..584524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0536"
FT                   /product="ornithine cyclodeaminase/mu-crystallin family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02423"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98451"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXD4"
FT                   /protein_id="ABM98451.1"
FT                   /translation="MTTPVFDAAQTARVTPFAELVDALRTAALDADAGRIESPARLVVP
FT                   LNEGGVMLSMPASAADLAIHKLVTVCPRNRGGDLPTIQGQVSVVDPATGAPLFALDGPT
FT                   VTGRRTAAVTLLALRTFVAAAPRDVLLIGTGTQAAHHVEALAALFPGVRVKARAPAQAA
FT                   AFCARLRAVLPTLEPLGGDTLPETLDAVITATTSATPVYDDAARAGRLVVGVGAFTPGA
FT                   AEVGARTIAGSALYVDDPAGARHEAGDLIVAGVDWARVRSLADALRATVSTPASNASPA
FT                   PGAPVFFKSVGCAAWDLAACRVARAVTSRTRACT"
FT   gene            complement(585124..585681)
FT                   /gene="pcaC"
FT                   /locus_tag="BMA10229_0538"
FT   CDS_pept        complement(585124..585681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="BMA10229_0538"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="identified by match to protein family HMM PF02627"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98643"
FT                   /db_xref="GOA:A2RXD5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXD5"
FT                   /protein_id="ABM98643.1"
FT                   /translation="MTILNLPRTARGRRRRDWGKSSSAKRRREDAGRVASVPNRNPLRP
FT                   LHSEQESSMSEADREQGKARRTQVMGDAFVERAMSDLDGFSRPLQDWLNEHAWGSTWRR
FT                   GGIDLKTRSLCTCAMLAALGRGHELKGHIRGALNNGASLIEIREVLLHSALYAGAPAAV
FT                   EAFRHAREVIDALALDAPDDGA"
FT   gene            585560..585730
FT                   /locus_tag="BMA10229_0539"
FT   CDS_pept        585560..585730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00109"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXD6"
FT                   /protein_id="ABN00109.1"
FT                   /translation="MRFGTDATRPASSRRRFALELFPQSRRRRPRAVRGKFRIVNEIHH
FT                   EYRIGKPAAPV"
FT   gene            585745..585912
FT                   /locus_tag="BMA10229_0540"
FT   CDS_pept        585745..585912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0540"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99619"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXD7"
FT                   /protein_id="ABM99619.1"
FT                   /translation="MRPTCARPEPPSARRRKRGRAPPVGCRPKHLRRRARRGHARDARS
FT                   KQEIRRTDLG"
FT   gene            585905..586795
FT                   /locus_tag="BMA10229_0541"
FT   CDS_pept        585905..586795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0541"
FT                   /product="alpha/beta hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99114"
FT                   /db_xref="GOA:A2RXD8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXD8"
FT                   /protein_id="ABM99114.1"
FT                   /translation="MDEARRVTSFHHDGLTFDAVDTGPLDGEVIVLLHGWPQTAKCWAR
FT                   VAARLNADGYRTVAPNQRGYSPLARPRRVGAYRMPHLVGDVVALIERLGGGPVHVVGHD
FT                   WGAAVAWALAGRHPAAVRTLTTVSVPHSGAFMRSMLSSDQLFRSYYMGLFQLPKLPELF
FT                   VTRCRGLFEKMLTGTGMTRDEVDTVYADIVEAGALTTSLNWYRAMMLTPPGYLTRKVPV
FT                   PVLHVWGARDAALSRRGAELAREFASGPYRLEVLPHATHWIPEHDAERLAALVRESIAV
FT                   KPGAAPGPLAAAAAN"
FT   gene            complement(586849..587829)
FT                   /locus_tag="BMA10229_0542"
FT   CDS_pept        complement(586849..587829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0542"
FT                   /product="TrkA domain protein"
FT                   /note="identified by match to protein family HMM PF02254;
FT                   match to protein family HMM PF07885"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98632"
FT                   /db_xref="GOA:A2RXD9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXD9"
FT                   /protein_id="ABM98632.1"
FT                   /translation="MRLALVVGLCALAFLVLYLDRDGLRDSTKSEPMSIADLVYFTMVT
FT                   VATVGYGDIVPVTARARLIDAFFIVPIRIGIWFIFLGTAYQFVIQRVIEEYRMKRLQKN
FT                   LRDHVVICGYGLSGSIAVRELLESGVDPATLIVIDSQEQALEAAAALGVTGLCGDPAHE
FT                   DLLQQAQVRSAKAVIISVTDDPTAILLTLSVRSIAPDTKIVVRIQENLYQRQLRQAGAD
FT                   VIVSSTKIGALLLADAVESRYIVPFVNDMLSTRGRATLVERPAAAHEIGCMSNAVAGAL
FT                   VVGLDRGGRILSFYEDPPCLIEAGDTLVVIQSTRAMERAGIELAD"
FT   gene            complement(588226..589554)
FT                   /locus_tag="BMA10229_0543"
FT   CDS_pept        complement(588226..589554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99867"
FT                   /db_xref="GOA:A2RXE0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXE0"
FT                   /protein_id="ABM99867.1"
FT                   /translation="MTTTYPLYKTLARADEPFPAQADVVIAGAGIMGCAAAYYLGLRGI
FT                   KAAVFDKSRIAGQQSTRAWGFVRQQGREAAEVPLMMAGMRLWEGLERELGADLEWRQGG
FT                   CLYLADNDDDWASFRQWTDVARAHGLDTRTLARAEIDAHVSGLAAPALGGLYTASDGQA
FT                   EPRRVAAAFAARAIEAGARFFEGCGVTAIDTSGGAVAGVVTERGVVKARRVICAAGATS
FT                   FRLLDGVGIRLPQQAVRGTCMRTNPLPAVSASTIWGHGLGIRQRANGAINLADDMQVDV
FT                   DVTLGHLRGLSLFLPELWARREKFRFHLNGAAWRDLKARAAGGAAVLEPRDPNPQPNPA
FT                   HAPRALAKLKAVFPALRDARIVEAWAGLIDVLPDGIPVIDAPRAPDGLAIATGFCGHGF
FT                   AMGPIVGSLLAEWVDTGATSLDLSAFRAARFVDGTMRRPASML"
FT   gene            589733..590641
FT                   /locus_tag="BMA10229_0544"
FT   CDS_pept        589733..590641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08667"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99482"
FT                   /db_xref="GOA:A2RXE1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013975"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXE1"
FT                   /protein_id="ABM99482.1"
FT                   /translation="MRHQALRSESLDPIRSRCMANEAITTDSLAVAERVRELMTRHGIG
FT                   KRQQTTELCRILDLSFSQGHRKLRGSSPWTLAQIKKVAEAYGEPAAQLFGAQALDPGMV
FT                   GACARDAVLYAGIAEIACTAWIGGLLDAGARPEFVAYEQQGRWRVLRHTGVLYQNAYDV
FT                   HKIEIYPRRAESDRLLVAVIDADSVSADEVCRYLDEQGFVTAHFGSIDAFADALQGQAF
FT                   DAVVTEWMFDGRNAADAIQAVRASDNPGAPIFVLTGDLLTGRASEAEISEVIRVYDVVC
FT                   YEKPARMAILSADLAKRLSRA"
FT   gene            complement(590992..591144)
FT                   /locus_tag="BMA10229_0545"
FT   CDS_pept        complement(590992..591144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0545"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98860"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXE2"
FT                   /protein_id="ABM98860.1"
FT                   /translation="MCRGRAFATRSRRVEEVLLEGGPRWNERAAHGAYAAACARTRREC
FT                   RSAEA"
FT   gene            591284..592948
FT                   /locus_tag="BMA10229_0546"
FT   CDS_pept        591284..592948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0546"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00182"
FT                   /db_xref="GOA:A2RXE3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXE3"
FT                   /protein_id="ABN00182.1"
FT                   /translation="MARIIPDDWKNLAATGAAERERETLATLERTLPDAYTVYHGVHWT
FT                   RADHNFSVFGEAHFVIVSPAGRVLVIEQKAGFLRETPKGLVKVYLQTERNVSIQLARTL
FT                   ENLHRRLTAALGAGAYGVEELLYCPDYTIRNPAIAGVAPARIVDATRRHALAARIVDAL
FT                   PADEPPFPSAAKVHHFLADELSLTPDTSALVGQADTLVTRLSGGLAAWARRLEFEPFRL
FT                   RVIATAGAGKTQLAVQAMRGAISAGKRVLYVCFNRPLADHVARIAPQGVKIANYHQLCD
FT                   WIARDGGHVPDFGARDAFAQLEARFAQTPIAERWRFDTLIVDEGQDFQPSWAHALERLV
FT                   APGGAWWWLEDPLQNLYMRERVPLPGWVTLKETTNYRSPRDILDYVRDVVGSVEPLAAE
FT                   LVSGSPFGGSEISISAYDDAHAQSPAQACIDATKRAITHALALGFRKQDIAVLSFRGRE
FT                   GSALATLDQLGPHRVKSFTGKYDLFGNPEYREGDVLLDSLHRFKGQAAPCVILTEVDFD
FT                   AFDERAARKLFVGATRATMKLIVVASKRAAQRIAPSA"
FT   gene            complement(593181..593294)
FT                   /locus_tag="BMA10229_0547"
FT   CDS_pept        complement(593181..593294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0547"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99538"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXE4"
FT                   /protein_id="ABM99538.1"
FT                   /translation="MSQQNAALVEQAAAAAASLEEQADGLRRTVGAFRVVA"
FT   gene            complement(593295..594887)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0548"
FT                   /note="methyl-accepting chemotaxis protein; this gene
FT                   contains a premature stop which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00015; match to protein family HMM PF00672"
FT   gene            594735..594902
FT                   /locus_tag="BMA10229_0549"
FT   CDS_pept        594735..594902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0549"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99013"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXE6"
FT                   /protein_id="ABM99013.1"
FT                   /translation="MTRKSRKWVAAGSGDSRRYYGPASENLRRLKRCGDMPRFARRRRG
FT                   CSAGNQWKFL"
FT   gene            594975..596489
FT                   /locus_tag="BMA10229_0550"
FT   CDS_pept        594975..596489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0550"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99596"
FT                   /db_xref="GOA:A2RXE7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXE7"
FT                   /protein_id="ABM99596.1"
FT                   /translation="MSPDSSAPPAHADAGRPVASVRLTIAALLLVLLLSALDQTIVSTA
FT                   LPTIVGDLGGLEKLSWVVTAYLLSSTVVLPLYGKLGDLYGRKIVLQAAIVLFVVGSALC
FT                   GLAQDMTQLIVLRALQGLGGGGLMVVTMAAIADLIPPDERGRYQGMFGGVYGIATVIGP
FT                   LLGGFLVQHLSWRWIFYINLPLGALAFAVIGAAFKPHTAHVRRRIDYAGAAFLATALTC
FT                   VVLFTSQGGTILPWSSPQLWFTLALGLVATAGFVYEERLAAEPILPLELFRHRTFVLCC
FT                   LIGFVVGLALFGSVTFLPLYLQVVKGSTPSEAGMQVLPMMGGLLATSIGSGRLITTLGK
FT                   YRLFPIAGTFVACAAMLLLATLSLDTPLRAMYLYMALLGDGLGMVMPVIVLAVQNTVEF
FT                   RHLGVATSGATLFRSIGDSLGVAAFGALFSNGLHARLAATLPPDTELPPSLGPSAVRQL
FT                   PGAVRSAYLHAFASSLHTVYLCAAAVIAIAFALAWLVEDAPLRKRA"
FT   gene            complement(596524..597534)
FT                   /locus_tag="BMA10229_0551"
FT   CDS_pept        complement(596524..597534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0551"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99976"
FT                   /db_xref="GOA:A2RXE8"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXE8"
FT                   /protein_id="ABM99976.1"
FT                   /translation="MPDDSVQLGRPAASQPRVEVATEAASASGDPSDPSRSSGARRSPH
FT                   ALDAAGPAAAPCAAEPPRSAAPGAARMPRVHRAFTSLQTHYKKLDTAQKLYLNCALALL
FT                   LYGVTYPLHAWWNFVGLALLSLAFWFAGMVCDALTLYKRIYATHIGKGLLLLAFTGFTN
FT                   FAIALANQRINAFAGVDPSKFPHTEIFVAILSIPFIALLILMMLYTASVLFLPVYGVFF
FT                   IAMDAKAKAFFSAGLMKQDDSEYPVITGIFRFVSFFVFAGVVLFFAKRMLGDYDRFMTS
FT                   TAERSVYQLEMYEKSPCDVPAGARVAFLDDGNIVYALRVGAELKFFPQRCKRSGQ"
FT   gene            complement(597543..597656)
FT                   /locus_tag="BMA10229_0552"
FT   CDS_pept        complement(597543..597656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0552"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00566"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXE9"
FT                   /protein_id="ABN00566.1"
FT                   /translation="MRVAAPQARAVRHPLRAQRTRSAMRSVRPMVSQPGAA"
FT   gene            complement(597717..597866)
FT                   /locus_tag="BMA10229_0553"
FT   CDS_pept        complement(597717..597866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0553"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99360"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXF0"
FT                   /protein_id="ABM99360.1"
FT                   /translation="MARGLSSRAARLILIIGGYSDGPRGAMKADVAARQASIMKKMRAA
FT                   VLAR"
FT   gene            597865..598608
FT                   /gene="pat"
FT                   /locus_tag="BMA10229_0554"
FT   CDS_pept        597865..598608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pat"
FT                   /locus_tag="BMA10229_0554"
FT                   /product="phosphinothricin N-acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99800"
FT                   /db_xref="GOA:A2RXF1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXF1"
FT                   /protein_id="ABM99800.1"
FT                   /translation="MRAVDCECPLRRPIAARSRRSAHRRVARRAHRSTPPRLADIDECA
FT                   HSSDFVIPALFVFEMKATDAPTSSAIVRDATEHDLEAIQAIYAHHVLTGVASFEETPPS
FT                   VDDLRARREAVRRHGLPYLVAELDGVVAGYAYATPYRPRSAYRYAIEDSTYVNEACRGR
FT                   GIGRVLLAALIARCEAGPWRQMIAVIADGGRGGSTSLHRALGFEPIGTLRGVGFKHGRW
FT                   IDTALMQRVLGDGAQTPPSNADASH"
FT   gene            598636..599493
FT                   /locus_tag="BMA10229_0555"
FT   CDS_pept        598636..599493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0555"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00510"
FT                   /db_xref="GOA:A2RXF2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXF2"
FT                   /protein_id="ABN00510.1"
FT                   /translation="MPKSNSTTPADVAPDASMSNEYTVDELARVSDTTVRNVRAYQDRG
FT                   LLAPPRKRGRVGIYDDTHVARLKVINHLLARGYTLSNIQDLIKAIDDGHDLRSILGLEN
FT                   AIGGRWSNERPQTFSLAQLIQMFGPQTPASLGRVAELGLLERRGVSFVAKSPALIEAAA
FT                   AMVREGIPARELLDAISITRPYFDAIARVLVELVVRRLDRYDEGSLPPPTDVPALVDAI
FT                   WRLRPLSSVFVEGEMNRALEAASSAYLGGRVATILDKKLSSQAAREGEPELERVTAKGA
FT                   PKKR"
FT   gene            599618..600601
FT                   /locus_tag="BMA10229_0556"
FT   CDS_pept        599618..600601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0556"
FT                   /product="aliphatic compound ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="identified by match to protein family HMM TIGR01728"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98793"
FT                   /db_xref="GOA:A2RXF3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXF3"
FT                   /protein_id="ABM98793.1"
FT                   /translation="MIRPARWFARTVTAALASLCVASAFAQDAAGDKVLRVGYQKAGLL
FT                   AVVKAQGTLETRVKPLGYTVKWFEFPAGPQLLEALNADSVDIGYTGAPPAVFAQASGVR
FT                   FVYVGAEPPSPHNEAIVVKADSPLRRVADLRGRKVALQKGSSANYLLLEALRQAGVRYD
FT                   EIRPIYLPPADARAAFESGTVDAWVVWDPYYAAAQHALKARTLADYTGLSATYNFYEAT
FT                   RDFATRHPDVVGAVLQQLRETGLWVNAHSAETAALIAPKIGLDRALVETWVKRVPYGTT
FT                   PLDDKIVASQQRVADAFLAAKLIPRKLTVADNVWTERRAADALAAK"
FT   gene            600788..601438
FT                   /locus_tag="BMA10229_0557"
FT   CDS_pept        600788..601438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0557"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF07947"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99644"
FT                   /db_xref="GOA:A2RXF4"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXF4"
FT                   /protein_id="ABM99644.1"
FT                   /translation="MLSHLPPRVRGLWLAAALAALLYGLSLGHAPYSGQPAAKAALGVL
FT                   LLAAALRHPLARERAWLGAALAASTLGDVLLALASWPPSFVAGLGAFLLAHLAYCALFA
FT                   PWRAAPRGARAVALGAVWLAAPALYAAFLPHLAALAAPVAVYVAVLGAMASFALCARTP
FT                   GPQVAAGALVFVASDALIGIDRFLGAFSGVDYFIWFLYAIAQLTMAFGVLRRK"
FT   gene            601684..603273
FT                   /locus_tag="BMA10229_0558"
FT   CDS_pept        601684..603273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0558"
FT                   /product="4-hydroxyacetophenone monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00414"
FT                   /db_xref="GOA:A2RXF5"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXF5"
FT                   /protein_id="ABN00414.1"
FT                   /translation="MNARNMSFGPLDSTNREETLDIAIIGTGFSGLGMAIRLRQTGNQD
FT                   FAVFEKASSVGGTWRDNHYPGCACDVQSHVYSFSFAPNPRWTRMFAPQPEIRAYMEDCV
FT                   QRFNVGSHLRFDHELVNATYDETAHRWHLTFANGKRVCARVLVSGMGGLSRAAYPNIPG
FT                   IETFKGEAFHSQHWKHDYALEGKRVAVIGTGASAIQFVPQIAPRVAKLALFQRTPPWIM
FT                   PKPDRAVSGVEQWLFRNLPFTQKLMRAGLYWMLESRVLGFAVHPSTMKLVQKLALRHID
FT                   KQISEPELRAAVTPDYTIGCKRILMSNDYYPALTRKNVDVITTGIERIEEDAVVTTDGK
FT                   RHEVDCLIYGTGFQINNPFPRGTIVGRGGVDVVDAWRDGLHAYLGATVPGYPNWFILMG
FT                   PNTGLGHNSMVYMIESQIEYVLGALKAMRTERAEAIEVRPLVELEYNNRIQNKLKGTVW
FT                   STGGCSSWYLDPRTGKNTTLWPTFTWRFRQETAFFSTADYHLYYANPRQSPQPVPALAS
FT                   AAAATATAETTA"
FT   gene            603301..604227
FT                   /locus_tag="BMA10229_0559"
FT   CDS_pept        603301..604227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0559"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00159"
FT                   /db_xref="GOA:A2RXF6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXF6"
FT                   /protein_id="ABN00159.1"
FT                   /translation="MKSFSNKVAAITGAGSGMGRSLAVQLAQQHCHVALADRNAVGLAE
FT                   TERIIRALAPSVRVTSRVLDVGDRAAMHAWADETAAAHGRVNLVFNNAGVALSSTIDGM
FT                   EYSDLEWIVNINFWGVVHGTKAFLPYLKASGDGHVINTSSIFGIFAQPGMSGYNATKYA
FT                   VRGFTESLRQELDMMKCGVSATCVHPGGIRTNIAQSARLAQNMVGFMVESEQQGKADFE
FT                   KFFITTADEAARVILHGVRKNKRRVLIGRDARGADWLARTLPAAYQPLVVLATKLQSAR
FT                   ARRRAGRATPAPAHATYNNAGNQGEQS"
FT   gene            604224..605138
FT                   /locus_tag="BMA10229_0560"
FT   CDS_pept        604224..605138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99669"
FT                   /db_xref="GOA:A2RXF7"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXF7"
FT                   /protein_id="ABM99669.1"
FT                   /translation="MTTPHMMPVRRDIRFALPADRAHDWHVQGAPVTHFMNALSLLFPA
FT                   GERFFMDSVRNYRDEIHDPELKKQVAGFIGQEAMHTREHIEYNDLLQSAGLPAHKLDKR
FT                   LWALLGWGKKVLPNSVQLAITIALEHYTAILANQLLSGYTHRIDGSVEGYKQMWLWHAM
FT                   EETEHKAVSYDVWNTVMKPGVKTYLLRTGTMLATTLIFWAVVFDFHVRLMFAHRMRHGK
FT                   LKGMWRLVKYLYSPKNGVFPSIALEWLDYFRPGFHPWDHDNRVYLQGLDTLLANIDAAN
FT                   ERYADQVAPRRVPLHSLPEHQHA"
FT   gene            605150..606103
FT                   /locus_tag="BMA10229_0561"
FT   CDS_pept        605150..606103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0561"
FT                   /product="EphD"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99143"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXF8"
FT                   /protein_id="ABM99143.1"
FT                   /translation="MATVRDTLTVRSGDVRLAVYLSGPRNAPPVILVHGYPDSARVWER
FT                   VREHLDKRFRVIAYDVRGAGASDAPKRRADYKLSVLAQDLLAVADVTCGDRPFHLVGHD
FT                   WGSIQCWEAATDPAVKGRLASYTSISGPCLDHVFRAPLNLRQTLKSWYIAFFHLPLVPE
FT                   LVWRLGGAKLWPLWLRRTERIVADADPDQLRNGLNGLKLYRANFIERARRPRERYAQAP
FT                   VQIIVPRYDRYVTPALTRGLDRWLGAHRRDEIAASHWTVIRDAALIAARIGRFAAAHEP
FT                   KRHAIAAGGAKSGGQPRAKQRTNQHASAGRRLKSVS"
FT   gene            complement(606175..606513)
FT                   /locus_tag="BMA10229_0562"
FT   CDS_pept        complement(606175..606513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0562"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98663"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXF9"
FT                   /protein_id="ABM98663.1"
FT                   /translation="MVFAGGRRRRFGRSSAIRASGWRCMARSRPNRGEREGGRRAKCVV
