(data stored in ACNUC7421 zone)

EMBL: CP000546

ID   CP000546; SV 1; circular; genomic DNA; STD; PRO; 3458208 BP.
XX
AC   CP000546; AAHM02000000-AAHM02000002;
XX
PR   Project:PRJNA13943;
XX
DT   31-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Burkholderia mallei NCTC 10229 chromosome I, complete sequence.
XX
KW   .
XX
OS   Burkholderia mallei NCTC 10229
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; pseudomallei group.
XX
RN   [1]
RP   1-3458208
RA   DeShazer D., Woods D.E., Nierman W.C.;
RT   ;
RL   Submitted (05-JAN-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [2]
RC   Protein update by submitter
RP   1-3458208
RA   Brinkac L.M., Harkins D.M., Shrivastava S., Durkin A.S., Sutton G.;
RT   ;
RL   Submitted (21-OCT-2009) to the INSDC.
RL   The J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850,
RL   USA
XX
DR   MD5; 05a6305c7aaa842880e5702c6dbafa7e.
DR   BioSample; SAMN02604032.
DR   EnsemblGenomes-Gn; BMA10229_A0142.
DR   EnsemblGenomes-Gn; BMA10229_A0144.
DR   EnsemblGenomes-Gn; BMA10229_A0194.
DR   EnsemblGenomes-Gn; BMA10229_A0203.
DR   EnsemblGenomes-Gn; BMA10229_A0372.
DR   EnsemblGenomes-Gn; BMA10229_A0390.
DR   EnsemblGenomes-Gn; BMA10229_A0562.
DR   EnsemblGenomes-Gn; BMA10229_A0700.
DR   EnsemblGenomes-Gn; BMA10229_A0701.
DR   EnsemblGenomes-Gn; BMA10229_A0702.
DR   EnsemblGenomes-Gn; BMA10229_A0738.
DR   EnsemblGenomes-Gn; BMA10229_A0958.
DR   EnsemblGenomes-Gn; BMA10229_A0992.
DR   EnsemblGenomes-Gn; BMA10229_A1010.
DR   EnsemblGenomes-Gn; BMA10229_A1307.
DR   EnsemblGenomes-Gn; BMA10229_A1503.
DR   EnsemblGenomes-Gn; BMA10229_A1533.
DR   EnsemblGenomes-Gn; BMA10229_A1746.
DR   EnsemblGenomes-Gn; BMA10229_A1810.
DR   EnsemblGenomes-Gn; BMA10229_A1903.
DR   EnsemblGenomes-Gn; BMA10229_A1904.
DR   EnsemblGenomes-Gn; BMA10229_A1905.
DR   EnsemblGenomes-Gn; BMA10229_A1907.
DR   EnsemblGenomes-Gn; BMA10229_A1987.
DR   EnsemblGenomes-Gn; BMA10229_A1988.
DR   EnsemblGenomes-Gn; BMA10229_A1989.
DR   EnsemblGenomes-Gn; BMA10229_A1990.
DR   EnsemblGenomes-Gn; BMA10229_A1991.
DR   EnsemblGenomes-Gn; BMA10229_A2266.
DR   EnsemblGenomes-Gn; BMA10229_A2283.
DR   EnsemblGenomes-Gn; BMA10229_A2409.
DR   EnsemblGenomes-Gn; BMA10229_A2577.
DR   EnsemblGenomes-Gn; BMA10229_A2627.
DR   EnsemblGenomes-Gn; BMA10229_A2643.
DR   EnsemblGenomes-Gn; BMA10229_A2651.
DR   EnsemblGenomes-Gn; BMA10229_A2652.
DR   EnsemblGenomes-Gn; BMA10229_A2658.
DR   EnsemblGenomes-Gn; BMA10229_A2777.
DR   EnsemblGenomes-Gn; BMA10229_A2778.
DR   EnsemblGenomes-Gn; BMA10229_A2826.
DR   EnsemblGenomes-Gn; BMA10229_A2827.
DR   EnsemblGenomes-Gn; BMA10229_A2828.
DR   EnsemblGenomes-Gn; BMA10229_A2934.
DR   EnsemblGenomes-Gn; BMA10229_A3052.
DR   EnsemblGenomes-Gn; BMA10229_A3081.
DR   EnsemblGenomes-Gn; BMA10229_A3162.
DR   EnsemblGenomes-Gn; BMA10229_A3211.
DR   EnsemblGenomes-Gn; BMA10229_A3213.
DR   EnsemblGenomes-Gn; BMA10229_A3214.
DR   EnsemblGenomes-Gn; BMA10229_A3331.
DR   EnsemblGenomes-Gn; BMA10229_A3351.
DR   EnsemblGenomes-Gn; BMA10229_A3358.
DR   EnsemblGenomes-Gn; EBG00001244854.
DR   EnsemblGenomes-Gn; EBG00001244855.
DR   EnsemblGenomes-Gn; EBG00001244856.
DR   EnsemblGenomes-Gn; EBG00001244857.
DR   EnsemblGenomes-Gn; EBG00001244858.
DR   EnsemblGenomes-Gn; EBG00001244859.
DR   EnsemblGenomes-Gn; EBG00001244860.
DR   EnsemblGenomes-Gn; EBG00001244861.
DR   EnsemblGenomes-Gn; EBG00001244862.
DR   EnsemblGenomes-Gn; EBG00001244863.
DR   EnsemblGenomes-Gn; EBG00001244864.
DR   EnsemblGenomes-Gn; EBG00001244865.
DR   EnsemblGenomes-Gn; EBG00001244866.
DR   EnsemblGenomes-Gn; EBG00001244867.
DR   EnsemblGenomes-Gn; EBG00001244868.
DR   EnsemblGenomes-Gn; EBG00001244869.
DR   EnsemblGenomes-Gn; EBG00001244870.
DR   EnsemblGenomes-Gn; EBG00001244871.
DR   EnsemblGenomes-Gn; EBG00001244872.
DR   EnsemblGenomes-Gn; EBG00001244873.
DR   EnsemblGenomes-Gn; EBG00001244874.
DR   EnsemblGenomes-Gn; EBG00001244875.
DR   EnsemblGenomes-Gn; EBG00001244876.
DR   EnsemblGenomes-Gn; EBG00001244877.
DR   EnsemblGenomes-Gn; EBG00001244878.
DR   EnsemblGenomes-Gn; EBG00001244879.
DR   EnsemblGenomes-Gn; EBG00001244880.
DR   EnsemblGenomes-Gn; EBG00001244881.
DR   EnsemblGenomes-Gn; EBG00001244882.
DR   EnsemblGenomes-Gn; EBG00001244883.
DR   EnsemblGenomes-Gn; EBG00001244884.
DR   EnsemblGenomes-Gn; EBG00001244885.
DR   EnsemblGenomes-Gn; EBG00001244886.
DR   EnsemblGenomes-Gn; EBG00001244887.
DR   EnsemblGenomes-Gn; EBG00001244888.
DR   EnsemblGenomes-Gn; EBG00001244889.
DR   EnsemblGenomes-Gn; EBG00001244890.
DR   EnsemblGenomes-Gn; EBG00001244891.
DR   EnsemblGenomes-Gn; EBG00001244892.
DR   EnsemblGenomes-Gn; EBG00001244893.
DR   EnsemblGenomes-Gn; EBG00001244894.
DR   EnsemblGenomes-Gn; EBG00001244895.
DR   EnsemblGenomes-Gn; EBG00001244896.
DR   EnsemblGenomes-Gn; EBG00001244897.