FT                   RRSEASEGDRCAAASRVRAPRRLAIRRLDGSMARRLGLRGRRADRRCADEPVRRRTAMP
FT                   TRRADVAR"
FT   gene            complement(606684..607925)
FT                   /locus_tag="BMA10229_0563"
FT   CDS_pept        complement(606684..607925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0563"
FT                   /product="putative integral membrane transport protein"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98654"
FT                   /db_xref="GOA:A2RXG0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXG0"
FT                   /protein_id="ABM98654.1"
FT                   /translation="MLATSVGNALEWFDIAIYAFFAVHIAKNFFPTANETASMLLTFGS
FT                   FGASYLVRPIGGMVLGAYADKRGRKAALMMSVGLMMIGTAIIAVIPPHASIGLLAPAGV
FT                   FIARLIQGFSAGGEFGASTAMLIEHAPERRGLLASWQFTTQGLATLLASTFGFALAKLM
FT                   PASELSAWGWRMPFFFGLLIGPAGLYLGRFLEDAADYTEAEHTATPVRDVLTRQKALLL
FT                   TSIGALTVSTAVNYLLQYVPTFAIRELHLDASTGFAASIVAGLMLTLVTPFAGHLSDKI
FT                   GRVKQMSTAALLLFVTGYPAFAYVVSHVSVAALFGLVAWLALLKAVYFGALPALMSEIF
FT                   PTSTRVTSISISYNIGVTVFGGFTPAIVIWLSSATGSKAAPSFYMMFTAVISLAALAAV
FT                   SRGKEPLSSAGTAA"
FT   gene            608007..608270
FT                   /locus_tag="BMA10229_0564"
FT   CDS_pept        608007..608270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0564"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99833"
FT                   /db_xref="GOA:A2RW75"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW75"
FT                   /protein_id="ABM99833.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            608294..609127
FT                   /locus_tag="BMA10229_0565"
FT   CDS_pept        608294..609127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0565"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99397"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABM99397.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(609544..610608)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0566"
FT                   /note="pyridine nucleotide-disulphide oxidoreductase, class
FT                   II, truncation; this gene contains a frame shift which may
FT                   be the result of a sequencing error; identified by match to
FT                   protein family HMM PF07992"
FT   gene            610738..611199
FT                   /locus_tag="BMA10229_0567"
FT   CDS_pept        610738..611199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0567"
FT                   /product="transcriptional regulator"
FT                   /note="identified by similarity to OMNI:NTL01AT0228; match
FT                   to protein family HMM PF02082; match to protein family HMM
FT                   PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98960"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXG4"
FT                   /protein_id="ABM98960.1"
FT                   /translation="MPRDNRLSRMLHVLIHMDRHVERATSEAIAKMLGTNPVVVRRMMA
FT                   GLRDQGYVRSEKGHGGGWELVCDLDAITLLDVYRAIGEPPLFSIGPHAEQSDCLVEKAV
FT                   DARMTEALGEAQALLLARFGAITVGDLARDFDKRHARHKAGKRGNCTAA"
FT   gene            complement(611319..611867)
FT                   /locus_tag="BMA10229_0568"
FT   CDS_pept        complement(611319..611867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06475"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99336"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXG5"
FT                   /protein_id="ABM99336.1"
FT                   /translation="MRWASLEHDGIEHLAFERHARGSVAESVVVGRSGGRAYGLAYRVV
FT                   CDARWRAKQVIVTMMGGGTLELRGDGEGRWRNAADERLGALDGCIDVDIAATPYTNTLP
FT                   IRRLGLARGERRPVDVVYVSIPDLTVSAMQQAYQCIVPDRVYRYESVVSGFTAHLEVDR
FT                   DGLVVDYEALFRRASDDAR"
FT   gene            complement(611956..612165)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0569"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(612172..613044)
FT                   /gene="nhoA"
FT                   /locus_tag="BMA10229_0570"
FT   CDS_pept        complement(612172..613044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhoA"
FT                   /locus_tag="BMA10229_0570"
FT                   /product="N-hydroxyarylamine O-acetyltransferase"
FT                   /EC_number="2.3.1.118"
FT                   /note="identified by match to protein family HMM PF00797"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99873"
FT                   /db_xref="GOA:A2RXG7"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXG7"
FT                   /protein_id="ABM99873.1"
FT                   /translation="MRDAVDLSRYFARIGYRGPAEPTLDVLRQLQLLHPQSIPFENLNP
FT                   FTGARVALELESVVDKLVGQRRGGYCFEQNKLFYTVLVQLGFRVTPLIARVRWQRPPEQ
FT                   STPQTHMLLRIDLDGDTWFADVGFGSTTLTAPLRHDPNVAQPTPHGTFRVVDAPVAGEF
FT                   EIECETPNGWHPLYRFSLKPVEWVDYEVANWYTSRHPDSFFTHDFIACRILPDARALLF
FT                   NDALTLRTADGAAHTTRLTDADAWAACVRERFGLDLDGFDAAALYARAVARADEAAAAA
FT                   ERRDGSAAR"
FT   gene            complement(613161..613862)
FT                   /locus_tag="BMA10229_0571"
FT   CDS_pept        complement(613161..613862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0571"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00481"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXG8"
FT                   /protein_id="ABN00481.1"
FT                   /translation="MKTINRLAKRAALVCCAGSVWASGAALAQVDWQSLGASLLGGGES
FT                   QQAGASGLPQLLQSYVGANQQVLAGQASLASAMGLTGAAGQAQHAAGLLTNGGTGALTP
FT                   GALSQVGGAQQSVAQALTQAFASGGANGAVSGAGVDKAAFTRGLASLGEGVTQYSRLQS
FT                   GLGKLGESNPASLLQSGLDPNNLKAASYIAQSAPNQFQSIGGTLGAAVQYAMSHGISVP
FT                   SVASSALKLLP"
FT   gene            complement(613923..614156)
FT                   /locus_tag="BMA10229_0572"
FT   CDS_pept        complement(613923..614156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0572"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98896"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXG9"
FT                   /protein_id="ABM98896.1"
FT                   /translation="MIRREREPLGRRMERTATARRAPVAIVVGAEAARASTLGWRERVR
FT                   TRCAAELRGAPIVPRRAACLRRSLSIRFDMYP"
FT   gene            614299..614523
FT                   /locus_tag="BMA10229_0573"
FT   CDS_pept        614299..614523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00015"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXH0"
FT                   /protein_id="ABN00015.1"
FT                   /translation="MDTSTVDAVAIAAKLAKEISPHPPQWIIDLYAATLVQRHGFARTG
FT                   DEIKQAQKAFFESRQAIVAALSTYRSPTD"
FT   gene            614556..614672
FT                   /locus_tag="BMA10229_0574"
FT   CDS_pept        614556..614672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0574"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00591"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXH1"
FT                   /protein_id="ABN00591.1"
FT                   /translation="MSAIDRLATGLARSRPKMRTRPARHAFKRTDAAGPIDP"
FT   gene            complement(614691..615992)
FT                   /locus_tag="BMA10229_0575"
FT   CDS_pept        complement(614691..615992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0575"
FT                   /product="trans-sulfuration enzyme family protein"
FT                   /note="identified by match to protein family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98519"
FT                   /db_xref="GOA:A2RXH2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXH2"
FT                   /protein_id="ABM98519.1"
FT                   /translation="MTYSSYHKKDIEGRPLHPETQMMSYGFDPFLSEGAVKPPVFLTST
FT                   FAFRSAEDGADFFDIVSGRKPLPQGEAAGLVYSRFNHPNLEIVEDRLALLDGSEAAVVT
FT                   SSGMSAISAIFLAFLRPGDQLVQSVPLYGGTETLIAKYFREWGVGAHSIDNGLSPQAIG
FT                   AALEAAAQQGPVRLCYVETPANPTNALIDLDGMRRELDAFEARHGYRPISVCDNTLLGP
FT                   IFQKPSEHGVDMSVYSLTKYVGGHSDLVGGGVTGRRDLVAKVRAVRSAFGSQLDPHSSW
FT                   MLIRSMETVVLRMKQAARTASAVAKWLATNPHQKVDVYHPELIVDDAYQAVYKRQCTGA
FT                   GSTFAFVLNGGRAEAFRFINALHLFKSAVSLGGTESLICHPASTTHSGVPEAARKAAGV
FT                   SEGLIRVSIGLEHEEDLIADLDHAFRRSGLATGV"
FT   gene            616180..616662
FT                   /locus_tag="BMA10229_0576"
FT   CDS_pept        616180..616662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0576"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99136"
FT                   /db_xref="GOA:A2RXH3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXH3"
FT                   /protein_id="ABM99136.1"
FT                   /translation="MKLDETDLKILKILQENGRLSNAELADRVALSAAPCWKRLRRLEA
FT                   DGFISGYQAILDRRALGYEIVAFVNISLDSHTEKTCRAFEAGVMAMPEVVACHNTTGQH
FT                   DYLVQIVAKNFDTFSSFVLNRLRSLPGVKELLSTISMRELKATSRLPAGELRITKQ"
FT   gene            616659..616850
FT                   /locus_tag="BMA10229_0578"
FT   CDS_pept        616659..616850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0578"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98734"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXH4"
FT                   /protein_id="ABM98734.1"
FT                   /translation="MTPIANAESARIVLRRKMNARHCGSMRARSMAAATPHAIRVLLRR
FT                   PRTQAPRLVARLVVARAR"
FT   gene            complement(616827..618281)
FT                   /locus_tag="BMA10229_0577"
FT   CDS_pept        complement(616827..618281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0577"
FT                   /product="amidase family protein"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99145"
FT                   /db_xref="GOA:A2RXH5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXH5"
FT                   /protein_id="ABM99145.1"
FT                   /translation="MPFDPIVDMPAHTLAEAIRRKDVSCVETMRAYLAHIERVNADVNA
FT                   IVALREPDALLAEAAQKDAALARGEYAGWLHGMPQAPKDLAMTKGIVTTLGSPIFRTMT
FT                   PSVDAIVVERMRAAGAVFIGKTNTPEFGLGSHTFNEVYGVTRNPYDLSKSAGGSSGGAA
FT                   AALAARMLPVADGSDFGGSLRNPAAFCNVYGFRPSQGRVPRWPSVDVFVQQLGTEGPMG
FT                   RTVVDVAQLLAIQAGYDRRDPLSLAEDPRRFTQSLDADMRGKRIAWVGDWNGYLAMEAG
FT                   VLELCESSFDTLRAIGCDIDAALPAFPAERIWRSWLAHRHLLSGGNLLMHYREPSRRAL
FT                   LKPEAIYEAQGLFALGAADVYEASAARSAWYQALIAFFERFDYIAAPSAQVFAFDVELR
FT                   WPQAIAGRAMDTYHRWMETVVPWTLAGCPVISVPVGFNAAGLPMGMQLIGRPRDDFAVL
FT                   QLARAYEKERDWVSARPPALSGARND"
FT   gene            complement(618502..618663)
FT                   /locus_tag="BMA10229_0579"
FT   CDS_pept        complement(618502..618663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0579"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98991"
FT                   /db_xref="GOA:A2RXH6"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXH6"
FT                   /protein_id="ABM98991.1"
FT                   /translation="MVRAAHGLGCPPPAVQVAAARTLSLIAWFIMVLMPLMPLMPRVRK
FT                   ADRIGTRA"
FT   gene            618854..619288
FT                   /pseudo
FT                   /locus_tag="BMA10229_0580"
FT                   /note="UspA family protein; this gene contains a premature
FT                   stop which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00582"
FT   gene            complement(619449..620279)
FT                   /locus_tag="BMA10229_0581"
FT   CDS_pept        complement(619449..620279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0581"
FT                   /product="outer membrane lipoprotein, OmpA/SmpA/OmlA
FT                   family"
FT                   /note="identified by match to protein family HMM PF00691;
FT                   match to protein family HMM PF04355"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00523"
FT                   /db_xref="GOA:A2RXH8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXH8"
FT                   /protein_id="ABN00523.1"
FT                   /translation="MKMNRMSKYAAAAGICAALLTGCGMAPTSAPDGSVGFPARDSAWL
FT                   KEGTFVNVENLRQIGPGLDKNQVYALIGEPHFSEGIIGVHVWNYVFNFRTGPGASDVVT
FT                   CQYQIQYDKHYRVKSTYWKEPACKALVDGPKPAPAVQAPPGDDVKQFTLDYQLLFPFDK
FT                   SALRDLLPAGRAELDRIAATLEQQYQHIRSVRVTGYTDRLGTDAYNRQLSLARAETIRA
FT                   YLTTRGLPGDLIVAQGLGKADPVSNGCPAGRSAEAIACLAPDRRVRIDVAGERR"
FT   gene            complement(620338..622800)
FT                   /locus_tag="BMA10229_0582"
FT   CDS_pept        complement(620338..622800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0582"
FT                   /product="hemagglutinin family protein"
FT                   /note="identified by match to protein family HMM PF03895;
FT                   match to protein family HMM PF05658; match to protein
FT                   family HMM PF05662"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00067"
FT                   /db_xref="GOA:A2RXH9"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXH9"
FT                   /protein_id="ABN00067.1"
FT                   /translation="MRGQLIAVSEFSRSNGKCSTTQVVTAAPGVAGRTAASGRSRPSWT
FT                   KLGLMSLAVSAAMGCMATDAAAQVSYAAGENAYAGPGGNTGPWAFYNPAFSAGTLLYGT
FT                   AVGNYAYANGEGSSAYGDHATVKGRIGSAFGAYSEAAGDGSTAIGASARALPDFSIAIG
FT                   TNAQALKDTGQSIPGREDIGTIAIGAGALAQGDNSDPLHVSAPNAFGGYSSATASGAVA
FT                   LGEGAASSGYYANALGSYSKASGAGAVAVGGGAQASAQGAVAIGGATSVDNATALSGYA
FT                   SASGVNAIAIGSGAQATGARSISIGTGNVVSGASSGAFGDPSTVTGTGSYSFGNNNTIN
FT                   SNNAFVLGNNVTIGPGFDGSVALGSGTTLAAANPTGSATITTSSGGQLTLSGFAGANPT
FT                   SVVSVGAPGAERQITNVAAGRITPTSTDAVNGSQLYAVASTIDNAVNGGGIKYFHANST
FT                   LADSTAAGTDSVAVGPAALAYGNDSIAEGTNATAGVSGNPAVAGDVALGSGAQATGGRS
FT                   LALGANASVNTAGGVALGAGSVANRAAGTYTDPITGSSFTTAFGAVSVGLEGSLRQITN
FT                   VAAGTQATDAVNVGQLQGAIAQLNQTIQNITNGSNSGNTGNNGNNTGQTVSGQWITGNP
FT                   STYTPPVASGIGSTAAGSGSVASGANSVAIGDGASASGNNSVALGAHSVASAPNTVSVG
FT                   SVGNERTISNVAPGVNGTDAVNVNQLNSGIGNAVGQANQYTDQKVDHLRREMNGGVAAA
FT                   MAVAGLPQPTAPGKSMVAIAGSTWQGQQGFALGVSTISENGKWLYKGSLTTSTRGGTGA
FT                   VLGAGYQW"
FT   gene            622789..622941
FT                   /locus_tag="BMA10229_0583"
FT   CDS_pept        622789..622941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0583"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98966"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXI0"
FT                   /protein_id="ABM98966.1"
FT                   /translation="MASHPTPNHIVDFVHSISPVNSIRTGRQQGHFRVRSPRDGAAEYE
FT                   IMHCD"
FT   gene            complement(623358..624782)
FT                   /locus_tag="BMA10229_0584"
FT   CDS_pept        complement(623358..624782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0584"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00400"
FT                   /db_xref="GOA:A2RXI1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXI1"
FT                   /protein_id="ABN00400.1"
FT                   /translation="MEENPRMSTLETAIAGAPAADAAAGAATPGAIIARIERLPANAMQ
FT                   IRARVLIGTATFFDGFDVITIAATLPLLIHKWGLSPNQIGMLIASGAIGQLLGAFLFPA
FT                   LAQKHGRVRAIAWSSAVIGVTSIACGFASTFETFVLLRIVQGLGLGGELPVAATYINEI
FT                   TRAHGRGRFVLLYEIVFPIGLLASMAFGAWLVPRFGWEVMYFIGGMPLLLALVLTRLVP
FT                   ESPRWLASRGRLDEAGRALHAFEASVKEPLPPVAHAGEFDTLVLSHPKRRMVDLFGPAY
FT                   LKRTLAVATLWATCGFIQYGLSTWLPTIYKNFYHAPLQLALNLAVIGSVMGVAGSLVSA
FT                   LAVDVVGRKPVIVWSFVLCALSLVFAGVYHASSVYVVAAFCSLALGLMASGFITSYVYT
FT                   PEQYPTSIRAAGCGLGSAWLKIASFVAPMVVPRAIVGGDLSPAFYLLAAVPLIAALTVH
FT                   SVGIETKGQVLEKLEA"
FT   gene            complement(624799..626013)
FT                   /locus_tag="BMA10229_0585"
FT   CDS_pept        complement(624799..626013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0585"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase,
FT                   class I"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00246"
FT                   /db_xref="GOA:A2RXI2"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXI2"
FT                   /protein_id="ABN00246.1"
FT                   /translation="MPRTVVVIGGGQAAGWVVKTLRDEGFAGRIVMIADEAHLPYERPA
FT                   LSKAVLAGEADIATVRVMQPDAFGALDVDAWQPERAASIDRARRVVRTASGREIEYDRL
FT                   VIATGGTPRRLPDAIVGTAHLHYLRTLDEALALGEKLRASRRVLVIGGGWIGLEVAATA
FT                   RKLGVDALVVEGAPRLCARSVPGAVSDFLLDLHRANGVDVRLNASLASLDAHPDDARRV
FT                   RATLAGGGVVDADFAVAGIGLALNTSLATEAGLHVDDGIVVDEYGATSDPAIFACGDVA
FT                   NHPNAWLKRRVRLESWANAQHQAIAAAKAVLGVRAPYAEIPWFWSDQYDVNLQILGDLP
FT                   ADARCIVRGELAAKRATLFFVADGALRGVIAINAARELKLARKWMNQGRAIDVAALADT
FT                   AKALA"
FT   gene            complement(626039..627004)
FT                   /locus_tag="BMA10229_0586"
FT   CDS_pept        complement(626039..627004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0586"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99755"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXI3"
FT                   /protein_id="ABM99755.1"
FT                   /translation="MSILGIEQITYGVTDLATCRRFFADWGLREIAHDDAHAVFETMNG
FT                   CTVRVVDAHDPSLPPAFEEGPTLREVTWGVGTQAELDALRGRLAGQPGHYETDDAIGCI
FT                   DPNGMAIRIEVTRRRALDVKGSLPNVWGATLRVDQPAAIYARAEPVEVGHVVFFTNRLA
FT                   EQEAFYHTLLGFETSDRYPGRGAFMRCAPHGGHHDLFLLALPTAKRGLNHVAFTVRDIH
FT                   EVFGGGMHVSRCGWRTQLGPGRHPVSSAYFWYFRNPAGGLIEYYADEDMLTPAWQPREF
FT                   EPGPTVFAEWAIDGGLDGDTRRQKNAQAPQGKFMTERDDD"
FT   gene            complement(627021..628511)
FT                   /locus_tag="BMA10229_0587"
FT   CDS_pept        complement(627021..628511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0587"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /EC_number="1.2.1.3"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99439"
FT                   /db_xref="GOA:A2RXI4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXI4"
FT                   /protein_id="ABM99439.1"
FT                   /translation="MTAFDSSLVPSGDILIGGEWRRGRGATTPSFYPADGSLNTEIHMA
FT                   DAADAREAVQAADAAWRRADWAGLKPHQRADVLYRVADLIHAHREALAQLQRRDNGKPI
FT                   NETRALVASAASTFRYFAACAQTLDEALTPSRGDYLSMSVHEPLGVVAAITPWNSPIAS
FT                   DAQKLGPALAAGNAVVLKPAEVTPLASLALARLCEQAGVPRGVISVLPGKGSVIGDALV
FT                   RDPLVKKVSFTGGTEVGRGIARLAAEKLMPLSLELGGKSPTIVFDDAELDHAVNGVLYG
FT                   IFSSSGESCIAGSRLFVQRSIYGAFVARLVEAARKLRVGDPASERTQMGPLITARHRDT
FT                   VERYVALGRDEGARVLCGGERPTGEGRDAGFFYLPTILDGLSNHARICREEIFGPVLVA
FT                   LPFDDEAALVADANDSVFGLAAGIWTRDYKRAWRVARVLDAGTVWINTYKQFSISTPFS
FT                   GRKESGMGREKGSLGIREYMQQKSLYWGLNDSPLPWAN"
FT   gene            complement(628537..629352)
FT                   /locus_tag="BMA10229_0588"
FT   CDS_pept        complement(628537..629352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0588"
FT                   /product="putative L-aspartate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF01958;
FT                   match to protein family HMM PF03447"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98587"
FT                   /db_xref="GOA:A2RXI5"
FT                   /db_xref="InterPro:IPR002811"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011182"
FT                   /db_xref="InterPro:IPR020626"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2RXI5"
FT                   /protein_id="ABM98587.1"
FT                   /translation="MRNAHAPVDVAMIGFGAIGAAVYRAVEHDAALRVAHVIVPEHQCD
FT                   AVRGALGERVDVVSSVDALACRPQFALECAGHGALVDHVVPLLKAGTDCAVASIGALSD
FT                   LALLDALSNAADAGGATLTLLSGAIGGIDALAAARQGGLDEVRYIGRKPPLGWLGTPAE
FT                   AICDLRAMAAEQTIFEGSARDAAQLYPRNANVAATVALAGVGLDATRVCLIADPAVTRN
FT                   VHRIVARGAFGEMSIEMSGKPLPDNPKTSALTAFSAIRALRNRASHCVI"
FT   gene            complement(629345..631018)
FT                   /locus_tag="BMA10229_0589"
FT   CDS_pept        complement(629345..631018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0589"
FT                   /product="putative acetolactate synthase, large subunit"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99031"
FT                   /db_xref="GOA:A2RXI6"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXI6"
FT                   /protein_id="ABM99031.1"
FT                   /translation="MSNPTTTTVGELIAAFLEQCGVKTAFGVISIHNMPILDAIHTRGK
FT                   IRYVGARGEAGAVNMADGLARVSGGLGVAFTSTGTAAGNAAGAMVEALTAGTALVHITG
FT                   QIETPYLDQDLAYIHEAPDQLSMLNAISKAAYRVRTVEAVLPTIREAVRVAMTAPSGPV
FT                   SVEIPIDIQAAEIEWPDDLAPPHVAVREHDGARVAQLAERLAGARRPLLWLGGGARHAR
FT                   AEVERLVALGFGVVTSVQGRGVLPEDHPATLGAFNVHAAVEHFYKTCDAVVVVGSRLRG
FT                   NEALKYKLALPRPLFRVDADALADNRGYRNDLFVHGDAKRVLAELADRLEGRLAIDPRF
FT                   ADDLAAARAAAVADVGKGLGPYKRLVDTLQQALGRDYNWVRDVTISNSTWGNRLLRIFE
FT                   PRAGVHALGGGIGQGMQMAIGAALAGNAAKTVCLVGDGGLMVNVGELATAVQENANVMI
FT                   VLMNDQCYGVIRNIQDAQYGGRRCYVELHQPDFAQFCASLKLAHHRITSLDDAERIVRE
FT                   GLAHEGPVLVEVDMLSVGSFAAAFAGPPVKKDTPAERQYA"
FT   gene            complement(631011..631808)
FT                   /locus_tag="BMA10229_0590"
FT   CDS_pept        complement(631011..631808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0590"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98516"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXI7"
FT                   /protein_id="ABM98516.1"
FT                   /translation="MIQIDLSGQVAVVTGGSSGIGYASAELFLRAGASVAICGRGDERL
FT                   ASAHARLVRQFPRERVLAVRCDVLDEADVTAFAQAVAERFGGADMLVNNAGQGRVSTFA
FT                   DTTDDAWRDELELKYFSIIRPTRAFLPLLRASSAPSITCVNSLLALQPEPHMVATSSAR
FT                   AGTLSLVKSLATELAPERVRVNSILIGIVESGQWRRRYDAQAAPGESWEAWTAALAAKK
FT                   NIPLARFGRPDEAAWALFYLATNLSSYTTGSHIDVSGGFARHV"
FT   gene            complement(631805..632659)
FT                   /locus_tag="BMA10229_0591"
FT   CDS_pept        complement(631805..632659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0591"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00284"
FT                   /db_xref="GOA:A2RXI8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXI8"
FT                   /protein_id="ABN00284.1"
FT                   /translation="MSEPLLKDADDARNDSNYVVPGLERGLRILAEFSPREPVLGAPEL
FT                   SKRLGIPRTTVFRLLQTLESLGFLERADKDRNYRLGVAVLRLGFEYLSSLELTDLGLPV
FT                   IESLRDATGFTAHIVIRDGRDVVFVAKAQNAGNAFGSVRVNVGTRLPAHATTHGHVLMG
FT                   DLSLAQLRALYPERALERVTKATPETVDALFDVIRDDARRGYGIGNSAFERDISVVTAP
FT                   VRNEASRIVAVVTVTVPRPEIDAALVAEGLVEKVVRAAAELSRRLNYRSDDENTYLKAL
FT                   GLR"
FT   gene            complement(632656..633561)
FT                   /locus_tag="BMA10229_0592"
FT   CDS_pept        complement(632656..633561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0592"
FT                   /product="alpha/beta hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99801"
FT                   /db_xref="GOA:A2RXI9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXI9"
FT                   /protein_id="ABM99801.1"
FT                   /translation="MSTISTTTTEAGAAPFAALLARFPERRAAVGGAGVIGYREAGEAH
FT                   ARRAGCEPVVLLHGIGSGAASWVRQLDALGATRRALAWDAPGYGASSRVAADSPVAADY
FT                   AASLAAWLDALRIQRCVLVGHSLGAIMAGAFARIAGERLAGLLLISPAGGYGSAPADVR
FT                   AGRRDSRLALLASLGPQGLAAERSANMLSAQASGAAREWVRWNMARIAPAGYAQATHLL
FT                   ANADLASDLAHCRGRIAVAVGGDDAITPPAACERIARAAGVGLQVIARAGHAGYVEAPD
FT                   AYSALIDAFCRQCDGSRGTP"
FT   gene            complement(633578..634105)
FT                   /locus_tag="BMA10229_0593"
FT   CDS_pept        complement(633578..634105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99279"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXJ0"
FT                   /protein_id="ABM99279.1"
FT                   /translation="MTDADIERKSWDQPAGESFAQWMDGRVARFETRRYDWDALKFQAD
FT                   FDPKYRRAQMRYVGTGGTGVAKDANTVPAGGFTFSTMVIPAGNVGPSHIHIDVEEIFFV
FT                   LRGRMKVICERDGETWEAVLGERDLISVPPGVYRTEINVGEEDALMCVMLGSPKPITPT
FT                   YPPDSPLAKIKR"
FT   gene            complement(634144..634914)
FT                   /locus_tag="BMA10229_0594"
FT   CDS_pept        complement(634144..634914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0594"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /EC_number="1.1.-.-"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00283"
FT                   /db_xref="GOA:A2RXJ1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXJ1"
FT                   /protein_id="ABN00283.1"
FT                   /translation="MSAPVQAIALAGRRVLVTGGARGLGAAFVEALVAAGAKVAFGDVL
FT                   DAEGRALAQRLRDAGHDAHFIALDLAAPASVTAFVDEGARVLGGLDGLVNNAAITNSGG
FT                   KRATELSIDTWDAVMNVNARGVWLACNAALPHLARSGRGAIVNLASDTALWGAPKLLAY
FT                   VASKGAVIAMTHALAREFGEQGVTVNAVAPGLTEVEATAYVPAERHEYYLQGRALPRAQ
FT                   VPADVTGPVLFLLSDAARFVTGQLLPVNGGFVMH"
FT   gene            complement(634911..635978)
FT                   /locus_tag="BMA10229_0595"
FT   CDS_pept        complement(634911..635978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0595"
FT                   /product="iron-sulfur cluster-binding protein, Rieske
FT                   family"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00512"
FT                   /db_xref="GOA:A2RXJ2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXJ2"
FT                   /protein_id="ABN00512.1"
FT                   /translation="MTSSDQTNSGADPVRAYLDRGIRNYWYPVAPSWQVSSAPVGITRL
FT                   SEQIVLWRDREGNVHALEDRCPHRGARLSLGWNLGDRVACWYHGVEVNGVGTVTKVPAV
FT                   SNCPLEGQACVKSYPVEERAGAIFLWFGDDAHREPAPLVLPDELVAPEYAQFVCVSNWT
FT                   CNYQYAIDNVMDPMHGAYLHATSHSMAEGDKQADMRVRRTETGLMFEKVNQRDVNFDWV
FT                   ELGETGCIWLRLAIPYQRKFGPGGSFGIVGFATPIDDEHCQVYFWRTRKVAGWQRDVWR
FT                   FLYRNRLEGLHWAVLEQDRYVLESMAPNARDHEYLYQHDIGVTRVRRMLRQRAQEHLAA
FT                   LDAHRAAQADAAERA"
FT   gene            complement(636013..636324)
FT                   /locus_tag="BMA10229_0596"
FT   CDS_pept        complement(636013..636324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0596"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00041"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXJ3"
FT                   /protein_id="ABN00041.1"
FT                   /translation="MNETTVNFNPLLMPWRAPQPNNVAGKGQIEIPGRMPNLVWQTRKA
FT                   EPTQYENDLGDALERVFESGATELAEVVAGLNRIGFRAPDGAEWTAERFCAELAALAE"
FT   gene            complement(636326..636643)
FT                   /locus_tag="BMA10229_0597"
FT   CDS_pept        complement(636326..636643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0597"
FT                   /product="naphthalene 1,2-dioxygenase system ferredoxin
FT                   component"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99969"
FT                   /db_xref="GOA:A2RXJ4"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXJ4"
FT                   /protein_id="ABM99969.1"
FT                   /translation="MSEQWVCAGHAGALSEDSPIEFKRTDGVEIGIYRVGDDVYALENV
FT                   CPHAYALLTQGFVDEGTVECPLHEAVFDIKTGQCLKGPGGRALKTYAVRLAGEEIQIKV
FT                   E"
FT   gene            637015..638166
FT                   /locus_tag="BMA10229_0598"
FT   CDS_pept        637015..638166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0598"
FT                   /product="putative outer membrane porin"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99551"
FT                   /db_xref="GOA:A2RXJ5"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXJ5"
FT                   /protein_id="ABM99551.1"
FT                   /translation="MADRFARGHRPRHLEQRSGDQMVKHAAATLLGALAVAGAWAQSSV
FT                   TLYGSLDAGVAYVNNVGGGAKWSMIQGNTQPDRWGLKGVEDLGGGLKAIFQLENGFYTN
FT                   NGQMAAAGTMWNRQAFVGLNSDRLGALTLGHQTPFNFDWLDPLSSAFLAQSWYAFHPGN
FT                   LDQLADTSTVPFNNSVKYRSPVFAGFTVGAMLGFGNTTNFSTGRTMSFGVNYANGPFKA
FT                   AAVYSNEHDQAFPMATVGGIAGPGGTFQGMPVASYVAKKAQNMGAGLSYRFGPLLVHGL
FT                   YTRVKLQANGHSDTFQSYDAGANYQSSPFNVIAGGAATSTLAGRRWSQFELGDTYSLSK
FT                   RTQLYVNVLYEHASGNAKAAFFTAGASSTANQVIVLTGIHHSF"
FT   gene            638211..638336
FT                   /locus_tag="BMA10229_0599"
FT   CDS_pept        638211..638336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0599"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99445"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXJ6"
FT                   /protein_id="ABM99445.1"
FT                   /translation="MPSGARKRRGVSSARIAAMLTNAKKPPRKTEAFSFPRRQMQ"
FT   gene            complement(638474..639424)
FT                   /locus_tag="BMA10229_0600"
FT   CDS_pept        complement(638474..639424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0600"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99306"
FT                   /db_xref="GOA:A2RXJ7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXJ7"
FT                   /protein_id="ABM99306.1"
FT                   /translation="MAKTTTTAAGRPAADAASAKSRRAAAGARPELDAADDEAAGGASS
FT                   YLVPGLERGLRILSEFSAREPVLSAPELSKRIGIPRTTTFRLLQTLEALGFIERANGDR
FT                   HFRLGIGVLRLGFEYLNSLELTDLGAPVLERLRDAAGLSTHLLIRDRRDVVFVAKAQSN
FT                   APMFGSVKVHVGTRLPAHATVHGHVLMGDLTRDAMRQLYPEKRLEAFTEHTPATVDELY
FT                   ERVRHYARLGYALSEGAFESGISAVTAPVRDHSGSIVAAITATVPRSEIGAVDEKERLV
FT                   ELVCGAAVDLSQRLNYRPLDGDPTVAHARHKVALF"
FT   gene            complement(639511..640137)
FT                   /locus_tag="BMA10229_0601"
FT   CDS_pept        complement(639511..640137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0601"
FT                   /product="oxidoreductase, 2OG-Fe(II) oxygenase family"
FT                   /note="identified by match to protein family HMM PF03171"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99224"
FT                   /db_xref="GOA:A2RXJ8"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXJ8"
FT                   /protein_id="ABM99224.1"
FT                   /translation="MDDLFDDLPRPDVDWHPDWLAPADADRFHARLVDEVAWRQDTMRT
FT                   PRGLLPLPRLTAWQGEPDALYVYSGIRNEPAPWTPAVLELKRRVEAASRARFNSVLLNR
FT                   YRNGFDSMGWHADDEPELGAEPVIASLSLGATRVFDLRHNETGVTHAYRLTNGSLLVMR
FT                   GRTQHAWRHRVPKEPAVRGERINLTFRWVSAPPAAELRARPRSRG"
FT   gene            640270..640854
FT                   /locus_tag="BMA10229_0602"
FT   CDS_pept        640270..640854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0602"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98805"
FT                   /db_xref="GOA:A2RXJ9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023936"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXJ9"
FT                   /protein_id="ABM98805.1"
FT                   /translation="MTLSDSALDQIFRTARTHNAWQPKPVDDALLRELIDLVKWGPTSA
FT                   NSSPARFVFVKSPEAKAKLKPALSEGNLAKTMAAPVTVIVGMDMAFHDHLPKLFPHADA
FT                   RSWFAGNDALIEATAFRNASLQGAYLIVAARALGLDAGPMSGFDQAAVDAAFFAGTSIK
FT                   SNFLVNLGYGDAAGLFPRSPRFSFDEIARIE"
FT   gene            640916..642121
FT                   /locus_tag="BMA10229_0603"
FT   CDS_pept        640916..642121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0603"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00547"
FT                   /db_xref="GOA:A2RXK0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXK0"
FT                   /protein_id="ABN00547.1"
FT                   /translation="MRRVSSFLLRLTIIGVLLHVYVGFRLLPELASPAARYAGALWLVG
FT                   SCLLIPLGMLSRVFERQPLGDRVAWAGLLAMGFFSSLLVLTLARDVLLASLVTVDALAP
FT                   GAVSLAQWRIQTAAGVPLAALAVSVVGFVNARRRARVVDVAVPIDDLPAALDGFTIVQI
FT                   SDIHVGPTIKRGYVEAIVDAVNRLAPDLVAVTGDVVDGTVAQLAGHAAPLGRLRARHGA
FT                   FVVTGNHEYYSGADEWIAEFRRLGLDVLLNEHRTLDHGDGRLVIAGVTDYSAGHFDPAH
FT                   RSDPSAALAGAPADVRIRVLLAHQPRSATAAADAGFTLQLSGHTHGGQFFPWNFFVRLQ
FT                   QPFTAGLARLNGLWVYTSRGTGYWGPPKRLGAPSEITRVRLVRGEGNRTRAPASVTLNA
FT                   ER"
FT   gene            642348..642524
FT                   /locus_tag="BMA10229_0604"
FT   CDS_pept        642348..642524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0604"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99056"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXK1"
FT                   /protein_id="ABM99056.1"
FT                   /translation="MRDSNSSARLHMRRRAALTFRRRTPRSHATAAARSRSRRALRETH
FT                   PAPRPRIHRRRAG"
FT   gene            complement(642683..642781)
FT                   /locus_tag="BMA10229_0605"
FT   CDS_pept        complement(642683..642781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0605"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98548"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXK2"
FT                   /protein_id="ABM98548.1"
FT                   /translation="MRRAMGAAARACRARVHYVRARHFSARIDAIV"
FT   gene            642801..643517
FT                   /locus_tag="BMA10229_0606"
FT   CDS_pept        642801..643517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0606"
FT                   /product="MgtC family protein"
FT                   /note="identified by match to protein family HMM PF02308"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00524"
FT                   /db_xref="GOA:A2RXK3"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXK3"
FT                   /protein_id="ABN00524.1"
FT                   /translation="MTFEFALRLFTAFACGVAIGLERQIRQRTAGLRTITLVASGACLF
FT                   VTLGVLTGNGIPGVTQIAAYVVSGVGFLGGGVIMRDKGSIQGINTAATLWCSAAVGVLS
FT                   GAGHYLPALAGTGVVLLTNTLLRGVSQAINATPVSNADLVREYQITVICLASDEVHIRT
FT                   LLSNSMYAKPLSFQSLTSEDVPREADAPERIKVTATLKLHPKDQQKLEQIASRMSMEKS
FT                   ISSVSWTAKEAEPLME"
FT   gene            complement(643553..644272)
FT                   /gene="bpsR"
FT                   /locus_tag="BMA10229_0607"
FT   CDS_pept        complement(643553..644272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bpsR"
FT                   /locus_tag="BMA10229_0607"
FT                   /product="autoinducer-binding transcriptional regulator
FT                   BpsR"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF03472"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00054"
FT                   /db_xref="GOA:A2RXK4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXK4"
FT                   /protein_id="ABN00054.1"
FT                   /translation="MELRWQDAYLQFSAAENEQQLFQQIAAYTKRLGFEYCCYGIRVPL
FT                   PISKPVVAIFDTYPNGWMERYQEMNYLEVDPTVREGALSSNMIVWPEASASDATTLWSD
FT                   ARDHGLAVGVAQSSWASRGVFGLLTIARHTDRLTSAEINHLTLQANWLANMSHSLMSRF
FT                   LVPKLAPESGVALTHREREVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATN
FT                   KVQAVVKAIAMGLIDAP"
FT   gene            644346..644789
FT                   /locus_tag="BMA10229_0608"
FT   CDS_pept        644346..644789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0608"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99141"
FT                   /db_xref="InterPro:IPR032598"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXK5"
FT                   /protein_id="ABM99141.1"
FT                   /translation="MNSPWLHRFRGPSTDGYVRLPMHAFAELRLVHVSSGIDSGLLVEL
FT                   RASDIDARIAGYTEWERPSSAGAAHLTVGWDWYIDGATGAFVIAWGDVRSNVMGVDGNG
FT                   LDIGMDPTSATLSRRLAQLNWPSAVTAAMLRRGDFAHAGPTLQ"
FT   gene            645014..645625
FT                   /gene="bpsI"
FT                   /locus_tag="BMA10229_0609"
FT   CDS_pept        645014..645625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bpsI"
FT                   /locus_tag="BMA10229_0609"
FT                   /product="autoinducer synthase BpsI"
FT                   /note="identified by match to protein family HMM PF00765"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98521"
FT                   /db_xref="GOA:A2RXK6"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXK6"
FT                   /protein_id="ABM98521.1"
FT                   /translation="MRTFVHGDGRLPSDLAADLGLYRHGVFVEQLGWKLPSASEGFERD
FT                   QYDRDDTVYVFARDDDGEICGCARLLPTTRPYLLKELFPTLVAQDMPLPQSAAVWELSR
FT                   FAANAEDPAGGGNPAWAVRPMLAAVVECAARLGAKQLIGVTFLSMERLFRRIGVHAHRA
FT                   GPAQQIDGRMVVACWIDLDAQTLAALDLDPLLCAPPAEAA"
FT   gene            645687..646535
FT                   /locus_tag="BMA10229_0611"
FT   CDS_pept        645687..646535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0611"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99597"
FT                   /db_xref="GOA:A2RXK7"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXK7"
FT                   /protein_id="ABM99597.1"
FT                   /translation="MDHSTVFRAMLPTFDAGETRIAVAFPSFAERLPLVRLGRQGLVFR
FT                   ARGAMPPVCGLPRSATLYLDDEPLCTLRLVIREVERCDDGAHDLTMQPSAANGDALLWH
FT                   ALRTRCRHARAPLAPRAPDERPAPATQASARRRDTAPRADAARPESGAPRAAGTGVRMT
FT                   RSAAFRLADRGDALFFADWLEYHFDELRALAQGLSPRLHLNELERDLAGDEVDVRFVYD
FT                   IDGHADRRMLTDCARQACDWIATEVRCRFDLPIAEQRFGARKPRRATRAIRFRRNNSGR
FT                   T"
FT   gene            complement(646498..647151)
FT                   /gene="ribA"
FT                   /locus_tag="BMA10229_0610"
FT   CDS_pept        complement(646498..647151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="BMA10229_0610"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="identified by match to protein family HMM PF00925;
FT                   match to protein family HMM TIGR00505"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00100"
FT                   /db_xref="GOA:A2RXK8"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXK8"
FT                   /protein_id="ABN00100.1"
FT                   /translation="MKSSHPDSPQPDDGAAPECVTLVATATLPTRYGTFTSYAFRVAGG
FT                   DAEHLALVMGDVAEQPSVLTRLHSECLTGDVFGSYRCDCGEQLDLSLRYIAAEGRGVLL
FT                   YLRGHEGRGIGLSNKIRAYALQEQGRDTVEANLDLGLPDDAREYDSAAAILRILKVTSV
FT                   RLMSNNPKKFDTLARHGIPVCERVALAVPVREENERYIRTKQLKFGHYYFDENE"
FT   gene            647328..647792
FT                   /locus_tag="BMA10229_0612"
FT   CDS_pept        647328..647792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0612"
FT                   /product="CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99125"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXK9"
FT                   /protein_id="ABM99125.1"
FT                   /translation="MSLTVAQILRSKPDSGRTIHMVEKSDSVYNAIKLMAEKSIGALLV
FT                   MDGANIAGIVTERDYARKVVLLDRSSKATRVEEIMTSKVRYVEPTQTSDECMALMTEHR
FT                   MRHLPVLDDGKLVGLVSIGDLVKSVIADQQFTIDQLEHYIHGIPAAAHPQ"
FT   gene            complement(647997..648338)
FT                   /locus_tag="BMA10229_0613"
FT   CDS_pept        complement(647997..648338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0613"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98691"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXL0"
FT                   /protein_id="ABM98691.1"