DR   EnsemblGenomes-Gn; EBG00001244898.
DR   EnsemblGenomes-Gn; EBG00001244899.
DR   EnsemblGenomes-Gn; EBG00001244900.
DR   EnsemblGenomes-Gn; EBG00001244901.
DR   EnsemblGenomes-Gn; EBG00001244902.
DR   EnsemblGenomes-Gn; EBG00001244903.
DR   EnsemblGenomes-Gn; EBG00001244904.
DR   EnsemblGenomes-Gn; EBG00001244905.
DR   EnsemblGenomes-Gn; EBG00001244906.
DR   EnsemblGenomes-Gn; EBG00001244907.
DR   EnsemblGenomes-Gn; EBG00001244908.
DR   EnsemblGenomes-Gn; EBG00001244909.
DR   EnsemblGenomes-Gn; EBG00001244910.
DR   EnsemblGenomes-Gn; EBG00001244911.
DR   EnsemblGenomes-Gn; EBG00001244912.
DR   EnsemblGenomes-Gn; EBG00001244913.
DR   EnsemblGenomes-Gn; EBG00001244914.
DR   EnsemblGenomes-Gn; EBG00001244915.
DR   EnsemblGenomes-Gn; EBG00001244916.
DR   EnsemblGenomes-Gn; EBG00001244917.
DR   EnsemblGenomes-Gn; EBG00001244918.
DR   EnsemblGenomes-Gn; EBG00001244919.
DR   EnsemblGenomes-Gn; EBG00001244920.
DR   EnsemblGenomes-Gn; EBG00001244921.
DR   EnsemblGenomes-Gn; EBG00001244922.
DR   EnsemblGenomes-Gn; EBG00001244923.
DR   EnsemblGenomes-Gn; EBG00001244924.
DR   EnsemblGenomes-Tr; BMA10229_A0142-1.
DR   EnsemblGenomes-Tr; BMA10229_A0144-1.
DR   EnsemblGenomes-Tr; BMA10229_A0194-1.
DR   EnsemblGenomes-Tr; BMA10229_A0203-1.
DR   EnsemblGenomes-Tr; BMA10229_A0372-1.
DR   EnsemblGenomes-Tr; BMA10229_A0390-1.
DR   EnsemblGenomes-Tr; BMA10229_A0562-1.
DR   EnsemblGenomes-Tr; BMA10229_A0700-1.
DR   EnsemblGenomes-Tr; BMA10229_A0701-1.
DR   EnsemblGenomes-Tr; BMA10229_A0702-1.
DR   EnsemblGenomes-Tr; BMA10229_A0738-1.
DR   EnsemblGenomes-Tr; BMA10229_A0958-1.
DR   EnsemblGenomes-Tr; BMA10229_A0992-1.
DR   EnsemblGenomes-Tr; BMA10229_A1010-1.
DR   EnsemblGenomes-Tr; BMA10229_A1307-1.
DR   EnsemblGenomes-Tr; BMA10229_A1503-1.
DR   EnsemblGenomes-Tr; BMA10229_A1533-1.
DR   EnsemblGenomes-Tr; BMA10229_A1746-1.
DR   EnsemblGenomes-Tr; BMA10229_A1810-1.
DR   EnsemblGenomes-Tr; BMA10229_A1903-1.
DR   EnsemblGenomes-Tr; BMA10229_A1904-1.
DR   EnsemblGenomes-Tr; BMA10229_A1905-1.
DR   EnsemblGenomes-Tr; BMA10229_A1907-1.
DR   EnsemblGenomes-Tr; BMA10229_A1987-1.
DR   EnsemblGenomes-Tr; BMA10229_A1988-1.
DR   EnsemblGenomes-Tr; BMA10229_A1989-1.
DR   EnsemblGenomes-Tr; BMA10229_A1990-1.
DR   EnsemblGenomes-Tr; BMA10229_A1991-1.
DR   EnsemblGenomes-Tr; BMA10229_A2266-1.
DR   EnsemblGenomes-Tr; BMA10229_A2283-1.
DR   EnsemblGenomes-Tr; BMA10229_A2409-1.
DR   EnsemblGenomes-Tr; BMA10229_A2577-1.
DR   EnsemblGenomes-Tr; BMA10229_A2627-1.
DR   EnsemblGenomes-Tr; BMA10229_A2643-1.
DR   EnsemblGenomes-Tr; BMA10229_A2651-1.
DR   EnsemblGenomes-Tr; BMA10229_A2652-1.
DR   EnsemblGenomes-Tr; BMA10229_A2658-1.
DR   EnsemblGenomes-Tr; BMA10229_A2777-1.
DR   EnsemblGenomes-Tr; BMA10229_A2778-1.
DR   EnsemblGenomes-Tr; BMA10229_A2826-1.
DR   EnsemblGenomes-Tr; BMA10229_A2827-1.
DR   EnsemblGenomes-Tr; BMA10229_A2828-1.
DR   EnsemblGenomes-Tr; BMA10229_A2934-1.
DR   EnsemblGenomes-Tr; BMA10229_A3052-1.
DR   EnsemblGenomes-Tr; BMA10229_A3081-1.
DR   EnsemblGenomes-Tr; BMA10229_A3162-1.
DR   EnsemblGenomes-Tr; BMA10229_A3211-1.
DR   EnsemblGenomes-Tr; BMA10229_A3213-1.
DR   EnsemblGenomes-Tr; BMA10229_A3214-1.
DR   EnsemblGenomes-Tr; BMA10229_A3331-1.
DR   EnsemblGenomes-Tr; BMA10229_A3351-1.
DR   EnsemblGenomes-Tr; BMA10229_A3358-1.
DR   EnsemblGenomes-Tr; EBT00001590355.
DR   EnsemblGenomes-Tr; EBT00001590356.
DR   EnsemblGenomes-Tr; EBT00001590357.
DR   EnsemblGenomes-Tr; EBT00001590358.
DR   EnsemblGenomes-Tr; EBT00001590359.
DR   EnsemblGenomes-Tr; EBT00001590360.
DR   EnsemblGenomes-Tr; EBT00001590361.
DR   EnsemblGenomes-Tr; EBT00001590362.
DR   EnsemblGenomes-Tr; EBT00001590363.
DR   EnsemblGenomes-Tr; EBT00001590364.
DR   EnsemblGenomes-Tr; EBT00001590365.
DR   EnsemblGenomes-Tr; EBT00001590366.
DR   EnsemblGenomes-Tr; EBT00001590367.
DR   EnsemblGenomes-Tr; EBT00001590368.
DR   EnsemblGenomes-Tr; EBT00001590369.
DR   EnsemblGenomes-Tr; EBT00001590370.
DR   EnsemblGenomes-Tr; EBT00001590371.
DR   EnsemblGenomes-Tr; EBT00001590372.
DR   EnsemblGenomes-Tr; EBT00001590373.
DR   EnsemblGenomes-Tr; EBT00001590374.
DR   EnsemblGenomes-Tr; EBT00001590375.
DR   EnsemblGenomes-Tr; EBT00001590376.
DR   EnsemblGenomes-Tr; EBT00001590377.
DR   EnsemblGenomes-Tr; EBT00001590378.
DR   EnsemblGenomes-Tr; EBT00001590379.
DR   EnsemblGenomes-Tr; EBT00001590380.
DR   EnsemblGenomes-Tr; EBT00001590381.
DR   EnsemblGenomes-Tr; EBT00001590382.
DR   EnsemblGenomes-Tr; EBT00001590383.
DR   EnsemblGenomes-Tr; EBT00001590384.