FT                   /translation="MKSFVYAAVAASILATPLASFAQADQQPPLTREQVRSELVQLEQN
FT                   GYKPEAGETQYPANVQAASQRMLPAQQTLTHADTSGYGVQPAGAAESGGRASRSPASPA
FT                   FGHSIYFGN"
FT   gene            648858..649256
FT                   /locus_tag="BMA10229_0614"
FT   CDS_pept        648858..649256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0614"
FT                   /product="putative nucleoside diphosphate kinase regulator"
FT                   /note="identified by match to protein family HMM PF01272"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98803"
FT                   /db_xref="GOA:A2RXL1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXL1"
FT                   /protein_id="ABM98803.1"
FT                   /translation="MRNRIYQLTELDVARLEKHAERNPRYQEMLDTLLERADIVEPNKI
FT                   QANVVTMNSQIKLLDETAGQDRAWTIVYPDAANFEQGRLNVFSPVGMALLGSRCGERVK
FT                   VTLPGGADATLKIVEIVYQPEASGDYAH"
FT   gene            complement(649474..650604)
FT                   /gene="opcP"
FT                   /locus_tag="BMA10229_0615"
FT   CDS_pept        complement(649474..650604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opcP"
FT                   /locus_tag="BMA10229_0615"
FT                   /product="outer membrane porin"
FT                   /note="identified by similarity to GP:967990; match to
FT                   protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00520"
FT                   /db_xref="GOA:A2RXL2"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXL2"
FT                   /protein_id="ABN00520.1"
FT                   /translation="MNKTLIVAAVAASFATVAHAQSSVTLYGVLDAGITYQSNVATPSG
FT                   SGKSLWSVGAGVDQSRFGLRGSEDLGGGLKAIFTLESGFNIGNGRFNNGGGMFNRQAFV
FT                   GLSSNYGTVTLGRQYDATQDYLSPLSATGTWGGTYFAHPLNNDRLNTNGDVAVNNTVKF
FT                   TSANYAGLQFGGTYSFSNNSQFANNRAYSAGASYQFQGLKVGAAYSQANNAGANTTGAT
FT                   DPLTGFNIGGTNAASIQGRSRVYGAGASYAYGPLQGGLLWTQSRLDNLANGAPTIRADN
FT                   YEANVKYNLTPALGLGVAYTYTYTNAKANGESTHWNQVGVQADYALSKRTDVYAQAVYQ
FT                   RSSKNANASIYNGDLSTPFSTSINQTAATVGLRHRF"
FT   gene            complement(651018..651188)
FT                   /locus_tag="BMA10229_0616"
FT   CDS_pept        complement(651018..651188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0616"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00127"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXL3"
FT                   /protein_id="ABN00127.1"
FT                   /translation="MLQSGELEAARADRAPRFDANAPRAGYRYESCNGRHGAPQPGGTR
FT                   ALQEFMVAVRR"
FT   gene            complement(651452..651637)
FT                   /locus_tag="BMA10229_0617"
FT   CDS_pept        complement(651452..651637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0617"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99668"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXL4"
FT                   /protein_id="ABM99668.1"
FT                   /translation="MRFAAFAANGVRLAAHAIPASVDIEPHVCPLSPIAGDPRCPGRCA
FT                   IQRPGIHTDRPPGQRQ"
FT   gene            651934..652239
FT                   /locus_tag="BMA10229_0618"
FT   CDS_pept        651934..652239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0618"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99468"
FT                   /db_xref="GOA:A2RXL5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXL5"
FT                   /protein_id="ABM99468.1"
FT                   /translation="MTFDADAIHKALASPVRRTILAWLKAPDKHFPASQAGPFPQGVCA
FT                   GQIDALCGLSQSTVSAHLATLERAGLVTSTRVGQWAFFKRNDAVIQAFLDSLQRGL"
FT   gene            652289..653350
FT                   /gene="nemA"
FT                   /locus_tag="BMA10229_0619"
FT   CDS_pept        652289..653350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nemA"
FT                   /locus_tag="BMA10229_0619"
FT                   /product="N-ethylmaleimide reductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF00724"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99964"
FT                   /db_xref="GOA:A2RXL6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXL6"
FT                   /protein_id="ABM99964.1"
FT                   /translation="MPSLFDPLTIGDLTLANRIIMAPLTRARAGDTRTPNALMARYYAE
FT                   RASAGLIISEATSVTPQGVGYASTPGIWSPEQVDGWRLVTDAVHAAGGRIFLQLWHVGR
FT                   VSDPVFLDGALPVAPSAIAPGGHVSLVRPQRPYVTPRALELDEIPGVVAAFRRGAENAR
FT                   AAGFDGVEVHGANGYLLDQFLQDSANRRTDAYGGSIENRARLLLEVVDAAIDVWSAARV
FT                   GVHLAPRGDAHTMGDSDPAATFGHVARELGRRRIAFLFARESFGGDAIGQQLKAAFGGP
FT                   FIVNENFTLDSAQAALDAGQADAVAWGKLFIANPDLPRRFKLNAPLNEPNAATFYAQGE
FT                   VGYTDYPALESAA"
FT   gene            complement(653491..654045)
FT                   /locus_tag="BMA10229_0620"
FT   CDS_pept        complement(653491..654045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0620"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98978"
FT                   /db_xref="GOA:A2RXL7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXL7"
FT                   /protein_id="ABM98978.1"
FT                   /translation="MTARRLAAQPCPIGIRAARADEAPLMAAIEAAAARRFDDIGMPHI
FT                   ASSPPTDLADLRERIDDDRALVAFDAEGLRIVGFAIYRMLGASRLYLEEVDVAPEQAGR
FT                   RIGSALIEAVAARARAAGARQVVLSTFRHVPWNAPYYRRLGFVELDGNTLDAALTAIRA
FT                   THVAHGLDESQRVFMARMVHE"
FT   gene            654100..654753
FT                   /locus_tag="BMA10229_0621"
FT   CDS_pept        654100..654753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0621"
FT                   /product="LysE family protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99338"
FT                   /db_xref="GOA:A2RXL8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXL8"
FT                   /protein_id="ABM99338.1"
FT                   /translation="MTNRSSSHRLGSLSMSLSSLALFAAALLVAAGSPGPSIAALVARV
FT                   LTNGVRDVLPFLAAMWLGEVIWLTCAVAGLTALAHTFAFGFLVLKFAGIAYLVFLAWKM
FT                   WFAPADEPSGQLPRGQSPLRMFLTGIAVTLGNPKIMIFYVALLPTMVDLSRAGAVAWLE
FT                   LTLTLLVVLITVDCAWAWLAARARKLLTSRRAMKAANRASAAAMAGAAVAIAMR"
FT   gene            complement(654960..655169)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0622"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(655433..656635)
FT                   /locus_tag="BMA10229_0623"
FT   CDS_pept        complement(655433..656635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0623"
FT                   /product="putative outer membrane porin"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00297"
FT                   /db_xref="GOA:A2RXM0"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXM0"
FT                   /protein_id="ABN00297.1"
FT                   /translation="MHIRTWIAAGVAGAAVAPACAQSGVTLYGTVDTGVIYSTNQQVTH
FT                   ADGSTSGGHAWQMGGGNLVPSRWGLQGTEALGGGLKAVFALEQQFLSASGQALQGGAAF
FT                   SRQAWVGLRHDRYGTLGVGRQYDSYTDTLGAYVSSNSWATPYGSHLGDVDNLNAAFNFN
FT                   NAIRFTSADFHGLTFGGTFGFGGQAGDFSARRGYALAVAYNRAPVSFGIGYLNLRQPLD
FT                   AALGGANGYIGDFACGNAGAMYCLLQDAVSMKAFGVGGSIAFGEATVALTYTHTRLGDS
FT                   AYFAAAARAQRASIAFDIAELNATYAFTPMLRGGIAYVFNRAKADSRGVTRFHQLNVGV
FT                   NYSLSKRTALYAVAIGQIASGRGLGSDANGDPVNYAQIPVLANSNSNRQLAMMAGVKVD
FT                   F"
FT   gene            complement(656865..657803)
FT                   /locus_tag="BMA10229_0624"
FT   CDS_pept        complement(656865..657803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0624"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00129"
FT                   /db_xref="GOA:A2RXM1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXM1"
FT                   /protein_id="ABN00129.1"
FT                   /translation="MLFQSRSLEDVHDHGLAIAGWRQVYRQMTPGRFRGTVTQVLYDDF
FT                   HFFRETTNRRVAQTGVSPEGRTSLAVPLLAPLSGTFQRQHVDGYALLALRPGEDFEFHT
FT                   PEGMRLVGISAAPDMIEELCEAEFGTRGHRAPRHVTRLTHEQGAALGARLSSYIDDAQR
FT                   NPTWLAYDGTRKMFRDAMLGVFLDALSGAVGEERRDITHATYSDIVGRCERYLRARPEE
FT                   PVTVLELCRALRCSRRTLQTSFQRVADVTPVTYLRTIRLNAVRRLLRTTSADALCVGEA
FT                   AARWGFTHLGYFAREYRGLFGELPSQTRRLS"
FT   gene            complement(657881..658501)
FT                   /locus_tag="BMA10229_0625"
FT   CDS_pept        complement(657881..658501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0625"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98555"
FT                   /db_xref="InterPro:IPR021500"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXM2"
FT                   /protein_id="ABM98555.1"
FT                   /translation="MSGRASAIAGAAAIAGWRRRFAPAAAPGYRCGATLARVAADLGAT
FT                   LAAADGGDARRMAFDDGVEWRAIERVDRQFLLHTVSVQLERTIAGPAAHGSASIAASGW
FT                   VRRGPLAAAIARNADARFGALVPTLLAAPALNAPLAALDLTYCAIVACGSRWTLRIVPF
FT                   GGSEVAGRMPSFRRYVRLADTQRDALRAAFAGFEAALACMPHA"
FT   gene            complement(658498..659988)
FT                   /locus_tag="BMA10229_0626"
FT   CDS_pept        complement(658498..659988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0626"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98850"
FT                   /db_xref="GOA:A2RXM3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXM3"
FT                   /protein_id="ABM98850.1"
FT                   /translation="MADWSGYSNAAAGSAAVGAGGRPALAAGAVGFPTALASAVGLIMA
FT                   SPVILTATSGFGMGGWAFAAAMLIAFVMMQAQATTFAEAAAMLPTAGSVYDYLSCGLGR
FT                   FWAITGTISAYFLVHVFAGTAETILSGIMALVNFESLNAAFERHDSAWLVGVGLVATFA
FT                   FTNIIGIKVFSKLEIVLTVGMWLSLTIFGVLGLVAAPAVQLDGWFGRSEIGASAPAVLS
FT                   LVGMAMFMFVGCEFVTPLAPEMKTPGKTIPRAMALGLAGVAVCMFVYGAAIKRQVPNVA
FT                   VTADGLTHLLDTPGAIPAFALQVLGPFGRAWFGIAFLCAGAATINTLMAGLPRILYGMA
FT                   IDGALPKCFAYLHPRFRTPVVGIVAAAVVPIAHAWIIHGDLGSIMHLVLAATCAWGTAY
FT                   LLVTLSVVMLRIRRPDLPRPYRSPWFPLPQIVSSVGIVLAIWYIAPPGTNSRDIYVPFG
FT                   AMLGLTALYALFWTIVVQRKHPFRPVPVEEVLRNECVR"
FT   gene            complement(660197..661546)
FT                   /locus_tag="BMA10229_0627"
FT   CDS_pept        complement(660197..661546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0627"
FT                   /product="putative
FT                   adenosylmethionine-8-amino-7-oxononanoate transaminase"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99528"
FT                   /db_xref="GOA:A2RXM4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXM4"
FT                   /protein_id="ABM99528.1"
FT                   /translation="MSYNDSRFWHPMLHPNDMKRREPIRIVRGDGCHVYDERGRQLVDG
FT                   VAGLWNVNVGHNRAEVKEAIVRQLDELEYFQLFDGITHPRAEELSSKLIDMMEPEGMRR
FT                   VLYSSGGSDSVETALKIARQYWKVRGQADRTKFISLKQGYHGTHFGGASVNGNTVFRRN
FT                   YEPNLPGCFHVETPWLYRNPFTQDPEALGRICAELLEREILFQSPDTVAAFIAEPIQGA
FT                   GGVIVPPANYWPLVREVCDRYGVLLIADEVVTGFGRSGSLFGSRGWGVKPDIMCLAKGI
FT                   SSGYVPLGATAVNARIEDAFASNADFGGAIMHGYTYSGHPVACAAALASLDIVLREDLP
FT                   ANAAKQGAHLIEALRPFVERFDALGEVRGKGLMVALDLVADKATRAPIDPMSGYANAVA
FT                   EVARENGVLVRPVGTKIILSPPLVIQREQIDRIVAGLEAGFAATPFPGGR"
FT   gene            complement(661584..663086)
FT                   /locus_tag="BMA10229_0628"
FT   CDS_pept        complement(661584..663086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0628"
FT                   /product="phenylacetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.39"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00509"
FT                   /db_xref="GOA:A2RXM5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXM5"
FT                   /protein_id="ABN00509.1"
FT                   /translation="MTQTDLVAVADTVRAFTEREFGVFIDGAMRAAHSPRRLDVFDPAT
FT                   GARLSRVPDADAHDVDAAVASAQRAFDARAWSGLRPAERERILLKLADVLEAHAEELAQ
FT                   LETLNQGKSILVSRGVEVGATIEYVRYMAGWATKITGQTLDVSIPFPPGARYTAYTRKE
FT                   PVGVVAAIVPWNFPLMIAVWKLVPALAAGCTVVLKPSPETPLTALRLAELALEAGVPAG
FT                   VFNVVTGARACGAALASHPAVRKISFTGSTATGKLVGAAAVQNMTRFSLELGGKNPIVM
FT                   LEDVDVDAALGGVAAGAFFNQGQVCAAASRIYVHRSRFRRLAEGLAGVASAMRLGPGLD
FT                   PAAQINPLVSAHHRDTVARHIDAARREGLTFFAGGTRADDLPGYFVRPAVIADAAHDSA
FT                   IVRDEVFGPVVVVLPFDDPAEAVRLANASPYGLAASLWSNDLKAVMDLVPQIEAGTVWV
FT                   NCHIPLDPSMPFGGYKQSGIGREFGQYAIEGFTETKSVCIAH"
FT   gene            complement(663153..663299)
FT                   /locus_tag="BMA10229_0629"
FT   CDS_pept        complement(663153..663299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0629"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98792"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXM6"
FT                   /protein_id="ABM98792.1"
FT                   /translation="MARQAVGCNGDVPGEHAASSPSGATRPPSQTRPSCQFALTGRETA
FT                   SLH"
FT   gene            complement(663343..664164)
FT                   /locus_tag="BMA10229_0630"
FT   CDS_pept        complement(663343..664164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0630"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00152"
FT                   /db_xref="GOA:A2RXM7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXM7"
FT                   /protein_id="ABN00152.1"
FT                   /translation="MDARLKNVRTICRFVLIAPSTAWLRCRHRPLAIEVATAMTYDPAL
FT                   SDADAAPSYARALQACVGSLQALARPTATVFYRIDASGEPVDFELFGMTAAMHRAYVSR
FT                   YRPLDPLHPSRCASQPGAVVTLASQLPDERRDTSSYWTGFLRRHGVVDVVEVLLRDGGA
FT                   VLAAFSLLRLAGDGRYSAPEIAALRAVQPVVEAALLPPLRAVRGIRRIACDVRLTHREE
FT                   QIARLVRDGRSNKAIARDLALGQPTVKTHLLRMFRKLGVSNRTELVGALFL"
FT   gene            complement(664493..665326)
FT                   /locus_tag="BMA10229_0631"
FT   CDS_pept        complement(664493..665326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0631"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98697"
FT                   /db_xref="GOA:A2RXM8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXM8"
FT                   /protein_id="ABM98697.1"
FT                   /translation="MNGVDSRRAAPPRGGLAADFRGRTALVTGAAQGIGAAIADAFAAA
FT                   GASVAIADVQGDAAAAFAARLAARGAADGQTVRAYRVDAARRDELFGLVAQAEADSGRL
FT                   DIVVHNAAYFPLTPFGAIAPDVLERTLAVNLSALFWLTQAALPAFERVGRGRVLATSSV
FT                   TGPRVAYPGLAHYAASKAGVNGFIRAAALELARRNVTVNGVEPGMIRTPAAGNLGDAAH
FT                   GERIARGVPLGRLGEPEDIAAAMLFLASDAAGYITGQTIVVDGGATLPETAAALG"
FT   gene            complement(665323..666264)
FT                   /locus_tag="BMA10229_0632"
FT   CDS_pept        complement(665323..666264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99206"
FT                   /db_xref="InterPro:IPR024724"
FT                   /db_xref="InterPro:IPR035348"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXM9"
FT                   /protein_id="ABM99206.1"
FT                   /translation="MAPRAGTMIAVRDCAGARIAQSEESMGADPVFIQVGALAEGFAPD
FT                   SHILAPVDDLAGRTLALAATHGATREYTFAGRSTLRWRERQAARDIDGPARDTSDTRDA
FT                   RGEAAYRATQLREGVYFVDYVDPARRATSVSLVLDLRRGVWTSVEGVLPAEADVRIDSF
FT                   SRVASGLPLTGVDTRFRHGAIVGAAAPGPLHAPTRELIGKRTMYRYSPTECYEHIYLND
FT                   DFYAWHCLAGVERGLADVDRCHSFKLAEALYLFVWREKVVPTLGVVLIDLDRCKTDGKI
FT                   FGYREGDFGALSNFAIGAHAQVLNETMHPLAR"
FT   gene            complement(666698..667702)
FT                   /locus_tag="BMA10229_0633"
FT   CDS_pept        complement(666698..667702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0633"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99552"
FT                   /db_xref="GOA:A2RXN0"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXN0"
FT                   /protein_id="ABM99552.1"
FT                   /translation="MNGVKPRAGRTLIIERREKMALRSLGTSTIQVSPLVFGGNVFGWT
FT                   ADENTSFSLLDALADAGINFIDTADVYSAWVPGNQGGESETIIGKWLKRSGKRDQVVIA
FT                   TKVGLLETRAGLSRENILKAADDSLRRLQTDYIDLYFSHRDLADTAPLEETLGAYQTLI
FT                   EQGKVRIIGASNYSGARLREAAELSRRTGLPAYQVIQPEYNLYDREAYERDLEPAATEL
FT                   RLGVVTYYALASGFLSGKYRSEADLKKSARGRRVEQYLNPRGLRILAALDAVAAKHGST
FT                   QTSVALAWQMARPSVTAPIASATSLEQLSALGAAIRLQLDAHDIRQLDDASAP"
FT   gene            complement(667699..668278)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0634"
FT                   /note="conserved domain protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            complement(668275..669024)
FT                   /locus_tag="BMA10229_0636"
FT   CDS_pept        complement(668275..669024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0636"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99817"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXN3"
FT                   /protein_id="ABM99817.1"
FT                   /translation="MYLIDWISNRLVSLSFFLSERMTAMNPFRLQYFFDPLCGWCYASA
FT                   PALAGLDAAHPGVLELMPSGLFADEGARELTPEWGEYAWRNDQRIEQMTGQRFTHAYRE
FT                   QVLRRGGVRFDSGPANRALSALRGVDARLERPLLEAIQLARYVDGLDTARPDVLARIAA
FT                   GVAANAGVTTVDADALARRIEGDAALASETAGRIARTQRAMRQLGASGVPQLLLTVGER
FT                   GYVLHGASLYGGAQAAVAAVERVLQEA"
FT   gene            669063..669962
FT                   /locus_tag="BMA10229_0637"
FT   CDS_pept        669063..669962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0637"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00543"
FT                   /db_xref="GOA:A2RXN4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXN4"
FT                   /protein_id="ABN00543.1"
FT                   /translation="MDRITAMQVFVETAERGSVSAAAQHLDMSRAMASRYVAFVEQWTG
FT                   ARMLHRTTRRLTLTAAGAQMLPLCRDMLGLAEHVATVVAEPGDAPRGALRITASAIFAQ
FT                   THVTDAVLDYLARYPTVSVDLLVTDRTADLVDERIDLAIRITNAVDPSLIARRLGTCRS
FT                   ALCASPGYLAEHGAPKRPHDLTRHNCLTYAYFGQSLWHLTRDGEPATVPVQGNLSANDA
FT                   LVLLRAATAGGGIALLPTFAAAEPIRTGALVRVLPDCAAPELGIYAVYASRKQMPLAMR
FT                   TMIDFLAERFGDTPAWDA"
FT   gene            complement(670359..671882)
FT                   /gene="fliD-2"
FT                   /locus_tag="BMA10229_0638"
FT   CDS_pept        complement(670359..671882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD-2"
FT                   /locus_tag="BMA10229_0638"
FT                   /product="flagellar hook-associated protein 2"
FT                   /note="identified by match to protein family HMM PF02465;
FT                   match to protein family HMM PF07195; match to protein
FT                   family HMM PF07196"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00099"
FT                   /db_xref="GOA:A2RXN5"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXN5"
FT                   /protein_id="ABN00099.1"
FT                   /translation="MAITQTGTTSQSDVWSQIQDAAQSLINGATGKTSMDVSGLVSVLV
FT                   NAKTAGQAAEIKNQAAWNSTQISALGALKLALSNLKTGVEPLSDGTFAQKFTSKASGKG
FT                   LGATMDKGTVAGSYQVEVKQVARSQTLVSAGFDPKHTLGSGTLTLKLGDRSTSIDIDAT
FT                   NNTPAGIAAAINSAKNNPGVTATVVTGTDGAHLVLRSTASGSANVISMSVSNVKDDAGL
FT                   SGLAVQSTADDKGGKSAITSAGDAWKQSDFAQDAIVTVGGVITARSADNAVKGVIAGVT
FT                   INVTEEAIGAPQTLLIARDIDGQARAVTNFVDLYNSMIGTMAQLTSFDKTAKPGQQGGP
FT                   MIGDSMLNGIRNSLAHIVGGGVPHGENKRASLAALGITFARPGDKQPEGSLIVDKAKLN
FT                   EALQNDPQAVEALFNKTNGIGTQITKALDVHLRKDGSFDVRSNAIDRDMKSIAQRQARL
FT                   ETYASQLTAQYKAQFTALDALMARMQQNTNYLTQLFGGANSSGALANNK"
FT   gene            complement(671922..672660)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0640"
FT                   /note="putative N-carbamyl-L-amino acid amidohydrolase,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts"
FT   gene            complement(672657..673940)
FT                   /locus_tag="BMA10229_0641"
FT   CDS_pept        complement(672657..673940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99982"
FT                   /db_xref="InterPro:IPR026002"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXN8"
FT                   /protein_id="ABM99982.1"
FT                   /translation="MRACAGSGARRAYLAQVPRAACVSYVLMRAMHAIRGAAERADSTD
FT                   AARLPAVLHTLKRQGVTGAIAFGGEGNLRDPAFTIYRAGGRTWAVVGVLGGVGGVGASG
FT                   NAAACVAAGVSGLSGGKAARLARFRESRERIERRIEMATSPGGRPMTTIPIHPAAGGAA
FT                   HDEPLGILARRRIEAEIIKPIYEIMKREFGLERAQAVIAEAVRGAALDAGRAFAAKEPG
FT                   GTSIASFVALQVLWEKDDALDVDVHRADDAHYDYDVRRCAYAQMYREMGLAEIGHLLSC
FT                   ARDSVFIEGYDARIALTRTRTLMQGGTHCDFRYRLAQPPRDGAADATHAAPGGLAGGMR
FT                   EARVRENEPAGQPEPAPGDRAGPSPESPPRSRTESRTEPGTEPGTASQASGDAPGIRRA
FT                   SSPTFDRRAVAASSAGEHTRPEAGDAAR"
FT   gene            complement(673975..675462)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0642"
FT                   /note="DNA repair helicase, truncation; comparison of this
FT                   gene to its homologs suggests this gene has been truncated"
FT   gene            675655..675918
FT                   /locus_tag="BMA10229_0643"
FT   CDS_pept        675655..675918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0643"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00117"
FT                   /db_xref="GOA:A2RVY0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVY0"
FT                   /protein_id="ABN00117.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKDLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            675942..676775
FT                   /locus_tag="BMA10229_0644"
FT   CDS_pept        675942..676775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0644"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00557"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABN00557.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            676797..678176
FT                   /locus_tag="BMA10229_0646"
FT   CDS_pept        676797..678176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0646"
FT                   /product="YadA-like C-terminal region protein"
FT                   /note="identified by match to protein family HMM PF03895;
FT                   match to protein family HMM PF05662"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98619"
FT                   /db_xref="GOA:A2RXP1"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXP1"
FT                   /protein_id="ABM98619.1"
FT                   /translation="MALSKGAGHIGSANSSIASLSTSTSTGISSLSTGLSTTDSNLTSL
FT                   STSTSTGLSSANSSITSLSSGLSTTNSNVASLSTGLSSTNSSLTSLSTSASSGISTAQS
FT                   GVNSLSTGLSTTNSTVASLSTSTSTGISSLSTGLSTTDSNLASLSTSTSTGLSSTTSSI
FT                   ASLSTSTSTSFSSALSSIGSLSTGLSTTNSNVASLSTSTSTAVGSLSTSLSTTNSNVAS
FT                   LSTSTSTNVNSLSTGLSTTNTSVASLSTSVTNLNTQLTSLSTTIVNSTNNVIRALPAST
FT                   GIAADMSAPNAAAPSVTAGSNSVALGANSTDGGRSNVVSVGSATQQRQITNVAAGTEGT
FT                   DAVNVNQLNALSTSMSQSLAGQQGQINNLGSQLTQTQQALQQTDTMARQGIAAATALTM
FT                   LPQVEPGKTINVAVGVARFAGQSGMAFGASAHVTTNGILKLGIGVSGQNKTFGAGYGYS
FT                   W"
FT   gene            678173..679327
FT                   /locus_tag="BMA10229_0647"
FT   CDS_pept        678173..679327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0647"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99726"
FT                   /db_xref="InterPro:IPR021234"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXP3"
FT                   /protein_id="ABM99726.1"
FT                   /translation="MIDSIRSSSTGPRDAPGKRLAVGISLFARDGQAIWENGIHQNIAF
FT                   LAMMLKQSDRIGPVYFLNGGDAKALPAGLDLGGLDVPLVQPRDVSHALDVVIEMGAQLP
FT                   VDWLKHMKALGKKLVVCFVGHTYSGLTETPMFNRPSGHIFNGGPFDEVWILPKSEKIDA
FT                   PLLRTLTRAPVHVVPHIWSPYFIERRARELEAAGLRFGYAPGRAKWRLSILEPNISVVK
FT                   TCHYPMLAADEFHRAQPDAVEHLFVVNSLHMKEHPTFVHFANSLDLVREHKATFEPRID
FT                   LPSFLAQHGDAVISHQWENPQNYLYYDVLYGGYPLVHNSPMLGDAGYYYPEFDSAAGGR
FT                   ALQHAWRHHDAHLDDYRRHADALLQGVSIDNRRNLDAYVARLFA"
FT   gene            679349..680497
FT                   /locus_tag="BMA10229_0648"
FT   CDS_pept        679349..680497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0648"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99132"
FT                   /db_xref="InterPro:IPR021234"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXP4"
FT                   /protein_id="ABM99132.1"
FT                   /translation="MSETTARDVPNGGKRLVVGVSLFVRSAGQSLWENGIFQNCLLLVL
FT                   LLRQSPLVAEAVMVNGGTSDADPQLMLGEWNVPLVSMDEAMTRCDVLIEMSAQFNAGWL
FT                   AEYQRRGGKVVTMRVGNDYVIDIERAIFDKPSGFLFSGARYDGVWTIPEFEHSCGHYLE
FT                   SGLRSPVTIVPHIWHPLLFDKARATLGPGLEFGYKPGRPRWRVTMFEPNICMVKTSIVP
FT                   MLVAEEAYRAQPDFVEFVRVCNTLHMKEHTTFVHFARSLDIVDHGLTTFEGRFAVYEFM
FT                   AAYGDAVVSHTWENAQNYLYYELLYGDYPLVHNSPSLGRAGYFYPDFDCQEGGRQLLKA
FT                   FREHDANLDAYREQSRHVLDSVSIYNAQNVAAYTEAIAALYR"
FT   gene            complement(680607..681095)
FT                   /locus_tag="BMA10229_0649"
FT   CDS_pept        complement(680607..681095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0649"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98522"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXP5"
FT                   /protein_id="ABM98522.1"
FT                   /translation="MPLACAPGARIAPHERMHCAAPAARPVYCPARDGATPRRRRGAYE
FT                   TRRRRPSLSCRKLRFSSTTLPRCRAVVQSTFAYSPFDRSVACVKRLSMMSDPTRPAARA
FT                   RRAARAAGACGGEALLGGRLLTQAAQSFPASSKRPSSIRLRTFSALRSTASGDGLVCA"
FT   gene            complement(681158..682360)
FT                   /locus_tag="BMA10229_0650"
FT   CDS_pept        complement(681158..682360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0650"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00115"
FT                   /db_xref="InterPro:IPR021234"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXP6"
FT                   /protein_id="ABN00115.1"
FT                   /translation="MRAAAPRVRYTASFPSLLHAMTPPVDLNGLRIGITIGLREPNESL
FT                   WINGIKQNALFLAKLLMKSSRGYRVTIVNTTDVPITDALPWDRRIFDTRSFADVKDSLD
FT                   VLIELGGQIDGEQTAYLKARGVKLVSYCCGFEYIHATQSILFGRRMWDTLFINRGYDEI
FT                   WAIPQIAPSSLPFLQSLRRSPGRVVPFVWDPMFLGERTRLLPERGEYRPSGKRAKRLTV
FT                   MEPNHDVVKFCVYPMLIIDEAYRREPDAIAFAHVTNAERLAHDSPEFVMLMNYLEIVRA
FT                   SKASFVGRFDTPTFLAEHTDVVVSHQWENPLNYFYFDVCWQGYPLVHNAHLVPDIGYYY
FT                   PDNDVQTGAEVLMRVLREHDDDWEGYAARQRSLLRRYTSKNPTLVAEYDTLLANLVNDR
FT                   R"
FT   gene            complement(682441..684435)
FT                   /locus_tag="BMA10229_0651"
FT   CDS_pept        complement(682441..684435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0651"
FT                   /product="putative acetyl-CoA carboxylase, biotin
FT                   carboxylase subunit"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF01071; match to protein family HMM PF02222;
FT                   match to protein family HMM PF02785; match to protein
FT                   family HMM PF02786"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99500"
FT                   /db_xref="GOA:A2RXP7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXP7"
FT                   /protein_id="ABM99500.1"
FT                   /translation="MFDKILIANRGEIACRVAATCRRLGIASVAVYSDADAHAKHVAAC
FT                   DEAVHIGGAAAADSYLRIERIIDAARATGAQAIHPGYGFLSENEDFARACEDAGIVFVG
FT                   PPVEAIAAMGSKAAAKALMHAAAVPLVPGYHGDDQSPELLQREADRIGYPVLLKASAGG
FT                   GGKGMRVVERAADFAAALASCQREAAASFGNDRVLIEKYLQRPRHVEVQVFGDTYGNAV
FT                   YLFDRDCSVQRRHQKVLEEAPAPGLADALRQAMGEAAVAAARAVGYVGAGTVEFIMTGD
FT                   AFYFMEMNTRLQVEHPVTEMVTGLDLVEWQLRVAAGEPLPLRQPELHVRGHAIEARLYA
FT                   EHPARGFLPSTGRLKHLRFPAGAEFAAGAAVRIDSGVREGDAITPFYDPMIAKLIVHAD
FT                   TRAQALATLGRALRECEVVGLHTNAEFLQRIVASRPFADADLDTGLIERHRDALFAPRP
FT                   APAAALGLACAALFAREQAGAGGVASPWAALPNWRLNAGYRRTIEWRALDDDTALEVRY
FT                   LEHGGAQSLEIGGVAQPFAWSRGAGPLDFDVTLGGVRASGRVHVDGDTFHVFCQGVARA
FT                   FEWRNLLAHAADSTEGEGWLTAPMPGKVIAVLVEPGRKVEQGDPLIVMEAMKMEHTIGA
FT                   PAAGVVAEVLYAVGDQVADGAQLLVMGPA"
FT   gene            complement(684615..685400)
FT                   /locus_tag="BMA10229_0652"
FT   CDS_pept        complement(684615..685400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0652"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99448"
FT                   /db_xref="GOA:A2RXP8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXP8"
FT                   /protein_id="ABM99448.1"
FT                   /translation="MRYETIEVTDDGRVATVTLARPDVRNAFNETMIAELTTAFDRIDA
FT                   QPSLRAVVLAARGPAFCAGADLNWMKKMAGFSDDENRADARRLARMLDAIYRCAKPVIA
FT                   RVHGDAYAGGVGLVAACDIALAAEDVKFCLSEARLGLIPATIAPYVVRAMGERAARRYF
FT                   ATAEAFDCAKAAQLGFVHERVPADALDASVAKLADALCANGPQAVRACKALVRDVAGRA
FT                   LDAALIEQTADWIAKARAGAEAREGVASFLEKRTPSWRA"
FT   gene            complement(685421..687028)
FT                   /locus_tag="BMA10229_0653"
FT   CDS_pept        complement(685421..687028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0653"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase"
FT                   /note="identified by match to protein family HMM PF01039"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98927"
FT                   /db_xref="GOA:A2RXP9"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXP9"
FT                   /protein_id="ABM98927.1"
FT                   /translation="MPIIESKLNPRSDEFRANAAALEALVADLREKIDRLALGGGQAAR
FT                   DKHLSRGKLLPRDRIAQLLDPGTPFLELSQLAAYGMYNDDAPGAGLITGIGRIAGRECV
FT                   IVCNDATVKGGTYYPVTVKKHVRAQEIAAENRLPCVYLVDSGGANLPNQDDVFPDRDHF
FT                   GRIFFNQANLSAAGIAQIAVVMGSCTAGGAYVPAMSDESIIVRNQGTIFLGGPPLVKAA
FT                   TGEEVSAEDLGGGDVHTRLSGVADHLAQNDAHALALARAIVGNLGARGGAAPAMREPLP
FT                   PRYDARSVYGVIPADTRKPFDVREVIARIVDDSAFDEFKARYGTTLVTGFAHIWGQPVG
FT                   IVANNGILFSESATKGAHFIELCCQRKIALVFLQNITGFMVGRKYENEGIARHGAKMVT
FT                   AVSTAKVPKFTVIIGGSFGAGNYGMCGRAFGPRFLWMWPNARISVMGGEQAASVLATVR
FT                   RDEIEAKGGEWSAQDEEAFKQPIRDQYERQGHPYYASARLWDDGVIDPAQTRDVLGLAL
FT                   AAARNAPIEDTRFGVFRM"
FT   gene            complement(687051..688232)
FT                   /locus_tag="BMA10229_0654"
FT   CDS_pept        complement(687051..688232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0654"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00371"
FT                   /db_xref="GOA:A2RXQ0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXQ0"
FT                   /protein_id="ABN00371.1"
FT                   /translation="MSNLPGVNFMLGEDIEMLRDSIAHFAAKEIAPRAAEIDRTDQFPM
FT                   DLWRKFGELGVLGMTVAEEYGGANLGYTAHMVAMEEISRASASVGLSYGAHSNLCVNQI
FT                   HRNGTDAQKRRYLPKLISGEHIGALAMSEPNAGSDVVGMKLRAEPRGARYVLNGTKMWI
FT                   TNGPDCDTLVVYAKTEPEAGARGITAFIVEKGMKGFSVAQKLDKLGMRGSHTGELVFED
FT                   VEVPEENILGELNGGVKVLMSGLDYERAVLAGGPTGIMAACLDAVVPYVHDRKQFGQPI
FT                   GEFQLIQGKIADMYTTFQACRAYLYAVGRHLDAGGSAHPRQVRKDCAGVILYTAEKATW
FT                   MAGEAIQILGGNGYINEYSVGRLWRDAKLYEIGAGTSEIRRMLIGRELFAETA"
FT   gene            688440..689204
FT                   /locus_tag="BMA10229_0655"
FT   CDS_pept        688440..689204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0655"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99908"
FT                   /db_xref="GOA:A2RXQ1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013570"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXQ1"
FT                   /protein_id="ABM99908.1"
FT                   /translation="MTATQKADRADAPRAPAGRKSQQRVQDILRAGREVFAEKGYEHAT
FT                   AAEIAQRVGVSEATVFSYFRGKRELCARVIADWYDEIVDAFETGMPRDGSVRQQFAFVV
FT                   RTHLRLMLVNGTGLCALVLSEGRAKQHALADELTALQRRYTAPLMDVLARGQATGQVRA
FT                   DMPLSLLRSMVFGPIEHVLWDAILGHRKLDTETTAEQLIDLLWTGLQPPAPENAALVRF
FT                   RSDVADAMRRLDQACGRAPRKAAAGRDAQKPA"
FT   gene            689242..689370
FT                   /locus_tag="BMA10229_0657"
FT   CDS_pept        689242..689370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0657"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98494"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXQ2"
FT                   /protein_id="ABM98494.1"
FT                   /translation="MPARYRAASACGRFAIISISNRKPSSHVTPTPVGVGCGASPR"
FT   gene            complement(689324..689650)
FT                   /locus_tag="BMA10229_0656"
FT   CDS_pept        complement(689324..689650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0656"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00082"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXQ3"
FT                   /protein_id="ABN00082.1"
FT                   /translation="MVDAPTAVRALAAFFGRGAIGLRATRVFPGARGRILRAMSDERRI
FT                   LQAQMRLAFDNLNACLSAAGSTFDDVVDVTIVVVDPPSISTRSGRARPATGATRRIRRR
FT                   PASA"
FT   gene            690144..692462
FT                   /pseudo
FT                   /gene="norB"
FT                   /locus_tag="BMA10229_0658"
FT                   /note="nitric oxide reductase; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            692459..694066
FT                   /locus_tag="BMA10229_0659"
FT   CDS_pept        692459..694066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0659"
FT                   /product="mulitcopper oxidase domain protein"
FT                   /note="identified by match to protein family HMM PF00394;
FT                   match to protein family HMM PF07731; match to protein
FT                   family HMM PF07732"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99631"
FT                   /db_xref="GOA:A2RXQ5"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXQ5"
FT                   /protein_id="ABM99631.1"
FT                   /translation="MTARAPAPPGKTRAGHEPHPPPAALGSRSPCRRAAAAGAAETNTG
FT                   GLDMNPAVDPSPLSRAAQALALASIGGALALGACTSRPSGERYDPSRMDFNPGPAIVTQ
FT                   TRHTGPFAAGSALSFDAALQPLDAARDQAIRLDTTHTVIRIAPGIAFAAWTFGNQVPGP
FT                   TVHVKVGDRVRLSMTNRSDEPAPGGLQLTAPMMHSMDFHTAMVSPTDKYRSIAPGQTMH
FT                   FEFTPNYPGVFMYRCGTPRVLEHIASGMYGVVVVAPRDGYPTRADREYVIVQSEFYTKP
FT                   DPQHRSVGTDALHVLDGERLRRKAPTYTVFNGRYNGMVTQPLIAKPGERVRLYVLNAGP
FT                   SDTSSFHVVGAIFDRVWLDGNPDNQLRGMQTVLLGSSGSAIAAFVVPEAGAYVMVDHQF
FT                   ANASQGAVGVIDAGAHEESTIEHHNIPASATPTDAEAIQGKLDFESKCLACHTLGHGAK
FT                   LGPALLGVTQRRSDAWLRRWLASPEAMVASDADARALRAHYPITMPGQNLSDSEIRRYV
FT                   RYFHWADEASKQRDHAMP"
FT   gene            694456..694572
FT                   /locus_tag="BMA10229_0660"
FT   CDS_pept        694456..694572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0660"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00426"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXQ6"
FT                   /protein_id="ABN00426.1"
FT                   /translation="MMKTTTLPLSGSSFVVAFLCEGTRKWTTPTQIKNTKDN"
FT   gene            694686..697862
FT                   /locus_tag="BMA10229_0661"
FT   CDS_pept        694686..697862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0661"
FT                   /product="rieske [2Fe-2S] domain/carboxynorspermidine
FT                   decarboxylase"
FT                   /note="identified by similarity to GP:498170; match to
FT                   protein family HMM PF00278; match to protein family HMM
FT                   PF00355; match to protein family HMM PF02784"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99334"
FT                   /db_xref="GOA:A2RXQ7"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXQ7"
FT                   /protein_id="ABM99334.2"
FT                   /translation="MPAHFDHAAARYAARTGEPLTLDHARAFCAATMLRAVEHPAGTDD
FT                   WHLLCRLDEIPDIGDYVTGYAFQESMTAVRASEHEVRVFLNVCPHRQTQLFQAAGSFDP
FT                   HRHVRCPYHGWTFDVDGRCVNAPGARRCEFGADFREQDFSLSRVPARVEDGGILVRKAV
FT                   SRVGRRMAALYERVYFAFPDVKRPFVPDRFRVLLRIGFLAADIRQARDSSILSALRAEL
FT                   RQHLLTYPDLPVRYASLAKRHGEPTVDAVDAVDAVDLGPRLAGGPLRETVATWVYGDAE
FT                   LHALERDTLVLPAWHFVGHVAELRGGERTLTLDVSGERAYVCRARDGTIHAGRLVDIDR
FT                   RTDDPARLRADGALAPIDVDVWQGLIFVRLAAGRGGVADIWEHARMLEPYRIGQMAPLA
FT                   GKGWYDFAVEADAKILWENFLEMYHFPAAHQAMIRLFELSSRSDLLTLREPASTRLSPI
FT                   EARYRDALKRGATHGADEEARQRAMADGDAALARPLQLTVFGSIPETAQTATMLGITVF
FT                   PDHIQAMSFIPVGPRECRVKIRSYGHAAEGALDIARQCNVEQLQIELVEEDIQLNHRSQ
FT                   IAASTRSYERRGVLHDMEVSVADFQQLLRRVLPVTRCVRRPPVGALARANQALRLRDRD
FT                   ERGAPRRACADAARRARAPAAASAFAAPPPASRQRNAETLEALDTPAFVYDERTLRDAL
FT                   SSMHTLLGDSGCRLLYPLKPFSHAGALECIGPHVDGFAASSPFEAAFSRTLLGRAGSVH
FT                   LATPALRDRDLGTIVDNCDYVALNSLSQWRRLHDALAGRLSCGLRINPQYSVVADARYD
FT                   PCRPHSKLGVPLDAIERVVASDPRALHGLQGIHFHTNCDSTDFSRLAETIEHLEKRLAR
FT                   TLDGLAWINLGGGYIADGARYVDRFRACAKRLREHFGVALFIEPGAAIVRAAGTIIASV
FT                   VDLFDSGGMPIAVLDTTVNHYPEVFEYQFQPDVDGHHPAHAHAYLLAGASCLAGDVFGT
FT                   YRFDAPLRVGSRVAFVNAGAYTLVKAHRFNGINLPSVYRRGEDGALAAVQRFSYEDFLR
FT                   QNGGLDHAYP"
FT   gene            697849..699213
FT                   /locus_tag="BMA10229_0662"
FT   CDS_pept        697849..699213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0662"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99426"
FT                   /db_xref="InterPro:IPR021763"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXQ8"
FT                   /protein_id="ABM99426.1"
FT                   /translation="MHIHEKAFSVSGPLASASLDHLRELTRQQLGPDETPVRFVVTRSD
FT                   EHGFDCEIGVLSDGEMPESMRADGLFRCERRTRGGGGEFNAVLIVPTGVGAEIGGHDGD
FT                   AGPVAMLLSSICDRLITHPNVVNAADINELPANGLYVEGSVICRLLLGQIGLQPVRANR
FT                   VLAVVGSNECPTFVNAAINAVNAARAAYGLDCPRVLHLDPGIRLTSTYASSGRAAGTVE
FT                   NLDALVALLAEHRDTFDAVAIASHIHVPDACRTGYYAGTLGLVNPWGGVEAMLTHTLST
FT                   LFSVPSAHSPMYEDPRFAVRDYGIVDPHIAPEVVSLTFLQCILKGLRRAPRIVELARAG
FT                   NAAGTLSVSDVSCIVIPHGCVGLPVLAALAQRIPVIAVRENRNVMRNDLRSLPWAPGQL
FT                   RIVDNYWEAAGVLASMRAGLNPDSVRRPLASVDVVRASAARAHGASSIATAANIA"
FT   gene            699215..700006
FT                   /locus_tag="BMA10229_0664"
FT   CDS_pept        699215..700006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0664"
FT                   /product="jmjC domain protein"
FT                   /note="identified by match to protein family HMM PF02373"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99556"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXQ9"
FT                   /protein_id="ABM99556.1"
FT                   /translation="MNDAAQADFLPIDRRDALSYEAFVEQYALPGKPVVLTGLMRDWEA
FT                   ARVWNFEYFRRRHGHVTIVARRSDDYERTITLPLADYLDRLDDPDAHFYLKDWVFENDI
FT                   PELRAQYRVPRHFANWATRVPGKWQPKWRWLYIGPASSASHLHVDFLLTSAWNALFVGA
FT                   KRWLAYSPDQARRMYRGAVDAFHPDLERFPEFAHARARMHVQRPGEIMYMPATWWHAVR
FT                   NEEPSLALSENFINAVNARYFLKPRVIARFLRYADHPLWVK"
FT   gene            complement(699985..700290)
FT                   /locus_tag="BMA10229_0663"