DR   EnsemblGenomes-Tr; EBT00001590385.
DR   EnsemblGenomes-Tr; EBT00001590386.
DR   EnsemblGenomes-Tr; EBT00001590387.
DR   EnsemblGenomes-Tr; EBT00001590388.
DR   EnsemblGenomes-Tr; EBT00001590389.
DR   EnsemblGenomes-Tr; EBT00001590390.
DR   EnsemblGenomes-Tr; EBT00001590391.
DR   EnsemblGenomes-Tr; EBT00001590392.
DR   EnsemblGenomes-Tr; EBT00001590393.
DR   EnsemblGenomes-Tr; EBT00001590394.
DR   EnsemblGenomes-Tr; EBT00001590395.
DR   EnsemblGenomes-Tr; EBT00001590396.
DR   EnsemblGenomes-Tr; EBT00001590397.
DR   EnsemblGenomes-Tr; EBT00001590398.
DR   EnsemblGenomes-Tr; EBT00001590399.
DR   EnsemblGenomes-Tr; EBT00001590400.
DR   EnsemblGenomes-Tr; EBT00001590401.
DR   EnsemblGenomes-Tr; EBT00001590402.
DR   EnsemblGenomes-Tr; EBT00001590403.
DR   EnsemblGenomes-Tr; EBT00001590404.
DR   EnsemblGenomes-Tr; EBT00001590405.
DR   EnsemblGenomes-Tr; EBT00001590406.
DR   EnsemblGenomes-Tr; EBT00001590407.
DR   EnsemblGenomes-Tr; EBT00001590408.
DR   EnsemblGenomes-Tr; EBT00001590409.
DR   EnsemblGenomes-Tr; EBT00001590410.
DR   EnsemblGenomes-Tr; EBT00001590411.
DR   EnsemblGenomes-Tr; EBT00001590412.
DR   EnsemblGenomes-Tr; EBT00001590413.
DR   EnsemblGenomes-Tr; EBT00001590414.
DR   EnsemblGenomes-Tr; EBT00001590415.
DR   EnsemblGenomes-Tr; EBT00001590416.
DR   EnsemblGenomes-Tr; EBT00001590417.
DR   EnsemblGenomes-Tr; EBT00001590418.
DR   EnsemblGenomes-Tr; EBT00001590419.
DR   EnsemblGenomes-Tr; EBT00001590420.
DR   EnsemblGenomes-Tr; EBT00001590421.
DR   EnsemblGenomes-Tr; EBT00001590422.
DR   EnsemblGenomes-Tr; EBT00001590423.
DR   EnsemblGenomes-Tr; EBT00001590424.
DR   EnsemblGenomes-Tr; EBT00001590425.
DR   EuropePMC; PMC2168593; 17933898.
DR   EuropePMC; PMC2612704; 19038032.
DR   EuropePMC; PMC3515745; 23227305.
DR   EuropePMC; PMC4029289; 24883196.
DR   GOA; A2S6D4.
DR   InterPro; IPR005764; Ade_phspho_trans.
DR   InterPro; IPR029057; PRTase-like.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000546.
DR   SILVA-SSU; CP000546.
DR   StrainInfo; 341634; 0.
DR   UniProtKB/Swiss-Prot; A2S6D4; APT_BURM9.
XX
CC   The bacteria and source DNA are available from David DeShazer
CC   (David.DeShazer@det.amedd.army.mil).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3458208
FT                   /organism="Burkholderia mallei NCTC 10229"
FT                   /chromosome="I"
FT                   /strain="NCTC 10229"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:412022"
FT   gene            81..959
FT                   /locus_tag="BMA10229_A0001"
FT   CDS_pept        81..959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01339"
FT                   /db_xref="UniProtKB/TrEMBL:A2S241"
FT                   /protein_id="ABN01339.1"
FT                   /translation="MRQAEYHRAPGALRARIAAGLPLAAAPFAQAPVQDLPASDVPVSD
FT                   MPVSDMPVSDAPEQDTPSQDMRAPNKPAVDRPPEAKPRFGADARGGARAGRWFARPGSR
FT                   GPTLDRPGPGPGPRAAALPGLGWGVALTVALAAAAGFALDARRAATEHAVDEIVASHVR
FT                   AGLSSRDIDVISTDRHTVKPWFNGRLDFAPPVVDLSASGFALAGGRLDYVGQRRVAVLV
FT                   YRYRQHVIDVYVWPSGEGGARPYATVSQGYALDRWEAAGMTWWAVTDAEPSALAAFRTA
FT                   LDARVAAPRTE"
FT   gene            1194..1568
FT                   /gene="rpsF"
FT                   /locus_tag="BMA10229_A0002"
FT   CDS_pept        1194..1568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="BMA10229_A0002"
FT                   /product="30S ribosomal protein S6"
FT                   /note="identified by match to protein family HMM PF01250;
FT                   match to protein family HMM TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03566"
FT                   /db_xref="GOA:A2S242"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S242"
FT                   /protein_id="ABN03566.1"
FT                   /translation="MRHYEIVFIVHPDQSEQVPAMIERYKSTITSHGGQIHRVEDWGRR
FT                   QLAYMIEKLAKAHYVCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMK
FT                   EVQREEAKKAAAAQPTEAQA"
FT   gene            1605..1904
FT                   /gene="priB"
FT                   /locus_tag="BMA10229_A0003"
FT   CDS_pept        1605..1904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priB"
FT                   /locus_tag="BMA10229_A0003"
FT                   /product="primosomal replication protein n"
FT                   /note="identified by similarity to SP:P07013"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02825"
FT                   /db_xref="GOA:A2S243"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/TrEMBL:A2S243"
FT                   /protein_id="ABN02825.1"
FT                   /translation="MNRLQLTASVVEREPVRYTPAGVPIASATLQHRTEVVEAGIARQV
FT                   ELTIPAVAAGEASGRLEACEMGVETLFTGFLAKKHRNARTLVFHITALQDIGKD"
FT   gene            1907..2182
FT                   /gene="rpsR"
FT                   /locus_tag="BMA10229_A0004"
FT   CDS_pept        1907..2182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="BMA10229_A0004"
FT                   /product="30S ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01825"
FT                   /db_xref="GOA:A2S244"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S244"
FT                   /protein_id="ABN01825.1"
FT                   /translation="MARPTGKKFDKRRQQQNPLFKRKKFCRFTAAGVEQIDYKDTETLK
FT                   DFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLALLPYTDQHKA"
FT   gene            2210..2662
FT                   /gene="rplI"
FT                   /locus_tag="BMA10229_A0005"
FT   CDS_pept        2210..2662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="BMA10229_A0005"
FT                   /product="50S ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01902"
FT                   /db_xref="GOA:A2S245"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S245"
FT                   /protein_id="ABN01902.1"
FT                   /translation="MQIILLEKVANLGNLGDIVKVKDGYARNFLIPNRKARRATKDAIA
FT                   EFEVRRAELEKVAAEKLAAAQAVGEKLNGQTFEITQKSGVDGRLFGSVTNGDVAELLKK
FT                   AGYEIEKAQVRMPEGPLKMIGEHGVQVALHTDVVVDVTVNVIGDHA"
FT   gene            2806..4188
FT                   /gene="dnaB"
FT                   /locus_tag="BMA10229_A0006"
FT   CDS_pept        2806..4188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="BMA10229_A0006"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00772;
FT                   match to protein family HMM PF03796; match to protein
FT                   family HMM TIGR00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02609"
FT                   /db_xref="GOA:A2S246"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A2S246"
FT                   /protein_id="ABN02609.1"
FT                   /translation="MNAPKDPQIESLKVPPHSIEAEQSVLGGLLLDNGAWDRIADFLSQ
FT                   SDFYRYDHRIIFEHIGRLIAATRPADVVTVYEALTTSGKAEDVGGLAYLNALAQNTPSA
FT                   ANIRRYAEIVRDRAVLRRLVSVADEISADAFNPQGKEVRQLLDEAESKVFSIAEDGARG
FT                   TQGFLEIGPLLTQVVERIDTLYHTANPSDVTGTPTGFVDLDRMTSGMHGGELIIVAGRP
FT                   SMGKTAFSMNIGEYVAVEYGLPVAVFSMEMPGTQLVMRMLGSVGRLDQHRMRTGRLTDE
FT                   DWPKLTHAVQKMSEAQLFIDETGGLNPMELRSRARRLARQCGKLGLIIVDYLQLMTGSS
FT                   QGENRATEISEISRSLKSLAKELDVPVIALSQLNRGLEQRPNKRPVMSDLRESGAIEQD
FT                   ADVILFIYRDEVYNPDSPDKGTAEIIIGKQRNGPIGPVRLTFLGQYTKFDNFAGAQNFY
FT                   GE"
FT   gene            4327..4953
FT                   /locus_tag="BMA10229_A0007"
FT   CDS_pept        4327..4953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01865"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00798"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A2S247"
FT                   /protein_id="ABN00798.1"
FT                   /translation="MFGRFMPTEGKFFEIFNAHANYIVSGGRELELLIDNLADAEIHKQ
FT                   NVQSAEKAADKLTHEAIDLLHKTFITPLDRDEIHKLITTMDDILDLMEDVATAVSLYDV
FT                   RSVTSEASQLAHIVTQSAQHVQAAVALLSDMKQSGQILKACEEIDRWESEADRVLRAAM
FT                   SKLFREEDDVKTLIKLKAIYELLEQITDKCEDVANIIEGIVLENA"
FT   gene            4964..5974
FT                   /locus_tag="BMA10229_A0008"
FT   CDS_pept        4964..5974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0008"
FT                   /product="phosphate transporter family protein"
FT                   /note="identified by match to protein family HMM PF01384"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03781"
FT                   /db_xref="GOA:A2S248"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A2S248"
FT                   /protein_id="ABN03781.1"
FT                   /translation="MHSIQLALWVVAALVLVALVFDFMNGFHDAANSIATVVSTGVLKP
FT                   QQAVVFAAAFNVIAYFIFHLKVAQTVGKGTIDASIVDHYVVFGALFGAIGWNIITWYYG
FT                   IPSSSSHALIGGLVGAAVSKSGWGSLNVDGLMKTVAFIFISPLLGFILGSLFMLGVSWL
FT                   YFRTAPSKVDRRFRRLQLLSASLYSLGHGGNDAQKTIGIIWMLLIASGYASAASDAPPA
FT                   WVIGACYLSMGLGTLFGGWRIVRTMGQKITKLKPVGGFCAETGGALTLFIASWMGIPVS
FT                   TTHTITGAIVGVGATRKLSAVRWGVAGNIVWAWVLTIPASALIAAAGWWIGHRVF"
FT   gene            complement(6210..7433)
FT                   /locus_tag="BMA10229_A0009"
FT   CDS_pept        complement(6210..7433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0009"
FT                   /product="lipoprotein, NLP/P60 family"
FT                   /note="identified by match to protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02491"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A2S249"
FT                   /protein_id="ABN02491.1"
FT                   /translation="MLRLSLSVLVISLLAACSSVPPKSARSSSGMAITTPRAYAPPRGF
FT                   PNFVDHSVGREEISIQAMSLVGVPYRWGGNTPDSGFDCSGLVRYVVDRAASVNLPRTTA
FT                   DMSSIGESIEPDGIAPGDLIFFNTSGRPHSHVGIYVGKLRFVNAPSTGGTVRLDYLTNP
FT                   YWAKRFDGIRRVAAPKAKPAPFDAPTYQASRPSEPAPRVSPAAAAPAYAAVNAPAASAA
FT                   RAAAPSAPGYAANSATPAAARAAAPPPSSEYAAHSAAAMASAPASAAPLPNAVPAAATA
FT                   ATAATAADPYEPPPSAMSAARRQAQAAGASSPVLAAGNPGGAVPPAAPPAGGPTSMAGA
FT                   SAADPIDAAADAFEPPPPTARAAARQAQLAAPGNVQVLRASTAGSAASAAATGSNDDPI
FT                   ARFANGGY"
FT   gene            complement(7673..9307)
FT                   /locus_tag="BMA10229_A0010"
FT   CDS_pept        complement(7673..9307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0010"
FT                   /product="PhoH family protein"
FT                   /note="identified by match to protein family HMM PF02562"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01093"
FT                   /db_xref="GOA:A2S250"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A2S250"
FT                   /protein_id="ABN01093.1"
FT                   /translation="MVVAANTTTPLRAVAPAADASAGAPRARRAKQTAALLQPVPAAPA
FT                   PVARSSKTDAAKPAAAAPAAPRAAAKTRGRKDAEVEMQKLFVLDTNVLMHDPSSLFRFE
FT                   EHDVYLPMMTLEELDNHKKGMSEVARNARQVSRTLDSLVADAGPISAGIPLARLGSREA
FT                   LGRLYFQTTLTSIEPVEGLPQGKADNQILGVVRALQRERPDRQVVLVSKDINMRVKAHA
FT                   LGLPAEDYFNDQVLEDKDLLYSGVRELPQDFWTKHAKGMESWQDTKTGTTYYRVTGPLV
FT                   ASMLVNEFAYLEPQNGEPAFHAIVRELNGKTALLQTLRDYSHHKNNVWGITARNREQNF
FT                   ALNLLMNPEIDFVTLLGQAGTGKTLVALAAGLAQVLDDKRYNEIIVTRATVPVGEDIGF
FT                   LPGTEEEKMQPWMGAFDDNLEVLQKTDDAAGEWGRAATQELIRSRLKVKSMNFMRGRTF
FT                   VDKYVIIDEAQNLTPKQMKTLVTRAGPGTKIICLGNIAQIDTPYLTEGSSGLTYVVDRF
FT                   KGWGHSGHVTLARGERSRLADYASDIL"
FT   gene            9350..9604
FT                   /locus_tag="BMA10229_A0011"
FT   CDS_pept        9350..9604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0011"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00648"
FT                   /db_xref="UniProtKB/TrEMBL:A2S251"
FT                   /protein_id="ABN00648.1"
FT                   /translation="MSGAPGGGLLRGFRGPRFRLVFVGRQQAAELAGGSRQRHGVPREE
FT                   SCRRHAPPFASCDASRVQFARSGAHGVRIAGSPRFRSSP"
FT   gene            complement(9798..10259)
FT                   /locus_tag="BMA10229_A0012"
FT   CDS_pept        complement(9798..10259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0012"
FT                   /product="antioxidant, AhpC/TSA family"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03143"
FT                   /db_xref="GOA:A2S252"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2S252"
FT                   /protein_id="ABN03143.1"
FT                   /translation="MSVEVDRQVPDFTAPATGGEFSLSGIKGKKLVLYFYPKDNTPGCT
FT                   TEGLQFRDLYPKFKKAGAEIVGVSRDSLRSHENFKAKLELPFLLISDPDETLCALFGVM
FT                   KLKKMYGKEVRGIERSTFLIDGAGMLRHAWRGVKVPGHVDDVLSAVQAL"
FT   gene            complement(10349..11245)
FT                   /locus_tag="BMA10229_A0013"
FT   CDS_pept        complement(10349..11245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0013"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03773"