FT   CDS_pept        complement(699985..700290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0663"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99883"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXR0"
FT                   /protein_id="ABM99883.1"
FT                   /translation="MRTSARRARRAGRIRAAGRRGRRRIAREAGAPRERTGAERSRRAA
FT                   AATRVMSLSRCAPAADAAAPGARARRARGRAMSASRGRADRRAARERRMRYLTQSG"
FT   gene            700396..701016
FT                   /locus_tag="BMA10229_0665"
FT   CDS_pept        700396..701016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0665"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98936"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXR1"
FT                   /protein_id="ABM98936.1"
FT                   /translation="MLRAAPAALLLAVCAGTQAQPLAGSPSSAATANPAAQAPTRSRTP
FT                   PDARSPALPAGSLASQTLSQHAPPDAKPQYAAPLQRNFAFAQDQSRQEECDELAATIDN
FT                   LARHTQAATRSAPPALLAPSTANSQTPWKIPAPPVYEPPPSRPPPSANGHARPNYAPLP
FT                   FDYRSRPWAQPYPATEQDAKEQRARSAQQIELETRYRQLHCRP"
FT   gene            701157..702170
FT                   /locus_tag="BMA10229_0666"
FT   CDS_pept        701157..702170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0666"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99181"
FT                   /db_xref="InterPro:IPR021365"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXR2"
FT                   /protein_id="ABM99181.1"
FT                   /translation="MTARQLTPALASRFANLALSHLTREYPNKLTHSLAGPQDVLGPRA
FT                   LHPIFYGSYDWHSCVHGYWLVTRLLDRFPDLPEGPRIVATVDAHFTAGNVAGEAAYLNL
FT                   PHNRGFERPYGWGWLLALSAQLASMKSDAGRRWSATLAPLTDLFVERFAEFLPKATYPL
FT                   RVGTHFNTAFALSLALDFARQTGHAALEALIVDTARRWHLRDANCQAWEPSGDEFLSPA
FT                   LMEAELMRRVLPAAEFLAWFDAFLPSLAAREPATLFTPATVTDRTDGKIAHLDGLNLSR
FT                   AWCQRALARALPDGDPRRAALADAADAHLASALEHVAGDYMGEHWLASFALLALEA"
FT   gene            complement(702639..704123)
FT                   /pseudo
FT                   /locus_tag="BMA10229_0667"
FT                   /note="MFS transporter; this gene contains a frame shift
FT                   which may be the result of a sequencing error; identified
FT                   by match to protein family HMM PF00083; match to protein
FT                   family HMM PF07690"
FT   gene            complement(704226..705074)
FT                   /locus_tag="BMA10229_0668"
FT   CDS_pept        complement(704226..705074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0668"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98440"
FT                   /db_xref="GOA:A2RXR4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXR4"
FT                   /protein_id="ABM98440.1"
FT                   /translation="MPPTSLTIECAAARAGALVRRVMRAFSPAGAPFIVSGILFVSDNA
FT                   YTNAFGQPIGAPVPGWQPRPAPPRTPAQGRFCRIEPVDPGRHADDLHAAYATAADGRDW
FT                   TYMSAGPFADAESYRAYLRKAAETDDPLHHAIVDLATGKAVGTFALMRADRANGAIEVG
FT                   FVVYSPLLQKTCAGTEALFLLMRRVFDELGYRRFEWKCDSLNAPSRAAALRYGFTYEGL
FT                   FRQAVVYKGRSRDTAWYSIVDGEWPALRSAFEQWLAAGNFDAHGRQRQSLSTLIAAARG
FT                   R"
FT   gene            complement(705140..705625)
FT                   /locus_tag="BMA10229_0669"
FT   CDS_pept        complement(705140..705625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0669"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99186"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXR5"
FT                   /protein_id="ABM99186.1"
FT                   /translation="MSGHGRAGAAGRRAFARAAAETDPAASRRPARADSGAPPTSVSGR
FT                   DSDRDSGRVSGCAPGRRAANRLLPGAPGAPGAGPRHAFGRHLPARRSRSRAPAACRGSS
FT                   RPAFGAGALRQTPARRVAIRRIAVPRSCRPPWRRHPARIGTARRHRSRRPWRPPQCS"
FT   gene            complement(705622..706983)
FT                   /locus_tag="BMA10229_0670"
FT   CDS_pept        complement(705622..706983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0670"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00059"
FT                   /db_xref="GOA:A2RXR6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXR6"
FT                   /protein_id="ABN00059.1"
FT                   /translation="MLRSLQGRLSAALVAGLVALSAAGGAAAFYVLRAEVEQMSDSALQ
FT                   ETAQRLLPLAVMDIVGRDSDGDDGDGGGGRIAAVRPHDELLTYIVRDETGKLLLRSHDA
FT                   NAGLFPKNLKAGFARTATHRVYAETVLQGTVTLLIAEPLATRRRAEVQAAFAVVRPLAL
FT                   FLPVGLLGIWLIVRSGLTPIRRFCGAIAARGRNDLTPLDKGGLPAEIAPVADAVTELMA
FT                   RLDRALAAERSFAANSAHELRTPIAAALAQTQRLIAEAPAEPLRERARRVEGALHTLSR
FT                   VSEQLMQLAKAEDGRVLADTPQDLRPVLALVVDDFRRGARDRAIALELPDTAVTSRIDP
FT                   DAFAIVVRNLVENALKHGAAAEPVRVALSAAGALSVTNRGPVLAAAELERLTKPFERGA
FT                   TAAKGSGLGLAIVDAIAKGAGASFTLRSPAPGVTDGVQARVDGLACGGGPAAKG"
FT   gene            complement(706986..707645)
FT                   /locus_tag="BMA10229_0671"
FT   CDS_pept        complement(706986..707645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0671"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00181"
FT                   /db_xref="GOA:A2RXR7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXR7"
FT                   /protein_id="ABN00181.1"
FT                   /translation="MRVLLVEDDPWLGEAVRAQIEKDGHPTDCVASLAHARRHVAVAPY
FT                   DLILLDLLLPDGRGLDFLRELRAGGSTVPVIILTALDQVANRIAGLNAGADDYLIKPFD
FT                   LSELSARVSAVARRYSGNPNPLVKLGELAVDIAARSVTRAGARVDLTASEWALLETLIQ
FT                   HPGMILSKPQLEERLYSFSDEVGSNTIEVHVSRLRKKLGAELIETVRGLGYRLRRD"
FT   gene            707790..708233
FT                   /locus_tag="BMA10229_0672"
FT   CDS_pept        707790..708233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0672"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99316"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXR8"
FT                   /protein_id="ABM99316.1"
FT                   /translation="MKTSRLIKAVALAALASLVLGGALGIRAAMADDGDDCRAPLADWK
FT                   PRDAVRALAQQKGWRVDKLKADDGCYEIKGHDADGKRFKAKLDPVTLDVVRMKREGERK
FT                   RDHDDDDDHGRAPDARAPAGGPPAGAPPGGVLKPGSKPDVQIR"
FT   gene            708517..708717
FT                   /locus_tag="BMA10229_0673"
FT   CDS_pept        708517..708717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0673"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00080"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXR9"
FT                   /protein_id="ABN00080.1"
FT                   /translation="MRRTAAASRRRFDQVPIGHRSTRMIERHPARLQALVNGHRACGAR
FT                   QRNSARRHALRRIRPRRRDGG"
FT   gene            708840..709673
FT                   /locus_tag="BMA10229_0674"
FT   CDS_pept        708840..709673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0674"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99783"
FT                   /db_xref="InterPro:IPR014469"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXS0"
FT                   /protein_id="ABM99783.2"
FT                   /translation="MAGAARAGGSIDCRLPTSGRPRSAHSARPRMLGSESSVARRHAAA
FT                   KGRESNAYIADKHRDTWPGMRGTGARDAGRTPGCGVRCRRTPTQRPPGRPTAGPPGDAR
FT                   PRLVAARAAALTQTRRTQMKHALPIAALAGALAAPSLAHARQVTFETQLADYGGDGAYV
FT                   VLYVTDRAGRYQGTLWMAGRQTKYYRHLRDWYRATGGSARLDGITGASVGAGRTLRATL
FT                   DVADALLDAGYEIHIDTAVEDMNENASEVVVPLNAAGAGKAVKGRGYVKSFRYSL"
FT   gene            709695..712027
FT                   /pseudo
FT                   /locus_tag="BMA10229_0676"
FT                   /note="oxidoreductase NAD-binding/FAD-binding, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error"
FT   gene            712008..713222
FT                   /locus_tag="BMA10229_0677"
FT   CDS_pept        712008..713222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0677"
FT                   /product="ApbE family protein"
FT                   /note="identified by match to protein family HMM PF02424"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98852"
FT                   /db_xref="GOA:A2RXS3"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXS3"
FT                   /protein_id="ABM98852.1"
FT                   /translation="MSKTSIEWSPGARLNRCRASGATMGTRYGAQFYAPPTADARAIAA
FT                   ALDAAVRAVDAQMSNWKADSDLSRLNRATPGSWTPICANLAAVLVRAREIGRETDNAFN
FT                   IGVGTLVDRWGFGPGAAANRQADNERAANRQAAGRHTVARRTVARHMVARHTVDRHTAD
FT                   RQTADRQTKDGRTPDRQPARPAGPANGLSGAIDARRRASILRGPVPSPCRPIDELLEVD
FT                   VARGRVRRLADVAFDLCGIAKGFGVDELARVLDRHGIGAWLVGIDGELRARGCKPDGSP
FT                   WAIALEAPDYGRRGAMGAIDLVDAAVATSGDYRHWADFGGERLSHTMDPRAGAPLRGDI
FT                   ASVTVVAPTCTDADAYATALMVLGAQAGCAHAERHGLDALFVVRDGDALRTIGCGAFAD
FT                   AGPAG"
FT   gene            complement(713237..714748)
FT                   /locus_tag="BMA10229_0678"
FT   CDS_pept        complement(713237..714748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0678"
FT                   /product="putative piperideine-6-carboxylate dehydrogenase"
FT                   /note="identified by similarity to GP:11990463; similarity
FT                   to GB:BAB19801.1; match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00432"
FT                   /db_xref="GOA:A2RXS4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXS4"
FT                   /protein_id="ABN00432.2"
FT                   /translation="MQFNDILAALDVDLSRWQGRALTARSPVDGATLATLAADAPADAE
FT                   RKIDAAHQAFLKWRTVPAPVRGELVRVFGNVLREHKAALGRLVTLEAGKIASEGLGEVQ
FT                   EMIDICDFAVGLSRQLYGLTIASERPGHRMMETWHPLGVCGVISAFNFPVAVWSWNAAL
FT                   AFVCGDPVVWKPSEKTPLTAIACHTLFAKAVREFDKTHPGVVPEGLHQLVLGGRDVGEA
FT                   LCASPKVPLVSATGSVRMGIEVAQVLSRRLARSILELGGNNGMIVAPSADLDLVVRAVT
FT                   FAAVGTAGQRCTTLRRLIVHRSVADQLLPRLEKAFASVKVGDPLEAGTLVGPLIDRASF
FT                   DAMQKALGDAREQGGEVKGGERVELGRADAYYVRPALVRMPRQTAVVTRETFAPILYVL
FT                   VYDDFDEALAIHNGVPQGLSSAIFTNDMREAERFMSVAGSDCGIVNVNIGTSGAEIGGA
FT                   FGGEKETGGGRESGSDAWKSYMRRATNTINYSRELPLAQGVKFDV"
FT   gene            complement(714907..716022)
FT                   /locus_tag="BMA10229_0679"
FT   CDS_pept        complement(714907..716022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0679"
FT                   /product="aminotransferase family protein"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99677"
FT                   /db_xref="GOA:A2RXS5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXS5"
FT                   /protein_id="ABM99677.1"
FT                   /translation="MTLAAAVDYPFAAPFADPQGSPIRELFKHVGKPGMISFAGGYPSA
FT                   ELFDREGIAAAFADAARDDPVACLQYGDTAGQPGLRAALADWMTRARGVACDASQVLVT
FT                   TGSQQGFDLLVRALIEPGDVALVEAPAYPAALQALRLAGAKLVPVRTDADGVDPDALAA
FT                   QLAAWPAAERRPKLLYTVPTFANPTGATLPPARRARLAAVAADARLVLVEDDPYADLRF
FT                   AGEPVKPVLAHDGASDWTVYLGSLSKIVAPGLRIGWAVAPAAVLRRMTVAKQTSDLCTA
FT                   PIAQEAIRRYLASGRLAAHLRTIAQTYGSRCRALVSALEHNVMYVPGAAFYARDADAGS
FT                   LRLSFAAPGEAEIFEGVRRLRAALAACRQRT"
FT   gene            complement(716077..717096)
FT                   /locus_tag="BMA10229_0680"
FT   CDS_pept        complement(716077..717096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99217"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXS6"
FT                   /protein_id="ABM99217.1"
FT                   /translation="MNPNLAALLATVSDQPTIDELMRLMHVPTCFERCEPGVVTRAELA
FT                   QALNMALFADLLERVPTGRAYTRDVARDGGRVTFDHGALRTVRWPSCGALPPGEAAFTR
FT                   ILRPLGYRLNGTYALERLKMTGRSYAHLDAPDQIAQFFVSELHPERFSAAFQAAVTNVL
FT                   GTSADPLTPRAVATLAELERDASLPLADACALLPVLVRGFGRQHATPALADYDTLLAES
FT                   AEMAWIATEGNAFNHATDRVPDVDALAAAQRALGRPIKPAVEVSRSGRVRQTAFRADPV
FT                   ARTFVDASGALVEREVPGSFYEFITRDAVADAQTGRRALDLSFDAGNATGIFKMTAAA"
FT   gene            717271..718179
FT                   /locus_tag="BMA10229_0681"
FT   CDS_pept        717271..718179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0681"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98444"
FT                   /db_xref="GOA:A2RXS7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXS7"
FT                   /protein_id="ABM98444.1"
FT                   /translation="MRKGIPNLAALQVFEAAARHESFTRAADELALTQSAVSRQITSLE
FT                   ERLGVALFLRIKKRVVLTPHGRHYAALVRRNLERIERDTLELMAQRGIGATLELAVVPT
FT                   FASQWLIPRLPQFRALRPDITVNLSVRTGPFLFSDSTFDAAIYFGHALWPGTQGRLLFL
FT                   EGDMLPVCSPALLGANGRRITRDALLDLPLLHLSTRADAWRDWFRAQGLDNDLRAVRGP
FT                   RYELFTMLTAAAHAGMGVALMPALLVADELASGRLCAPLDLRLPSDAGYYLVAPDAAAD
FT                   SEPFVALAEWLGSVSPARPIS"
FT   gene            718240..718713
FT                   /locus_tag="BMA10229_0682"
FT   CDS_pept        718240..718713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0682"
FT                   /product="prevent-host-death family protein, putative"
FT                   /note="identified by match to protein family HMM TIGR01552"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99663"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXS8"
FT                   /protein_id="ABM99663.1"
FT                   /translation="MTIRIDDIVPLSIARARFSELADDARDGGEKIITKNGAAYVALID
FT                   ARRLDHYHRLERERAECACAALLHGGGGDGRDSDDRGNGGDAACDAARGGGRDSPDGRG
FT                   AAIAAGRETGAANATDATGAPGTMGAMAAPCDSDGADALAPDAPSAERRAGPD"
FT   gene            718676..718906
FT                   /locus_tag="BMA10229_0683"
FT   CDS_pept        718676..718906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0683"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00074"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXS9"
FT                   /protein_id="ABN00074.1"
FT                   /translation="MRRRPSGAPDPIETSAVWASTAEHGRRAWRIRPRASRTDERAASA
FT                   APPAPAPCTIRGAPASIRADAASSQARQPIR"
FT   gene            718955..720256
FT                   /locus_tag="BMA10229_0684"
FT   CDS_pept        718955..720256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0684"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99317"
FT                   /db_xref="GOA:A2RXT0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXT0"
FT                   /protein_id="ABM99317.1"
FT                   /translation="MQNYYEATVTRTPYPALAERIDTDVCIVGGGLAGLSTALGLVERG
FT                   VRDIALLDAQTVGFGASGRNGGFVFGGYSLDNADLLRTLGPESARALYRLTIDAVELIR
FT                   ARAARYGIDCELVDGGVILANWFDDPARLCAPRKLMKEAFGVDWEPLDERALRTRLKTD
FT                   RYRGGLFERNAFHFHPLKYVLGVAAAAAQGGARIHEHSAARAIRRDGAGFVVATDGGAV
FT                   RARRVVFAGGGYARGVYPRIERAVLPIATYVIATEPLGARLADAIACEAAVYDTRFAFD
FT                   YYRPLADTRILWGGRISVLERGPEAIARLLRRDLLRVYPQLRDAAVQFAWGGLMSYARH
FT                   KMPQIGRDAHGIWHAVGFGGHGMAPTTVAGEVLAAALAGERPVPDGFARFGLARTFGLA
FT                   GLAAAQLTYSAYEARDALAARRCARAGQPFRQRL"
FT   gene            720309..721007
FT                   /locus_tag="BMA10229_0685"
FT   CDS_pept        720309..721007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0685"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98809"
FT                   /db_xref="GOA:A2RXT1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXT1"
FT                   /protein_id="ABM98809.1"
FT                   /translation="MPPSDHAKMKQGSKAAAPDAEARRDEARRKYDPEQTKRNILDVAT
FT                   QEFSAMGLSGARVDAIAERTNTTKRMLYYYFDSKEGLYEAVLEKVYGDIRTLERELNVG
FT                   ELEPREGLSRLVEFTFDYHDRHRDFVRLVTIENIHGAKYIEQLKSFKNRNVSIIKTLEE
FT                   LLARGVESGVFRDDVDPFDLHLLISSFCFHRVANRYTFGTAFGRDPSSPRLRARHRAMI
FT                   TDTVLRYVAR"
FT   gene            complement(721279..721401)
FT                   /locus_tag="BMA10229_0686"
FT   CDS_pept        complement(721279..721401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0686"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98892"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXT2"
FT                   /protein_id="ABM98892.1"
FT                   /translation="MEAARRRASAMRRWLAMLRIRPGSREMRAARPRISRGRRG"
FT   gene            complement(721473..723278)
FT                   /locus_tag="BMA10229_0687"
FT   CDS_pept        complement(721473..723278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0687"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00489"
FT                   /db_xref="GOA:A2RXT3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXT3"
FT                   /protein_id="ABN00489.1"
FT                   /translation="MSVSVRSYLSPTLVLLAFDWPDAQRRDDFLGFAIKRTPGFWSADG
FT                   KTRAATSWLPNRLTFDGPAAHTQGDAPTDQAPIQKFMWWDARIDPPDRGRSFRYDVYPV
FT                   VGTPASLQVLEAEAGVCAITLPAHVEDGVGTWFNRAVVSSQAFAKQVRALHLADGGAPS
FT                   PDAALRLRMWLANDLQETFGLMLGADARRAVSAVYHLTDPLWAIPAFDAFGRAHGANAL
FT                   AIVYDAHETKRGSGEPPLPSPNQPAVERLTGVATLAPRDKTRIMHDKFIVAGDETGPAR
FT                   VLTGSANFTAEGIAEQANVLHTFESAALAELYNARARALASNPGIAETARLAPGWSEPV
FT                   EIGSARVRVSFSPEPRGVRTQIDTIVEAVRGAQHSVAFCLFMPTDAALRDACFAAGERG
FT                   LMMFGLVNAISARGAQQADADRRDGKTLDAARLANLELYHRSRSNRDVIDAAYFSPATV
FT                   PDGFETELRLFPGEPAPPYPPVVVHHKFVVIDAEGANPIVYSGSANMSANSEHYNDENL
FT                   LEIRDARIAGIYLAEFLRLYEHYRARALAIASRRGDGGGSTAGNAGAHGGLALQPDSRW
FT                   AKKYFVAGSPEEKARIALAAPVAAR"
FT   gene            complement(723295..723606)
FT                   /locus_tag="BMA10229_0688"
FT   CDS_pept        complement(723295..723606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0688"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00423"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXT4"
FT                   /protein_id="ABN00423.1"
FT                   /translation="MRMWRGAGRAAASRIIARMRAGAPGERLGRAAHAYSRASRIVQRD
FT                   TRHATRRRARPRRASCRLSAGVRGRRAAHSPRDTETSSERHTHGKRVLNTRRFDFVRR"
FT   gene            complement(723993..724751)
FT                   /locus_tag="BMA10229_0689"
FT   CDS_pept        complement(723993..724751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0689"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220; match to protein
FT                   family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99952"
FT                   /db_xref="GOA:A2RXT5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXT5"
FT                   /protein_id="ABM99952.1"
FT                   /translation="MLAEQRHRYILSELGRAGALSVAQLVNALNVSRETIRRDLNALAA
FT                   RGLVITTHGGALAADRHEPSVSERDASHADAKRVIGRRAAEFVPDGASVLLDSGSTVHA
FT                   VALALADRHRLSVYTNDWRIAGVLGRRNGNRVTLLGGELSDDEDATFGLDTIHQLAQYH
FT                   VDFAFVGAGGITPDGTLTDYSRVVAEVRGRMLAAAAAPIVVADHSKFGRVTPVRINGSD
FT                   AARFLVTERAPDKAMRRALTARGIELVVCG"
FT   gene            complement(724804..725367)
FT                   /locus_tag="BMA10229_0690"
FT   CDS_pept        complement(724804..725367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0690"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98590"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXT6"
FT                   /protein_id="ABM98590.1"
FT                   /translation="MGARRAAWARMRAAAGCRAGRPRTRRRRRARCGDGGRAIDGGNLS
FT                   REMGCDDRSERRWQPIGCGGGRRVRLSADPRSRGDEMRAADRRRWAADDTRHARPVARR
FT                   PMRDGASMFGCESTAGPRPAVGGRLPAVGFARPVTAGRWRTARVGWPVSDGRRWTNRRG
FT                   ATAREARRTAGDRRPARTARAVLQ"
FT   gene            complement(725370..726746)
FT                   /locus_tag="BMA10229_0691"
FT   CDS_pept        complement(725370..726746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0691"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00318"