FT                   /db_xref="GOA:A2S253"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A2S253"
FT                   /protein_id="ABN03773.1"
FT                   /translation="MARIVLKIDVDTLRGTREGVPNLARIFDRFAARATFLFSLGPDHT
FT                   GWAMRRVLRPGFLKKVSRTSVVEHYGVRQLLYGVLLPGPDIGRRARADMRAIHEAGFEC
FT                   GIHTWDHVYWQDNVRRRPREWTVREMNKSRERFVEIFGAPPVTHGAAGWQMNDAAFEQI
FT                   DAWGMRYASDGRGHSPYLPVVAGKTLAHVQMPTTLPTLDEILGVDGIDTGNVAARVLEH
FT                   TERNPHDQVFTLHAELEGQKLAPVFEQLLAGWRAQGHTFATMGDYYATLDRAALPSYPV
FT                   AWGEIPGRSGELIVQPD"
FT   gene            complement(11261..12316)
FT                   /locus_tag="BMA10229_A0014"
FT   CDS_pept        complement(11261..12316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01177"
FT                   /db_xref="GOA:A2S254"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2S254"
FT                   /protein_id="ABN01177.1"
FT                   /translation="MKAKKVLILGVNGFIGHHLSKRILETTDWEVFGMDMQTDRLGDLV
FT                   KHERMHFFEGDITINKEWVEYHVKKCDVILPLVAIATPATYVKQPLRVFELDFEANLPI
FT                   VRSAVKYGKHLVFPSTSEVYGMCADEQFDPDASALTYGPINKPRWIYACSKQLMDRVIW
FT                   GYGMEGLNFTLFRPFNWIGPGLDSIYTPKEGSSRVVTQFLGHIVRGENISLVDGGSQKR
FT                   AFTYVDDGISALMKIIENSNGVATGKIYNIGNPNNNFSVRELANKMLELAAEFPEYADS
FT                   AKRVKLVETTSGAYYGNGYQDVQNRVPKIENTMQELGWAPQFTFDDALRQIFEAYRGHV
FT                   ADARAFVEQHG"
FT   gene            complement(12313..13260)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0015"
FT                   /note="putative formyltransferase; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00551; match to
FT                   protein family HMM PF02911"
FT   gene            complement(13257..14264)
FT                   /locus_tag="BMA10229_A0016"
FT   CDS_pept        complement(13257..14264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0016"
FT                   /product="glycosyltransferase, group 2 family"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03312"
FT                   /db_xref="GOA:A2S256"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2S256"
FT                   /protein_id="ABN03312.1"
FT                   /translation="MTHPETRATHPEVSIVIPVYNEEAGLAALFARLYPALDALGTPYE
FT                   VILVNDGSRDRSAALLADQFRVRPDTTRVVLLNGNYGQHMAILAGFEQSRGEIVITLDA
FT                   DLQNPPEEIGKLIAKMREGYDYVGSIRLQRQDSLFRRKASAAMNRLRERITRIKMTDQG
FT                   CMLRAYSRHIIDTINRCGEVNTFIPALAYTFAQNPTEIEVAHEERFAGESKYSLYSLIR
FT                   LNFDLVTGFSVVPLQWLSFIGVILSLGSAALFVLLVVRRFIVGAEVQGVFTLFAITFFL
FT                   LGVIIFALGLLGEYIGRIYQQVRARPRYLIHTVLEARDGKPGVTLAAERREAAR"
FT   gene            complement(14271..15422)
FT                   /locus_tag="BMA10229_A0017"
FT   CDS_pept        complement(14271..15422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0017"
FT                   /product="aminotransferase, DegT/DnrJ/EryC1/StrS family"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00803"
FT                   /db_xref="GOA:A2S257"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2S257"
FT                   /protein_id="ABN00803.1"
FT                   /translation="MSQTSVPFLPFVKPEIDEETIQGVADVLRSGWITTGPQCQRFEAA
FT                   LSEYCGGRPVRVFNSGTATLEIGLRIAGVGPGDEVITTPASWVATSNVILETGATPVFV
FT                   DIDPVTRNLDLGLVEKAITPRTKAIIPVYLAGLPVDMDRLYAIARAHELRVIEDAAQAL
FT                   GSTWRGQRIGAIGDIVSFSFHPNKNITSIEGGALVLNDEAEATLAQKYRLQGITRTGLD
FT                   GMDCDVLGGKYNLTDVAARVGWGQLAHLERFNATRHALARRYFDAFANGPACALGVGLP
FT                   VADFENTNWHMFQITLPLEKLSISRGEFMEQLKQRGIGSGVHYPAIHLFTLYRARGFAQ
FT                   GMFPHAERFGASTVTLPLFTQMSEAHVQRVVDAVNQICEQYGK"
FT   gene            complement(15549..15920)
FT                   /locus_tag="BMA10229_A0018"
FT   CDS_pept        complement(15549..15920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0018"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01415"
FT                   /db_xref="GOA:A2S258"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S258"
FT                   /protein_id="ABN01415.1"
FT                   /translation="MNPVSLFCIVTGVMLNACAQLLLKAGVRAVGHFEFTRANIVPIGF
FT                   KIATQLPIIGGLGCYVLSVVVWIVGLSRVDVSVAYPMLSLGYVVNAFAAWYLFGEVLSV
FT                   QRLVGIGIILIGVFVLARS"
FT   gene            complement(15917..17647)
FT                   /locus_tag="BMA10229_A0019"
FT   CDS_pept        complement(15917..17647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0019"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF02366"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00815"
FT                   /db_xref="GOA:A2S259"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="InterPro:IPR040845"
FT                   /db_xref="UniProtKB/TrEMBL:A2S259"
FT                   /protein_id="ABN00815.1"
FT                   /translation="MNDTPTRLPLDRAAPVTLNRAALLLLVAALAVIWFAPLGLRHLIP
FT                   SDEGRYAEMAREMFVTGDWITPRYNGYKYFEKPPLQTWLNALTFAWFGIGEWQARLYTA
FT                   LASFAGVLFAGYAGARVFNPRAGFFAALVLASSPYWNLMGHFNALDMGLSLWMTVTLCA
FT                   LLLAQRPGIGKRAERGWMWLCWASMALAVLSKGLIGLILPGAVLVLYTLASRDWALWKR
FT                   LHLVSGLVIFFAIATPWFVLVQSRNPEFFNFFFIVQQFRRYLTPEQNRPGAFYYFAPVL
FT                   AVGFLPWLSVSVQSVRHALRIPRQPNGFAPMLMLATWSVFIFLFFSASHSKLISYVLPV
FT                   APALALMIGAYLPLVSREQFRRHLFGYLVFLVAAAFGTLFLARLGDARTPNSQYLEFQK
FT                   WVYVALAAAFALTLVAVWLNRRGRAGVAAAAVAFGAGWLLLGTIGGTGHDAFGRYSSGA
FT                   LLAPAIREELAKLPPDTPFYSVETLDHTLPFYVGHTMIMVERKDELTFGISVEPNKWVP
FT                   TVAEWEQRWRADRHALALMSPDRYKQLSEAGLPMRVVARDNRRVVVEKPQSRAAKDPNR
FT                   "
FT   gene            complement(17816..18190)
FT                   /locus_tag="BMA10229_A0020"
FT   CDS_pept        complement(17816..18190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04430"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01096"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:A2S260"
FT                   /protein_id="ABN01096.1"
FT                   /translation="MKLHQDPSNALNTVTGYGPDYVDINLQRHETSVIVLPGAPVVEWP
FT                   VASFDALTPELFAMLLEPQPEVVVFGSGARLRFPHPRLTAQLTAQRVGVETMDFQAACR
FT                   TYNILMAEGRKVAAALLIER"
FT   gene            18752..19771
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0021"
FT                   /note="aminotransferase, class I/II; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00155"
FT   gene            19816..21144
FT                   /gene="hom"
FT                   /locus_tag="BMA10229_A0022"
FT   CDS_pept        19816..21144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hom"
FT                   /locus_tag="BMA10229_A0022"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="identified by match to protein family HMM PF00742;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM PF03447"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02936"
FT                   /db_xref="GOA:A2S262"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2S262"
FT                   /protein_id="ABN02936.1"
FT                   /translation="MEPIKVGLLGFGTVGGGTFKVLRRNQEEIKRRAGRGIEIARVAVR
FT                   NPAKALAALDGDANGVSIGDDFNAVVDDPSIAIVAEMIGGTGLARELVLRAIANGKHVV
FT                   TANKALLAVHGTEIFEAARAKGVMVAFEAAVAGGIPIIKALREGLTANRIQYIAGIING
FT                   TTNYILSEMRERGLDFATALKAAQELGYAEADPTFDIEGVDAAHKATIMSAIAFGVPVQ
FT                   FDRAYVEGISRLAATDIKYAEELGYRIKLLGITRRTERGIELRVHPTLIPAKRLLANVE
FT                   GAMNAVVVHGDAVGTTLYYGKGAGAEPTASAVVADLVDVTRLHTADPEHRVPHLAFQPD
FT                   SLSNTPILPIEEVTSGYYLRLRVADQTGVLADITRILAESGISIDALLQKESEQVDDAN
FT                   GETDIILITHETVEKNVNAAIARIESLATVVSKVTKLRMEALN"
FT   gene            21152..22603
FT                   /gene="thrC"
FT                   /locus_tag="BMA10229_A0023"
FT   CDS_pept        21152..22603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="BMA10229_A0023"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR00260"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01299"
FT                   /db_xref="GOA:A2S263"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A2S263"
FT                   /protein_id="ABN01299.1"
FT                   /translation="MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPSEYPRVSADEL
FT                   ARWRALPYADLAFEILAKFCDDIPADDLRAITRRTYTADVYRHTRHGGNAADITPLTTL
FT                   GAENGAPVSLLELSNGPTLAFKDMAMQLLGNLFEYTLAAHGETLNILGATSGDTGSAAE
FT                   YAMRGKRGVRVFMLSPHRKMSAFQTAQMYSLQDPNIFNLAVKGVFDDCQDIVKAVSNDH
FT                   AFKAQQKIGTVNSINWARVVAQVVYYFKGYFAATRTNDERVSFTVPSGNFGNVCAGHIA
FT                   RMMGLPIEKLVVATNENDVLDEFFRTGAYRVRSAEHTYHTSSPSMDISKASNFERFVFD
FT                   LLGRDPARVVQLFRDVEQKGGFDLAASGDFARVAEFGFVSGRSTHADRLATIRDVFERY
FT                   RTTIDTHTADGLKVAREHLQPGVPMIVLETAQPIKFGETIREALGREPSRPAAFDGLEA
FT                   LPQRFEVVDASAQQVKDFIAAHTGA"
FT   gene            23379..24671
FT                   /gene="moeA-2"
FT                   /locus_tag="BMA10229_A0024"
FT   CDS_pept        23379..24671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA-2"
FT                   /locus_tag="BMA10229_A0024"
FT                   /product="molybdopterin biosynthesis moeA protein"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM PF03453; match to protein
FT                   family HMM PF03454; match to protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02203"
FT                   /db_xref="GOA:A2S264"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A2S264"
FT                   /protein_id="ABN02203.1"
FT                   /translation="MLSTADALTALLAAARPLAEIETVPTLEALNRVLAADVASGLDVP
FT                   PMNTSAMDGYAVRIADLTRGERRLPVSQRIAAGHPAAPLAPGTAARIFTGASVPAGADA
FT                   VVMQEQTEAAGDQVDILHTPTVGEWITAQGADIRRGSVILPAGTRMTPQAMGLAASVGC
FT                   VSLAVTRRVKVAVFFTGDELTMPGEPLKPGAIYNSNRFTLRGLLERLGCDVTDYGIVPD
FT                   RLDATRAALREAAREHDVIVTSGGVSVGDEDHVKPAVEAEGRLALWQIAMKPGKPLAFG
FT                   AIRRDGAASGAAAVEANAHGASDASDTRAMHATSGGEAYFIGLPGNPVSSFVTFLLFVR
FT                   PFLLRVAGAAQVAPRAVSLRADFTQNKADRRNEFLRARVNAAGGLDLFPNQSSAVLTST
FT                   VWGDGLIDNPPNHAISAGETVRFIPFSELLG"
FT   gene            24693..24950
FT                   /gene="moaD"
FT                   /locus_tag="BMA10229_A0025"
FT   CDS_pept        24693..24950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaD"
FT                   /locus_tag="BMA10229_A0025"
FT                   /product="molybdopterin converting factor, subunit 1"
FT                   /note="identified by match to protein family HMM PF02597;
FT                   match to protein family HMM TIGR01682"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02738"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A2S265"
FT                   /protein_id="ABN02738.1"
FT                   /translation="MKIELKFFASVREALGVASETVTVPDGVATVGDVRAWLRARGGAW
FT                   ADTLAEGRALRMACNHTMTDAGTRITEGCEVAFFPPVTGG"
FT   gene            24961..25449
FT                   /gene="moaE"
FT                   /locus_tag="BMA10229_A0026"
FT   CDS_pept        24961..25449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaE"
FT                   /locus_tag="BMA10229_A0026"
FT                   /product="molybdopterin converting factor, subunit 2"
FT                   /note="identified by match to protein family HMM PF02391"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02515"
FT                   /db_xref="GOA:A2S266"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A2S266"
FT                   /protein_id="ABN02515.1"
FT                   /translation="MATVRVQADDFDVSAEIAALRARNPKVGAIACFVGTVRDLNEGEQ
FT                   IDALELEHYPGMTEKALAAIAEDAIARWPGIDVAIVHRVGKLYPLDQIVFVATVSAHRG
FT                   DAFQSCEFVMDYLKTQAPFWKKEKTPAGERWVDARSADDAALARWGVESGNAREKRST"
FT   gene            complement(25771..26313)
FT                   /locus_tag="BMA10229_A0027"
FT   CDS_pept        complement(25771..26313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01152"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03420"
FT                   /db_xref="GOA:A2S267"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:A2S267"
FT                   /protein_id="ABN03420.1"
FT                   /translation="MTQAFSASSAAAKPARDAEPTPENIRALVDAFYDRVRDDALLGPV
FT                   FESKLAGRWDQHLPKMGEFWSSLVLGTKSYRGNVQAAHQPLDGLEPVHFSRWLALFLKT
FT                   VEARYEPAAAVRFMEPALRIAQSLQLSRFGWDYRIPAEQQVILDLIAPKRPDDAAHRPR
FT                   GEPFPTKIIGRTARDDT"
FT   gene            26497..26994
FT                   /locus_tag="BMA10229_A0028"
FT   CDS_pept        26497..26994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0028"
FT                   /product="Rrf2 family protein"
FT                   /note="identified by match to protein family HMM PF02082;