FT                   /db_xref="GOA:A2RXT7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXT7"
FT                   /protein_id="ABN00318.1"
FT                   /translation="MNAGDIGMKETGMHQKTMGWVTVFLLFVVYGINYLDRVALSIVAP
FT                   MVRRDLGIDAAQMGVVFSTFFVGYALFNFIGGLASDRLGPKRVYVIAVGLWSIFCGMTA
FT                   ITVGFVSLLIVRLLFGMAEGPLCSAANKMVNNWLPRESAATAMGLLSAGSPLGGALAGP
FT                   IVGVLAAQLGWRPAFWIVCAIGLAWVLVWIATTSDRPAPQASAMPAGGSGAAAAAARAA
FT                   AAPRACASGGRTADAAHASETADVPPLRDYLKQPRILATGVAFFGYNYVLFFFLSWFPS
FT                   YLVQAHHLNIREMSVATVVPWLVGTIGLACGGVISDGIYKLTGNAMLSRRIVLVGCLLG
FT                   AGGCVAIAGSVRSTQSAIALMSVSLFFLYATGAIYWAIVQDIVAPGRVGAVSGCLHCMG
FT                   SLSGVIGPAVTGFIVERSGSFVSAFVLAGAIALAGAVLSALFLRNRACDARVLRESPLL
FT                   "
FT   gene            complement(727038..728507)
FT                   /locus_tag="BMA10229_0692"
FT   CDS_pept        complement(727038..728507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0692"
FT                   /product="mannitol dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF01232;
FT                   match to protein family HMM PF08125"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98954"
FT                   /db_xref="GOA:A2RXT8"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXT8"
FT                   /protein_id="ABM98954.1"
FT                   /translation="MPLLSSDHCRALPPEVSRPRYDRRALRTGIVHLGLGAFHRAHQAC
FT                   YTETLVERGDLRWGIAGVELRRRHTVERLAAQDHLYSVTERAGDAARTRVVGAVHRTLF
FT                   APQALATLLGLIADPSVSIVSLTVTEKGYYRRPGGGGLDLDDPAIRRDLAQPHAPSTTL
FT                   GVLAAGIRLRAAHAPLSVLSCDNMPSNGDTLRALLAQYAEQTDGALARRIRCDVAFPNT
FT                   MVDRIVPAATPESLDWVQSRIGVRDEAAIVCEPFAQWVFEDRFAGARPRWEDAGALVAA
FT                   DVRPYEKMKLRLLNGSHSAIAYAGQLRGRRTVSDAMADPLIDALARGVMTRELLATLDV
FT                   PAGYDVRAYCASLIERFRNPALAHRTAQIATDGTQKVPLRWLPALAESAAAGVERPFLE
FT                   RSLAMWLHYVEVARDESGRPLVLEDPGAQALAARLHGAPGATDAVRAALGLIASRDAAR
FT                   WPEALTARVGAHLETVRTRGTDALLRPLLDA"
FT   gene            728682..729407
FT                   /locus_tag="BMA10229_0693"
FT   CDS_pept        728682..729407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0693"
FT                   /product="transcriptional regulator, GntRfamily"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00439"
FT                   /db_xref="GOA:A2RXT9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXT9"
FT                   /protein_id="ABN00439.1"
FT                   /translation="MSDKEPAEDVVVAALNGFVLDAERSYTQQVHALLRNAIVRGALPP
FT                   RTALSEAVISATIDVSRTPVREALAQLADERLVQIYRKVGTLVAPISVSMLEEGRFARG
FT                   TLECANHVDLAQKITPAQLAELARLVDAQRDAVAAHDVDTFFTLDETMHGRMFEFAGRP
FT                   HVWAMLQPMKRKFDRVRWLLLDRVEDHARRALHEHEQILAHIAARNMALLGASVAVHVD
FT                   RVNAHLPEVRERAPHYFVD"
FT   gene            729429..730637
FT                   /locus_tag="BMA10229_0694"
FT   CDS_pept        729429..730637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0694"
FT                   /product="starvation sensing protein RspA"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99810"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034589"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXU0"
FT                   /protein_id="ABM99810.1"
FT                   /translation="MKIERLNIIVTCPGRNFVTVKIVTDEGVHGLGDATLNGRELAVRA
FT                   YLEDHVFPCLIGRDPRDIEDIWQYLYRGAYWRRGPVTMTAIAAIDMALWDIKSKLAGMP
FT                   VYQLLGGKSREGLMVYGHANGRDHDEAIDAAHRHIAAGYRAIRVQSGVPGLAKVYGVGK
FT                   TAGAYEPAEKGLPPEEPWDTALYLRHTPELFRKVRDALGDAPHLLHDAHHRLTPIEAAR
FT                   LGRDLEPYRLFWLEDATPAENQDAFRLIRSHTTTTLAVGEVFNSIWDCKDLIRDQLIDY
FT                   IRATIVHAGGITHVRRIADYAAMYQVRTGFHGATDLSPVCMAAAVNFGLWAPNFGIQEL
FT                   MPHTALTDEVFPHNYRFDDGYLVMDDVPGLGVDIDETLAANYPYERAYLPVARLRDGSM
FT                   WNW"
FT   gene            730686..731717
FT                   /locus_tag="BMA10229_0695"
FT   CDS_pept        730686..731717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0695"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00392"
FT                   /db_xref="GOA:A2RXU1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXU1"
FT                   /protein_id="ABN00392.1"
FT                   /translation="MLSVVVDQPHSMGVREMPTPEPAAGEVRVRVRYAGICGSDLHIFH
FT                   GKNPFVSYPRVIGHEFVGRIESVGAGVDASRIGEIVAVDPVISCGRCHACAIGRRNVCR
FT                   SLTVLGVHRDGGFSEYACVPAANAHRIAPEIADTCAAIVEPFAVAANATARTGVLPSDV
FT                   ALIYGAGTVGLTLLQVLKHVYGIRAFIADRLDERLALARKCGAAADEVIHAATETVPDA
FT                   LERRGVDGGPTLIFDAVCHPSILEEAVRLAAPAARIGVLGFSSEPSSIVQAELTKKELT
FT                   LCASRLNCAMFPQVIEWIADGRVHPEHIVTHTLDFRDVARAFELAERNPRESCKILLDF
FT                   AAH"
FT   gene            732657..732842
FT                   /locus_tag="BMA10229_0696"
FT   CDS_pept        732657..732842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0696"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98975"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXU2"
FT                   /protein_id="ABM98975.1"
FT                   /translation="MYRKGIVLEIQFPPQRLNDAAGDPYWIDLTLDEARRLHRQLSARL
FT                   ATEAGANQPLDTFSLD"
FT   gene            732928..733833
FT                   /pseudo
FT                   /locus_tag="BMA10229_0697"
FT                   /note="putative membrane protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00892"
FT   gene            734278..735132
FT                   /gene="nadE_2"
FT                   /locus_tag="BMA10229_0698"
FT   CDS_pept        734278..735132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE_2"
FT                   /locus_tag="BMA10229_0698"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="identified by similarity to SP:Q81RP3; match to
FT                   protein family HMM PF02540; match to protein family HMM
FT                   TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99595"
FT                   /db_xref="GOA:A2RXU4"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2RXU4"
FT                   /protein_id="ABM99595.1"
FT                   /translation="MSRPDQAARRRAIAAELHVSPTFDARDEAERRIGFVADYLRTAGL
FT                   RACVLGISGGIDSSTAGRLAQLAVERLRASGYDARFVAMRLPYGAQHDEADARRALAFV
FT                   RADETLTVDVKPAADAMLAALAAGGLAYLDHAQQDFVLGNIKARERMIAQYAVAGARNG
FT                   VVIGTDHAAESVMGFFTKFGDGGADVLPLAGLTKRRVRALARMLGADEPLVLKTPTADL
FT                   ETLRPQRPDEHAYGITYEQIDDFLEGKPMDDAVAETVLRFYDATHHKRALPYTMFDWPG
FT                   HPA"
FT   gene            complement(735387..736403)
FT                   /locus_tag="BMA10229_0699"
FT   CDS_pept        complement(735387..736403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0699"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00330"
FT                   /db_xref="GOA:A2RXU5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXU5"
FT                   /protein_id="ABN00330.1"
FT                   /translation="MPTTVSAPETLSETRTQTRELLLQTALSMLEQGWFPSITELANAS
FT                   GVSRATAYRYFPSQAALVSTVVDESLGPVLQWQPTSTSVEARVNELLDFAYPRMEQHEG
FT                   ALRAALQVALHQWANERARRAQDEPKYRRGNRRRLLTLAVEPMVRAGVDPAVAERLAQA
FT                   LSLLYGTEAMVVLKDIWGLDFRQFMNVIKWMSSALVRATLAQASGAAGAGGGAEAGAGG
FT                   AGVAEGVAQGAAQGTAEGTAAAGGGAAREQVARDAGAAQHASPDGDPAAAGRAAASDSP
FT                   AAGHGDAPAAGAADAADPAGDAAGERPEDRASASPTSSITSSTPSASPASGDDGRDA"
FT   gene            736515..737732
FT                   /locus_tag="BMA10229_0700"
FT   CDS_pept        736515..737732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0700"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q8ZAG3; match to
FT                   protein family HMM PF06792"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98660"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXU6"
FT                   /protein_id="ABM98660.1"
FT                   /translation="MVPHRTRIYVAATVDTKGAEAHFVKDRIADAGLAAVVVDLSTRVP
FT                   GRAADIGADAVAAHNPDGAAAVFCGDRGRAIAAMAVAFEHYIKSRDDVAALIGIGGSGG
FT                   TALVTPAMQALPIGMPKLMISTMASGDVSAYIGSSDIAMLYSVADIAGLNRISRQVLAN
FT                   GAHMIAGAVRDMQPPHADLKPALGLTMFGVTTPCIQAVTSRLDARFDCIVFHATGKGGP
FT                   AMEKLADSGLLDGVLDLTTTEVCDLLMGGVLACGADRFDLIARSRVPYVGSCGALDMVN
FT                   FGHIDTVPPRYAQRLLYKHNPQVTLMRTTPDENRRIGEWIGAKLNACDGPVRFLIPEGG
FT                   VSALDAPGQAFWNPQADEALFDALEATVVQTERRRLVRVPAHINDARFADAAVEHFLSL
FT                   HAAHRN"
FT   gene            737735..738577
FT                   /locus_tag="BMA10229_0701"
FT   CDS_pept        737735..738577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0701"
FT                   /product="TIM-barrel signal transduction protein"
FT                   /note="identified by match to protein family HMM PF09370"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98807"
FT                   /db_xref="GOA:A2RXU7"
FT                   /db_xref="InterPro:IPR009215"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXU7"
FT                   /protein_id="ABM98807.2"
FT                   /translation="MKRLSRVEILEKLRATIARGEPIVGGGAGTGLSAKCEEAGGIDLI
FT                   VIYNSGRYRMAGRGSLAGLLAYGNANEIVVDMAREVLPVVKSTPVLAGVNGTDPFCNFD
FT                   AFLDELTRLGFSGVQNFPTVGLIDGNFRANLEETGMGYALEVDMIRLAHRKGLLTTPYV
FT                   FSEADAIAMTEAGADIVVAHLGLTTGGTIGANTARTLADCVPLVRSWADAAKSVRDDVI
FT                   VLCHGGPIASPEDAAYILRACPQCHGFYGASSMERLPAETALTDMTRRFKEIDRHAAS"
FT   gene            738623..739063
FT                   /locus_tag="BMA10229_0702"
FT   CDS_pept        738623..739063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0702"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00429"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXU8"
FT                   /protein_id="ABN00429.1"
FT                   /translation="MNHTSFASSVIDAPIERVWAFFRDFDGLPAFHPAIVESRLEPGPD
FT                   AYTVGAVRYLTLADGYVREKLLKLDEPNHALEYAIVESTMPVRDYVAGVQLVPVTDSGK
FT                   TFAQWWANFTTQGVELQPVAESISEHVFAAGFRALADKLRAR"
FT   gene            739471..741033
FT                   /gene="nirK"
FT                   /locus_tag="BMA10229_0703"
FT   CDS_pept        739471..741033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirK"
FT                   /locus_tag="BMA10229_0703"
FT                   /product="nitrite reductase, copper-containing"
FT                   /EC_number="1.7.2.1"
FT                   /note="identified by similarity to SP:Q02219; match to
FT                   protein family HMM PF00034; match to protein family HMM
FT                   PF00127; match to protein family HMM PF00394; match to
FT                   protein family HMM PF07731; match to protein family HMM
FT                   PF07732; match to protein family HMM TIGR02376"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00055"
FT                   /db_xref="GOA:A2RXU9"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXU9"
FT                   /protein_id="ABN00055.1"
FT                   /translation="MKDLQSIRGQLRATFLSVLLGAVIAASAQAGAATGKVPGDFGPPQ
FT                   GEPLHATLVSPPNVPPPITRRYPAKVIVDLEVVEKVLPIADGVNYTFWTFGGAVPGNFI
FT                   RVRQGDTVEFHLKNRPDSKMPHNIDLHAVTGPGGGATSSFTAPGHESRFTFKALNEGLF
FT                   VYHCATAPVGMHVANGMYGLILVEPPEGLPKVDREYYVMQGDFYTNGKYREKGLQSFDM
FT                   DKAIDERPTYVVFNGAEGALTGERAMRARTDETVRLFVGNGGPNLVSSFHVIGAVFDKV
FT                   RADGSNVTQNDVQTTLIPAGGAATIEFHTRVPGNYTFVDHSIFRAFNKGALAILKVDGP
FT                   ENKAIYSGKELDAPYSGDAVTAAAGSGPAGAPGAAAGVKGGVKGGASPVRTSAAASAAP
FT                   LSLPAQVKAGGTVFASTCAVCHQSAGTGLPGVFPPLAGSDFLAANPKRAIGILLHGLNG
FT                   KVTVNGHDYDSAMPPMAQLTDDEVANVLTYVLNSWNNPGGRISTDEVSKARAKAPAVAE
FT                   AAH"
FT   gene            741058..741894
FT                   /locus_tag="BMA10229_0704"
FT   CDS_pept        741058..741894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0704"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03781"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00527"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXV0"
FT                   /protein_id="ABN00527.1"
FT                   /translation="MHEPSSRHACRAASAVRLARVAIVALTLAFAAAGAHAARFVRLPG
FT                   GDFESALPQDVPSRSTPVHIDAFELQDTPVTVRAFAGFLRAHPEWRRDRVAHVFAGPAY
FT                   LADWADPLHPASPTPPDAPVTGVSWFAARAYCASEGARLPTWLEWEYAAAADATRPDAR
FT                   NDPLWRRQILSWYEQPAARVLPGVGGAPNVYGLRNLHGLIWEWVDDFNALFISGDSRTQ
FT                   GDPDQQRFCGAGAISIVRRDSYAVLMRVALLSSLTGADSTGSLGFRCARSISGDRP"
FT   gene            741891..742505
FT                   /locus_tag="BMA10229_0705"
FT   CDS_pept        741891..742505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0705"
FT                   /product="SCO1/SenC family protein"
FT                   /note="identified by match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99582"
FT                   /db_xref="GOA:A2RXV1"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXV1"
FT                   /protein_id="ABM99582.1"
FT                   /translation="MKLDYFTARGALALLAAACVATAAHGADAPAAAATPPAATATDSL
FT                   YQANATLTDQDGKTFRLADLRGTPTLVSMFYTSCKMVCPMLFETIGLTLDAGGEPARKR
FT                   IKVVAVTVDPDRDSVAVLRKTANAHGLDARWRLVRTDRDSTRTVAALLGIQYRKLASGE
FT                   FNHSSTIVLLDADGRIVAHTNTLGETDPAFVDAMRKQLAAQ"
FT   gene            complement(743151..743276)
FT                   /locus_tag="BMA10229_0706"
FT   CDS_pept        complement(743151..743276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0706"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99231"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXV2"
FT                   /protein_id="ABM99231.1"
FT                   /translation="MGRGVRIDAANGCERAREAKRVGAEASRVVLNQSRQFREGR"
FT   gene            743544..744569
FT                   /locus_tag="BMA10229_0707"
FT   CDS_pept        743544..744569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0707"
FT                   /product="N-acetylmuramoyl-L-alanine amidase domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01471;
FT                   match to protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99804"
FT                   /db_xref="GOA:A2RXV3"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXV3"
FT                   /protein_id="ABM99804.1"
FT                   /translation="MSQSRQTRRDDIANAKRRRFIARASACTAGALASPYAAHAARAAG
FT                   GKPRDASGAQDVAIDASIASPNQDSRVRTLVLHYTAQTLARSVALLTDPARPVSAHYLV
FT                   PDAADAGTLFRVYALVPETNRAWHAGVSYWQGERLLNASSIGVEIVNTGFPDADENAPL
FT                   MRRRWAPFPDAQMAVVGRLAADIAARHEIPPQKVVGHSDIAPGRKLDPGPLFPWRMLHE
FT                   QYGVGAWPDAIAVEYYRACRPFRGDIAELQAKLLAYGYDTPQTGVLDLRTTDVIAAFQM
FT                   HFRPARYDGVPDAETVAILDALLDKYIERDRQRLRDGQAALPEKDDRAPAAGSAAAKPL
FT                   A"
FT   gene            744857..746077
FT                   /locus_tag="BMA10229_0708"
FT   CDS_pept        744857..746077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0708"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99059"
FT                   /db_xref="GOA:A2RXV4"
FT                   /db_xref="InterPro:IPR030929"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXV4"
FT                   /protein_id="ABM99059.1"
FT                   /translation="MPAAPTGKHAGSPAHIQAPTHARGFAPPADIPTWSGTEGVRFDFN
FT                   DGCRVLLPDGDWTVRLSDMHTDTPLFDAQIGAGIVTSTRRHFVPFQIEIDSGEKRVFKH
FT                   QFDAHGKPVLIQFEAGRLGEALGWFGYAVKFQRQHRCRLTCAMPAPLIALLKPGYPDIE
FT                   FVTPELVKPECYYATYRLGRFTGDEARAYQPSAPQLVGVHRSAAYMLGVDPREAPPRIE
FT                   LADDSRPLAGRYVCIAAQSALRCARWERPGGWRQVQRFLTAAGYRIVCVDSPSPDVADE
FT                   SSALAQVAHVLPPDTPWTERARWLRHAACLIGVPGDLAWLAWAVGAPVVLISGFTHPVS
FT                   EFDTPYRVINFHACNSCWNDASANFDDADASACPRHAGTLRQFECARLVSAEQIKHAIR
FT                   SIPAIAS"
FT   gene            746106..747245
FT                   /gene="bimA"
FT                   /locus_tag="BMA10229_0710"
FT   CDS_pept        746106..747245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bimA"
FT                   /locus_tag="BMA10229_0710"
FT                   /product="intracellular motility protein A"
FT                   /note="identified by match to protein family HMM PF05658;
FT                   match to protein family HMM PF05662"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99269"
FT                   /db_xref="GOA:A2RXV6"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXV6"
FT                   /protein_id="ABM99269.2"
FT                   /translation="MVLYIRMKYHRFPRSHAQQDTGRAASTVPFQRFAHLLCSSIAPLA
FT                   LGFSTDALAIGQAESTAFNAVIDQIKKGDFKLKPVGDRTLPNKVPPPPPPPPPPPPPPP
FT                   PPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPPTTTTPTPSMHPIQPTQLPSI
FT                   PNATPTSGSATNVTINFNSTGASAMGTNSIALDFHARAKDSDSLASGRLAHASGPRSTA
FT                   IGAEANASGQNTVALGAGSIADRNNTVSVGRHGDERQIVHVAAGTQATDAVNVGQLNLA
FT                   MSNANAYTNQRIGDLQQSITDTARDAYSGVAAATALTMIPDVDRDKRVSIGVGGAVYKG
FT                   HRAVALGGTARINENLKVRAGVAMSAGGNAVGIGMSWQW"
FT   gene            747325..747702
FT                   /locus_tag="BMA10229_0711"
FT   CDS_pept        747325..747702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0711"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98775"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXV7"
FT                   /protein_id="ABM98775.1"
FT                   /translation="MKLPILPPALAALALSIASLSGCTRDADPAPAAHVDAGAPASQGR
FT                   ASYMDEFNESIRSMSGEHESGVHINRGWGVFNTIKAAPAAEPAASACAASSDASIVGDA
FT                   GGARRAHAHRPNPAAGDSRMS"
FT   gene            complement(748031..749947)
FT                   /locus_tag="BMA10229_0712"
FT   CDS_pept        complement(748031..749947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0712"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06812;
FT                   match to protein family HMM TIGR03362"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00299"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXV8"
FT                   /protein_id="ABN00299.1"
FT                   /translation="MGMSERRPPGGAAARARMPIDVQALAVLGRTDIDSAMPAGADVRA
FT                   DARFDALHAELAKLASPGASGQVDWRAATHLAAELLRERGKDLLVGCYLAGALLQTGGA
FT                   AGLRCGLEIVGDLVERHWDAMSPPVSRMRARRGALQWLVDRVDAMHDAGAAACGGACSA
FT                   ELVAQLRAAARRIDALLAERDDDAPTMRAVHAFAERLPVEVVEVVEVADEADVAEAAEA
FT                   AEAAEAAEAAEAADVADVADVADVADVADVADVAETAEADAHGSTGGPAAEIAIAAAEQ
FT                   ALIDPAGRAAPSAGTDTNANADAARQPARLDEAAGRDRALADALAQLHCVATAFAQADW
FT                   ADARGFRLRRVACWSSVCALPETDAENGRTRIAAPSASIVGAAKNIDEDGEPVAAVRFA
FT                   EAHAQAFPLWLDLQRIAARALARAGGDGADARREVETAVRALLARLPGLDALTFADGTP
FT                   FADDATRAWLGELGAPVVAADAVSPSSLPLSPRPSPPERSSPMAGEPARAPGDACGASA
FT                   DDAVDRACAFAASGQLDLALHAIQHAIDRATSAEQRLRARVRLCELARDHWPHEVPEAF
FT                   ARGVIEPIRRHDLLAWNPELALDGLSAAYALLIRRDRESAHARTVLDEIASVDAARAMR
FT                   LSM"
FT   gene            complement(749938..750675)
FT                   /gene="virG"
FT                   /locus_tag="BMA10229_0713"
FT   CDS_pept        complement(749938..750675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virG"
FT                   /locus_tag="BMA10229_0713"
FT                   /product="DNA-binding response regulator VirG"
FT                   /note="identified by similarity to SP:P07545; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99704"