FT                   match to protein family HMM TIGR00738"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00693"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S268"
FT                   /protein_id="ABN00693.1"
FT                   /translation="MRLTDYTDYSLRVMLFLAVRGEGLSTIQEISDAYGISKNHLMKVV
FT                   QQLGELGWIETVRGRNGGLRLNAQSVTLTVGEVVRKTENDFALVGCFAGESESHRSCVI
FT                   QSACRLRGVFAAAREAFFAELDKHTIGELAQPASQLATLLGLAPVRIVSAADIRAAAPV
FT                   VG"
FT   gene            26991..27104
FT                   /locus_tag="BMA10229_A0029"
FT   CDS_pept        26991..27104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0029"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02276"
FT                   /db_xref="UniProtKB/TrEMBL:A2S269"
FT                   /protein_id="ABN02276.1"
FT                   /translation="MTTRRPRRAGGLPDGFPACAGRAARRVPLSFAAARFA"
FT   gene            27198..29795
FT                   /gene="clpB"
FT                   /locus_tag="BMA10229_A0030"
FT   CDS_pept        27198..29795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="BMA10229_A0030"
FT                   /product="ATP-dependent chaperone protein ClpB"
FT                   /note="identified by similarity to SP:P03815; similarity to
FT                   SP:P63284; match to protein family HMM PF00004; match to
FT                   protein family HMM PF02861; match to protein family HMM
FT                   PF07724; match to protein family HMM PF07728; match to
FT                   protein family HMM TIGR03346"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03174"
FT                   /db_xref="GOA:A2S270"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A2S270"
FT                   /protein_id="ABN03174.1"
FT                   /translation="MRIDKLTTKFQEALSDAQSFAAGRDNQYIEPVHVLAALVAQQDGS
FT                   ARSLLSRAGVHIQALQGALNEAISRLPQVTGTGGDIQVGRELAGLLNQADKEAQKLNDT
FT                   FVASEMFLLAVADDKGEAGKLARQHGLTRRALESAIAAVRGGSQVHSQDAESQREALKK
FT                   YTVDLTERARAGKLDPVIGRDDEIRRSIQILQRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVNGEVPETLKNKRVLSLDMAALLAGAKYRGEFEERLKAVLNDIAKDEGRTIVFIDEIH
FT                   TMVGAGKAEGAMDAGNMLKPALSRGELHCIGATTLDEYRKYIEKDAALERRFQKVLVDE
FT                   PSVEATIAILRGLQEKYELHHGVEITDPAIVAAAELSHRYITDRFLPDKAIDLIDEAAS
FT                   RIKMEIDSKPEEMDKLDRRLIQLKIEREAVKKEPDEASQKRLALIEEEIERLGREYADL
FT                   DEIWTAEKAAVQGSAQLKEEIDKVRADIARLQREGKLEKVAELQYGKLPQLEARLKQVT
FT                   QAEESEQHNPTRPRLLRTQVGAEEIAEVVSRATGIPVSRMMQGEREKLLHIEEKLHERV
FT                   VGQNEAIDAVADAIRRSRAGLADPNRPYGSFLFLGPTGVGKTELCKALAGFLFDSEEHL
FT                   IRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRKPYSVILLDEIEKAHPDVFN
FT                   VLLQVLDDGRMTDGQGRTVDFKNTVIVMTSNLGSQLIQSMSGSSQEEIKDAVWVEVKQH
FT                   FRPEFLNRIDDVVVFHSLDRGNIQAIAKIQLARLHDRLAKLDMALDVSEAALEQIGKVG
FT                   YDPLFGARPLKRAIQQEIENPVAKLILAGRFGPKDVIPVDMQDGRFVFERVVH"
FT   gene            complement(30034..30456)
FT                   /locus_tag="BMA10229_A0031"
FT   CDS_pept        complement(30034..30456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06078"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03536"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:A2S271"
FT                   /protein_id="ABN03536.1"
FT                   /translation="MGLLDIVGGLIGGQGGNQNALVSAALEFINNQPGGLNGLIEKFNA
FT                   GGAGDIIGSWIGTGENQPISPETLQNVLGSDTIGALAQKVGIDPQQASGILAQVLPHVV
FT                   NGATPNGEVPAGGQLDTSNVLGTLSQLASLLGNKQA"
FT   gene            complement(30535..31230)
FT                   /locus_tag="BMA10229_A0032"
FT   CDS_pept        complement(30535..31230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0032"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01277"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A2S272"
FT                   /protein_id="ABN01277.1"
FT                   /translation="MLERDARLAPRAGFVPTATHPFHQKGAPAMLKKLLMLVVALSLSL
FT                   TAALAAAVEVNTADQAALESVKGLGPVKSKAIIDERAKNGPFKDADDLANRVKGLGAKS
FT                   VAHLEAAGLTIGGSTTPPTGAKAKTGTAKPAATATPAPAPAPAPTTSSATPTPSAATPA
FT                   PATATPSTAASAPAAKKSRSSKKQDKAAAASAAAQASAPAAASTTKAKGSKKSRKNKAA
FT                   TPASAASGA"
FT   gene            31499..31993
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0033"
FT                   /note="transcriptional regulator, MerR family; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00376; match to protein family HMM PF09278"
FT   gene            31942..32340
FT                   /locus_tag="BMA10229_A0034"
FT   CDS_pept        31942..32340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0034"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02627"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02799"
FT                   /db_xref="GOA:A2S274"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A2S274"
FT                   /protein_id="ABN02799.1"
FT                   /translation="MEQRISEDRYTRGWNKLKEIDGKVGERVVAALAPIAPDFGRLLVE
FT                   FGFGDIYSRPQLDLKSREIATIASLATLGHAQPQLKVHIEAALNVGCTRDEIVEVFMQM
FT                   ALYAGFPAALNALFAARDVFGQRDAAHA"
FT   gene            complement(32731..34086)
FT                   /locus_tag="BMA10229_A0035"
FT   CDS_pept        complement(32731..34086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0035"
FT                   /product="putative multidrug resistance protein NorM"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03117"
FT                   /db_xref="GOA:A2S275"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A2S275"
FT                   /protein_id="ABN03117.1"
FT                   /translation="MFGDIRRIAGLAWSVLVGQLAIIAFGVIDTAMVGRFSALDLAALG
FT                   LGMSIYVSIYIGLTGILSALQPIAGQLYGARRYAEIGEEVRQAMWLAVLLAAPGFLLLH
FT                   FPHPLLRLAHAPAELTDRTVAYLRILSFGLPASLLFRIYNALTNAAGKPRLAMILQVGA
FT                   LAVKVPLNLWFIFGGLGVPALGGPGCGLASTLINWALAIVGFTLLARLDVFEPLAIFAR
FT                   FTRPVWHRQKALLVLGVPMGLSYLIEVTSYTFMALFIAQFGTTTLAGHQIAGNIDAVLY
FT                   MTPLSIGVASSTLVARALGAGRFDEARALGRHGVALACGLACAYGIVVFALRPLIVSGY
FT                   TPNPAVAAAAMPLVAIVTVYHFFDALQITTAFVLRAHKMAVVPTAIYAIALWGVGLGGG
FT                   YLLGFDVGGAVPAQFTGARGFWIASAASLMLAGGGLALYLRHIGKRETGGAR"
FT   gene            complement(34090..35838)
FT                   /locus_tag="BMA10229_A0036"
FT   CDS_pept        complement(34090..35838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0036"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00992"
FT                   /db_xref="GOA:A2S276"
FT                   /db_xref="UniProtKB/TrEMBL:A2S276"
FT                   /protein_id="ABN00992.1"
FT                   /translation="MKPVVRLTASATRALPRWLLLTLCIVYAAFGLFGRDPWKNEDAAG
FT                   FGVMWTMAQGGLHDWLLPNLVGKFVTSDGPLGYWLGGLAIRALPWVDASNASRIYTGVL
FT                   FCVACAFVWYAAYLLGRRAEIQPFKYAFGGEPEPRDYGRTLADGALLVLLACFGLAERG
FT                   HETTPQLAQFACIATFVYGLVRAIDKPTQGALWWGLALGLVALSGNPVLVAALALGTLA
FT                   LYLVTPEIRCVQLPAIGLPLAVAVFAIWPLAAYIAFPDDANWFFNQWLHGSLMRFSGPP
FT                   TTVLAYAAKNLPLFTWPAWPLAIWAWVSWAGLRRRPHIAIPLSVAAPLLALVILQSQQT
FT                   NRMYMLLLPALAVIATFALPTLKRGAINAIDWFAVLSFTILGTFVWLVWLASLTGFPHP
FT                   LARNLGRLVPGYEPHFKVLSFVCAVAATACWLMLVRWRISRQPKVLWRSVVLSSAGTTL
FT                   MWVLLMTLWLPIVNYSRTYRDVAQQIAAHLPSDYECISPVRLGDAQIATFAYFGDMHFS
FT                   FTDDCDVILRQDHADFGEPSSISQYVWRLVWEGRRVADRDERFRLYERIERPKTPIKRR
FT                   PPRKAR"
FT   gene            35866..36108
FT                   /locus_tag="BMA10229_A0038"
FT   CDS_pept        35866..36108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0038"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02421"
FT                   /db_xref="UniProtKB/TrEMBL:A2S277"
FT                   /protein_id="ABN02421.1"
FT                   /translation="MPARERRAVSGIRHCRRAGRHASANRRARAAPVARGIDRDKKRQP
FT                   GLPFLRNRPGAKPDADAVAKLTSRPCRWRVRRTCS"
FT   gene            complement(36062..36325)
FT                   /gene="rpmE"
FT                   /locus_tag="BMA10229_A0037"
FT   CDS_pept        complement(36062..36325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="BMA10229_A0037"
FT                   /product="50S ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01378"
FT                   /db_xref="GOA:A2S278"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S278"
FT                   /protein_id="ABN01378.1"
FT                   /translation="MKQGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEFEGKTYPLA
FT                   KIEVSSESHSFYTGQQKIMDTAGRVEKFKNKFGARASGKAAK"
FT   gene            complement(36540..37385)
FT                   /locus_tag="BMA10229_A0039"
FT   CDS_pept        complement(36540..37385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06167"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01806"
FT                   /db_xref="GOA:A2S279"
FT                   /db_xref="InterPro:IPR010384"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042252"
FT                   /db_xref="UniProtKB/TrEMBL:A2S279"
FT                   /protein_id="ABN01806.1"
FT                   /translation="MLSKLNQWLDARRRDRALRSHPIPDVLWRETLERLPFLSYLSNED
FT                   RARLRETTSLFLAQKSFSTAHGLELTDAIVVGIAAQACVPVLNLGLDLYRGWVGIVVYP
FT                   GEFVIRKTVEDEDGVVHEVEHDASGEAWDGGPVILSWEDVQMADGSDAYNVVIHEFAHK
FT                   IDMMSGAADGHPPLFRRWHAPALDAERWADVFDHAYDQFCDRVDAVPERAWARFERDSL
FT                   IYPYAADHPSEFFAVCSEALFVKPRSFEAEFPELYRLLARYYRQDPARTGCLAGSAAHV
FT                   "
FT   gene            complement(37428..38984)
FT                   /locus_tag="BMA10229_A0040"
FT   CDS_pept        complement(37428..38984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0040"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00843"
FT                   /db_xref="GOA:A2S280"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2S280"
FT                   /protein_id="ABN00843.1"
FT                   /translation="MSAAPGRPPLWSAANLRGDFFPWVLAIVTGLDYFDNAAFSFFASY
FT                   IAGEINASPDELVWASSAYAVTAVLGILQQQWWVDRLGHRRYVAGCMLMFSLGAMAAAA
FT                   ADTSLQLAFARGFQGYFIGPMMGACRILIQVSFAPKDRPPATRAFLIMLLLGSALAPIA
FT                   GGLLVAHFTWRALFACTAPAGILFAALAFVALPDSGHTPPDERGGAHFWPYVIFALAQG
FT                   ALQIVMQQVRFQLFAGSPLLVLLAVGGLAALAWFGHHQWHHPAPLVRLHAFRERTFRVG
FT                   LLLYLFYYYETTGYSYLISRFLETGLGYPIENAGRLVGTMSLISASALFVYLRYAKLLT
FT                   HKKWIIVPGFALAAFAALWMTRMSPEVGEAALVAPLLMRGLLLLFIVLPVANLTFRVFA
FT                   IDEYSHGYRLKNIVRQLTISFATASVIIVEQHRLAVHQTRLVEQANVYNPLFRQTLDTL
FT                   TRGFAAAGHAFSDAHALALVTVSRTIAQQASFLASLDGFYFLAGVAICGGLFAAWQKEI
FT                   D"
FT   gene            complement(38981..39481)
FT                   /locus_tag="BMA10229_A0041"
FT   CDS_pept        complement(38981..39481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0041"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03380"
FT                   /db_xref="GOA:A2S281"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A2S281"
FT                   /protein_id="ABN03380.1"
FT                   /translation="MSDAPPTLLLTVRDAAERLGVTPRTLKYYEERGLVTPSRSEGRYR
FT                   LYDAADLERFERILRLRALGFSLHGITEMLKRPLEPAGDGRRRYSDASLRDIHADLSQQ
FT                   IATLDARIAAAQRELKEVRALKQELQHDIDYVERRLAGENPDELIAQRRAAARARKTGG
FT                   TSA"
FT   gene            complement(39618..40880)
FT                   /gene="rho"
FT                   /locus_tag="BMA10229_A0042"
FT   CDS_pept        complement(39618..40880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="BMA10229_A0042"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF07497; match to protein
FT                   family HMM PF07498; match to protein family HMM PF08206;
FT                   match to protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02623"
FT                   /db_xref="GOA:A2S282"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A2S282"
FT                   /protein_id="ABN02623.1"
FT                   /translation="MHLSELKSLHVSELIEMANGLEIENANRLRKQELMFAILKKRAKT
FT                   GETIFGDGTLEVLPDGFGFLRSPEMSYLASTDDIYISPSQIRRFNLHTGDTIEGEVRTP
FT                   KDGERYFALVKVDKVNGQPPKASKHKIMFENLTPLHPNKPLSLEREMRGEENVTGRIID
FT                   MIAPIGKGQRGLLVASPKSGKTVMLQHIAHAIKQNHPDVILFVLLIDERPEEVTEMQRS
FT                   VAGEVIASTFDEPATRHVQVAEMVIEKAKRLVEMKHDVVILLDSITRLARAYNTVIPAS
FT                   GKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIGTALIETGSRMDDVIYEEFKGTGN
FT                   MEVHLERRLAEKRVYPSINLNKSGTRREEMLIKPEILQKIWVLRKFIHDMDEVEAMEFL
FT                   LDKIRQTKNNAEFFDLMRRGG"
FT   gene            complement(40944..41069)
FT                   /locus_tag="BMA10229_A