FT                   /db_xref="GOA:A2RXV9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXV9"
FT                   /protein_id="ABM99704.1"
FT                   /translation="MTNVTRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAAE
FT                   SVGRREYEMVLLDLGLPDGDGIDVLLRWRETQRFPLICVTGRSEEADRIMGLEFGADDY
FT                   VVKPYSLREVLARMRALWRRAEPSTTPVRRGRHPRAYRFDGWTLNMNTRRLLTRDAQEI
FT                   PLTVGEFNLLAFFLGSPSRVVTRAQLLECTRAFDDVFDRAVDVQIWRLRKKIEKDPKHP
FT                   ELIRTERGVGYYFDAKEVETLWG"
FT   gene            complement(750672..752519)
FT                   /locus_tag="BMA10229_0714"
FT   CDS_pept        complement(750672..752519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0714"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF05231"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98515"
FT                   /db_xref="GOA:A2RXW0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXW0"
FT                   /protein_id="ABM98515.1"
FT                   /translation="MHGNSIDAGPPARARPARITRTARTAPRRDDRAFAPGGALNAAGL
FT                   LLLLLFYANHLLSRPGACTSLNHTLSAVVWPAPVLGIALLLHCRRPLAWWLGAGSLFAT
FT                   LLAAGSLDWVPWHVDALFAAVNVVEAIAGAWLARRYLIAGGGVDTLRGFAMFVLLLPLG
FT                   MAAMHATLAAAILSVWMNDREWLSEWSRAYAANALALLVLLPALLTWNARACGAAWSRS
FT                   RNQLPVLATFGSLCFASIWGYQAEVARALLALSLSWAALEGGLVLASQLNALSAIALIA
FT                   MTLGGRGPYAWHHDGHGVWALQVDLIGVAILSMCIAIATGERRRLARQIERSRRFESLG
FT                   FFAGGIVHDFSNVLTTIDCHAEYASERLASGARADDSIDEIHRAVERGRDLAAQILLAA
FT                   RRGEPVLTRVSVDEVVDEALAATRAAAWRGVEIVRCGDGARDGARRGDVRHVVFADRSQ
FT                   LARAVMNLVGNAVRAARATVVVRVGVNGGVNGGASDGASRGANDGGAPAARAFDVAIGE
FT                   AAMPGGVWIEVSDDGEGIDVEPLDRIFEPFYSNRSGAPGTGLGLAIVAGAALAHRGQIA
FT                   VATDRGAGSCFRLTLPAAWGTGAPGAMDAGAPGAVQERT"
FT   gene            752779..753273
FT                   /locus_tag="BMA10229_0715"
FT   CDS_pept        752779..753273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0715"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05591;
FT                   match to protein family HMM TIGR03358"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99218"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXW1"
FT                   /protein_id="ABM99218.1"
FT                   /translation="MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAAD
FT                   KPPLEELSPVNVDKDDFNDVMRAQNLQLALSVPNLLDDQAGEDDRLSVTLGFDSVHDFS
FT                   PDAIVEKVPELKQLIALRDALKALKSPIGNIPGFRRRIQEIVADKGARKQLLDELGLDE
FT                   Q"
FT   gene            753270..754796
FT                   /locus_tag="BMA10229_0716"
FT   CDS_pept        753270..754796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0716"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05943;
FT                   match to protein family HMM TIGR03355"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00606"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXW2"
FT                   /protein_id="ABN00606.1"
FT                   /translation="MNRDTEQTTMEGEHLQSPKHDDAPDATPPESPASLLDELIEAARV
FT                   KRDEDAYPITRHGIQAFVAHLAKPKRPIETVSQATIDDMIAEIDRKLCRQIDAILHDPA
FT                   FQQLESTWRSLKFLVDRTDFRENVKVQILDVGKTALFDDFEDSPDITKSGLYQKVYTAE
FT                   YGQFGGQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAGPAFFGIDSFGKL
FT                   PNVKDLASLFEGPQYAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEERV
FT                   DGGDAHFLWGNAAFAFATRLTASFADYRWCANVIGPKGGGTVTDLPLYAYESMGEIQNK
FT                   IPTDVLISERREFELAEQGFIALTMRKNSDNAAFFSANSTQKPKFFGISKEGKEAELNY
FT                   RLSTQLPYIFVVNRLAHYIKVIQRENIGSWKERGDLEQELNQWIRQYVVDMDNPSQSVR
FT                   SRRPLRQAQIVVSDVEGEPGWYRVDMKVRPHFKYMGAFFTLSLVGKLEKR"
FT   gene            755016..755525
FT                   /locus_tag="BMA10229_0717"
FT   CDS_pept        755016..755525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0717"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03344"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00160"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXW3"
FT                   /protein_id="ABN00160.1"
FT                   /translation="MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARL
FT                   QEGLTPAAAARGTITLTKEMDRSSPQFLQALGKREMMEEFEITIHRPKTDTTGGDLTEL
FT                   LFTYKFEKVLITHMDQYSPTPHKDDSNGIKEGLLGYIEEIKFAYSGYSLEHAESGIAGA
FT                   ANWTNG"
FT   gene            755518..755979
FT                   /locus_tag="BMA10229_0718"
FT   CDS_pept        755518..755979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0718"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04965;
FT                   match to protein family HMM TIGR03357"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00309"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXW4"
FT                   /protein_id="ABN00309.1"
FT                   /translation="MADRESSRAGEPRTLERRLLERIANREAGGEHDRPPPADVLAHSI
FT                   IDHLRRILNTRQGHVPIDPAFGVPDFTNLAGGFAQGSAREIEAQIERVITCYEPRLKAP
FT                   RVSLAERGPDAATLRFSLDARLVIDAHDVPARFLTTVTGNGKIDIRTIS"
FT   gene            756016..757758
FT                   /locus_tag="BMA10229_0719"
FT   CDS_pept        756016..757758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0719"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05947;
FT                   match to protein family HMM TIGR03359"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99685"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXW5"
FT                   /protein_id="ABM99685.1"
FT                   /translation="MATTTPNRYYEDELVRLRELAAEFARAHPLLAPMLGAPSGDPDVE
FT                   RLLEGVAFLTGLARQKLDEGLPELVQALANLLFPHSLRPVPAATLIAFEPRGALRERAV
FT                   IAAGTEIESVPVDGTACRFRTCGELDIEPIALAGCRFVPPAHGGPALRLDFEMLGLDAS
FT                   EWDATRIRLFIGGERLHASRLFALLMQHVVAVEIAGGPPELPGPRCALGARALRPAGFD
FT                   DALLPCPERAFPGFRLLHEYFAFAEKFLFVELGGLERWRAARAGAQFSVWLALDSAPDW
FT                   LPGIDRDSFRLNVAAALNLFAHEAVPIQHEHRATDYRLQPEGDTSGHYRIYSVDRVIGY
FT                   RPGHAVDRHYVPFGVAGDDANAASYRLIRRAALDGHGQDLHLALAYPPGEALATETLSI
FT                   GLSCTNGALPARLKIGDVCRATDSSPERFTFANIAPVSPPLDPPLGEPLLWRTISHLAL
FT                   NFLSLGDADHLKRMLALHAFGERGDDARAQADRRRIDGIESVDVRAETRIIGERMLSGQ
FT                   RVALRCSAHAFGGAGELYLFGCVLERFLAEYAAINTYTRVEIDASPDGVRFAWPPRMGA
FT                   QCLL"
FT   gene            757746..758768
FT                   /locus_tag="BMA10229_0720"
FT   CDS_pept        757746..758768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0720"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06996;
FT                   match to protein family HMM TIGR03347"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99371"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXW6"
FT                   /protein_id="ABM99371.1"
FT                   /translation="MPALEPVLLGEAKHFAYFQAIRLLRRIARERRGDAAGRPDAPLPI
FT                   HTRPNLSLSFPDTDVERIDKADDGGYRVVANFFGLYGVSSPLPTFYTEDLIDEAFRGRH
FT                   AARGFLDVLHRALYPLLFDAWLKHRLALRIVEERDEHALRPLYALAGVDARIARDAGLH
FT                   EHALLRYVGLLSQRPRSAAGLRALLADAFAPATVDIEPCVSQWLPIPDDQRTRVGTRAR
FT                   RLGADARVGARMRDDGARLRIVLGDVPGPLFRALMPGGDAFARLRLLVRLYLTQPFAVD
FT                   VVVRVRARDAAPARCGRRAWSRVGLDAWLGGPSAERAASPKFRLPTSLFDQARPHHAAG
FT                   "
FT   gene            758755..761838
FT                   /locus_tag="BMA10229_0721"
FT   CDS_pept        758755..761838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0721"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02861; match to protein
FT                   family HMM PF07724; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR03345"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98752"
FT                   /db_xref="GOA:A2RXW7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXW7"
FT                   /protein_id="ABM98752.1"
FT                   /translation="MLLVDLKPLIEQLNPYCRNALESAVGACVARRHDDVAVEHLLARL
FT                   CDEPSADVALLLRACGADAARLRRQADAALDARPAGDGGRPAFAPSLLALLQDAWLIAS
FT                   LELGDTHIRSAAVLAAAVARAARQPSPGGDDVLQSLRKDALVARFASGACARSIESRAS
FT                   GALDAAPGEASDTRDASSAIARYCEDFTAKARAGGIDPVFGRDAEIRQIVDILARRRKN
FT                   NPVCVGEPGVGKTAVVEGLALRIAEGDVPATLRGATLLGLDLGMLQAGASVKGEFEQRL
FT                   KRVIAEIRASQTPVVLFIDEAHTLIGAGGAAGASDAANLLKPALARGELRTIAATTWSE
FT                   YKKYFEKDAALARRFQPVKLDSPDVATSVMILRGLKERYQDAHGVTIRDDALVAAAELS
FT                   ARYITGRQLPDKAIDLLDTACARVKVRQQTKPAALEDAQRAIQALERERRALRDELAER
FT                   CAPDTPRVADIDRELAALSARAGALRDAWAAQRDAAQALVDARRACRAAADATAATDAA
FT                   GTTGTAHAGELADSADVSDIADVAKMADAADAAPADAETGSSARDADARMPAGTCARVA
FT                   PNPDARARPPLRAPHADARERAARALAEATRRFEHAQRDTPLVRIDVDPDAIADVVADW
FT                   TGIAAGKLRRDRANVMLRLADTLRRRIRGQDHAIEQISEAVKAGAAGVHDPRRPLGVFL
FT                   LAGPSGTGKTETALAVADALFGDERSIVVVNMSEFQERHDVSRLIGSPPGYVGYGEGGM
FT                   LTEAVRQRPYSVVLLDEVEKAHPDVLNLFYQVFDKGSLSDGEGKEVDFANTVIFLTSNL
FT                   GADIIADIAARGARPDPDAMRAAVRPALSRHFKPALLARMTEIPYAPLAPDTLADIARL
FT                   KLERIAARVAAQHATRIVYDDAVVAHVAARCTEVESGARNVDFILQRHVLPALAQHVLV
FT                   CAGNAAPMPAIRVAIDAGGRFVVSNDAPADSDARDRSDASDAIDAVDAVDAVDAVDAVD
FT                   AVDAPNAPNAPNAPNAPNAPNAPNAPNAPNAPNAPNAR"
FT   gene            761865..764888
FT                   /pseudo
FT                   /locus_tag="BMA10229_0722"
FT                   /note="Rhs element Vgr protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF04524; match to
FT                   protein family HMM TIGR01646; match to protein family HMM
FT                   TIGR03361"
FT   gene            764914..768638
FT                   /pseudo
FT                   /locus_tag="BMA10229_0723"
FT                   /note="pentapeptide repeat family protein; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00805"
FT   gene            768635..769396
FT                   /gene="tssH"
FT                   /locus_tag="BMA10229_0725"
FT   CDS_pept        768635..769396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssH"
FT                   /locus_tag="BMA10229_0725"
FT                   /product="type VI secretion system protein TssH"
FT                   /note="identified by similarity to GB:CAE31305.1"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00170"
FT                   /db_xref="InterPro:IPR021927"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXX1"
FT                   /protein_id="ABN00170.2"
FT                   /translation="MIHGSRTSMTPPPSSAPLDAAAPLPPVHARHARRADEAGAALRAA
FT                   RVTGRVGDWLLLDDHAGRARRADGCLLAPDIGDSVLIWTSAPAGALADDDDAAHAPSAY
FT                   VLAVLARAGAPQAALALPGGVVLETGADGLRIDAPHIALAARERIDARAPRVDVSAHRA
FT                   HVRAAHLDACARSIDGRAHDVRLVARRFTSTIGRALHTLGDCLRRVCGVDELHAARTRW
FT                   RVDERAHLHARDVTLLADRHVGIDGERIDLG"
FT   gene            769425..769817
FT                   /gene="tssI"
FT                   /locus_tag="BMA10229_0726"
FT   CDS_pept        769425..769817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssI"
FT                   /locus_tag="BMA10229_0726"
FT                   /product="type VI secretion protein TssI"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00453"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXX2"
FT                   /protein_id="ABN00453.1"
FT                   /translation="MFAVTTASGLCLSPADVCKTPTPGGPVPVPYPNTGLPMMAASITT
FT                   KVLVCGMPALTKKSTIPMTNGDQPGSAGGVMSAKIMGKVEFTAGSAKVKFEGGAAVRLT
FT                   TPTKHNEGNATGAVLQPSQQKVMVMS"
FT   gene            769827..770624
FT                   /gene="tssJ"
FT                   /locus_tag="BMA10229_0727"
FT   CDS_pept        769827..770624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssJ"
FT                   /locus_tag="BMA10229_0727"
FT                   /product="type VI secretion lipoprotein TssJ"
FT                   /note="identified by similarity to GB:AAR33760.1; match to
FT                   protein family HMM TIGR03352"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99825"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXX3"
FT                   /protein_id="ABM99825.1"
FT                   /translation="MNARHIAPPAATRARRPMQPGRPSWPSRTYRACAARTCAAVLVAL
FT                   AALAGCAARVTEEQARADVRWDYAPDALRIDIDASARLNEYLNAPHTLLLAVFQSADAK
FT                   AFRQLADDPDRLRMTLAAGGPAADFIQTTRYVVAPGQHVALSIDRAQQARYVGIVAGYY
FT                   DADGPRAARLFEVPLRIDKRGWFSSTYRAAPRTLELKLRLGAQSITDAREAPLNLPPPG
FT                   ARAWTALDSGAKTLALPSADANDGGSGKRDKRGNAAARAPRKQ"
FT   gene            770657..772054
FT                   /gene="tssK"
FT                   /locus_tag="BMA10229_0728"
FT   CDS_pept        770657..772054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssK"
FT                   /locus_tag="BMA10229_0728"
FT                   /product="type VI secretion protein TssK"
FT                   /note="identified by similarity to GB:AAR33761.1; match to
FT                   protein family HMM PF05936; match to protein family HMM
FT                   TIGR03353"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98625"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXX4"
FT                   /protein_id="ABM98625.2"
FT                   /translation="MDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGAL
FT                   SLAQAAIDRRVVEIRSARLLFADRSYVEYPGNAVVAARAFDPAWLDEGRALVAHVALRR
FT                   LARGANNVTVAAAPDALPDAPTRYATLPSAEEVADLHSDHPGAPVRTLKHVLKIVFEHE
FT                   LDALAAHETIPIARIVRDGERLRLDDDFAPPCYALSGSRTLLERVRCIRDELAGRARQL
FT                   QQYKNPREMQRAEFDASYAAFLLALRSLNRFGPLLFHLAECDGQHPWTVYGVLRQLVGE
FT                   LSVFSECFDMLGETPDARGGLPPYDHRDLGGCFSRAHALIGHLLDEIAVGPDCVATFEP
FT                   DGPQQPAQRSAQLPPDVFADRHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTAL
FT                   ALPGVELTRLPGPPPRLPRRGDARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAEL
FT                   VAVRHTQ"
FT   gene            772051..772716
FT                   /locus_tag="BMA10229_0729"
FT   CDS_pept        772051..772716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0729"
FT                   /product="type IV/VI secretion system protein, DotU family"
FT                   /note="identified by match to protein family HMM TIGR03349"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00502"
FT                   /db_xref="GOA:A2RXX5"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXX5"
FT                   /protein_id="ABN00502.1"
FT                   /translation="MKLTDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAAC
FT                   AGAPAADVDDALFAVCAWIDEALLNSGWDDADRWTLRLLQKRYFDTSHAGVVFFERLGT
FT                   LDGARASVLEVYLLCLRLGFRGRYGYDGGDGPLDAIRQRALDALSAHAPPCAAGEPPFP
FT                   AAYAHAGPHAAAAKARTRRRIARAGLSVGLPLAILLSLYLIYHVVIVRMVDAVYPRLQ"
FT   gene            772728..776696
FT                   /locus_tag="BMA10229_0730"
FT   CDS_pept        772728..776696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98987"
FT                   /db_xref="GOA:A2RXX6"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXX6"
FT                   /protein_id="ABM98987.1"
FT                   /translation="MMIARIAALLALAALSWASALYFDWPLWCAPAVFCAALAGWLLCR
FT                   VARRALRAVRARAQLARLDASERLPAADAPELRVAARWRTALAALGRAQPAPRLRGRPR
FT                   DALPWYLVIGPEGAGKTTALARARLASPLRHARDDAAIAPTEDCDWWCFDDAVVLDLAG
FT                   RFAAPGATDDDRRAWHALLEQLGRARARRGVNGVVVAIDAPRLIEASRDALTIEGSAIR
FT                   ERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDADAFVAR
FT                   ALDSLDARLGALRVALAARGEPPSPRALMLPHELACLRPALEAFARAAFGPNVYQETPY
FT                   LRGLLFASGRQAGGAPSLTLPDWLDAAPARTPGDAGLFLHDVFARVLPGERDAWLPVER
FT                   PSRSRLVLRRLALAAWLLASVAAGLLMSASFVGDMRTVELVRRDYPAHPRFTGEFAHDT
FT                   ATLARIGRVIADVERRDERRLVRPLAGATPVGRLEAELKRRYVAHYRRSIEPTADRLFF
FT                   GKPDGASDMRAANDARLAARIRNLVRYVNLMQARRRGADRETLAQMPAPAVARATDGGG
FT                   ARGVDSVGVSGVSGVSGVSGVSGGVGGVGGARAAEGAGRAVRASGGRRAGDARAARGMR
FT                   GAAGNAGAGAEIAPAADGVRDRDEGFARVSALAVDLIAWSAPDDRALAARVAAAQAELE
FT                   RLAYRDPDGAWLLALPDASMPRDVTLADFWPAAEPRTLPDAQPAALRDVRVPAALTAAH
FT                   RPAIDAFLDEMAQAVANRPKFAFHRDAFDTWYRARRIDAWRDFVARFPQGEQGLTTQAQ
FT                   WRAVIDRIADHRDPFAALLARVDREFESERDDTLPPWLRFVRTTSHMLAPAMLAPARLP
FT                   AASGGLGAALGSISRSGGRALREALGGAPEQGRLTLERDAALRDALVDYERRVAALAAD
FT                   ALAGPGAAYRLAADFHGFGVDPSVQASAMRAADSALRDVKRLAGDRDVGGDVVWSLVGG
FT                   PLRALIAYVERQASCALQDDWERDVLWPLRRAATRDDVEGLLYGPQGAIWAFVDGPAKP
FT                   FVRVGAARASALDTLGYRLPFTDAFLPLIDDAAARRVAQARRDAERRAQQQAALELDER
FT                   IASLGKQIDALRAQTVRFGIVAQPTDVNPDAQAKPFETVLTLQCAPQARTLTNYNLRVS
FT                   EQIDWQPDRCGDATLRISLGGVTLVRRYAGSLGVARFVQDFRYGVRRFTPRDFPDAKAQ
FT                   LQRLGVRHIDVRYDFSGHDALLAHVGRIDALERARRDDLARQRRAANRQDDDAGGATAI
FT                   ARAAASVANAPGAALPRRIGVCWGDPAHDRPDGDGAQP"
FT   gene            776674..776838
FT                   /pseudo
FT                   /locus_tag="BMA10229_0731"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(776842..777042)
FT                   /locus_tag="BMA10229_0732"
FT   CDS_pept        complement(776842..777042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0732"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00271"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXX8"
FT                   /protein_id="ABN00271.1"
FT                   /translation="MRVELMAAYRNGVPCESAAAHRRRREHESKTVRRSRRRFVSKAAR
FT                   WDDRLDPKRDSKRDSSLRDRR"
FT   gene            777767..778621
FT                   /locus_tag="BMA10229_0733"
FT   CDS_pept        777767..778621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0733"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99771"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXX9"
FT                   /protein_id="ABM99771.1"
FT                   /translation="MRRPTIELEFDRAIEPGSVPHIVLRADDGTSVAVGPLSWLSDRRI
FT                   AFAPRKPLKSNSRYEIMVPAGIRSTTGERSAHPLTSSFDTAPVTPPRGLPNLDGASCFI
FT                   NTALQLAVHSSALDDILSNEAVPPAVRTLLEDYDAASADALDAQLAAAVAALRATPEVP
FT                   DSGPGQTLEVMQALRMPLYDTSSANNATNNADAIRHAPPNTKAFFLNSYPPLSYADLPN
FT                   HDRLVAFDYSTGGHYVAYVKRDGIWYRIDDAQVSAVNEQDLLALPAFNPANGSVSIEIA
FT                   IYR"
FT   gene            778693..778929
FT                   /locus_tag="BMA10229_0734"
FT   CDS_pept        778693..778929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0734"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ABM98751"
FT                   /db_xref="UniProtKB/TrEMBL:A2RXY0"
FT                   /protein_id="ABM98751.1"
FT                   /translation="MRGFALNAERALSKSNTSRTSDTAPSHRFGACRTHPARNSPDARI
FT                   RRSIQRRRTPSPVAPSNSLTFIFPFTCSPSALR"
FT   gene            780309..780572
FT                   /locus_tag="BMA10229_0735"
FT   CDS_pept        780309..780572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0735"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00516"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABN00516.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            780596..781429
FT                   /locus_tag="BMA10229_0736"
FT   CDS_pept        780596..781429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_0736"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ABM99068"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT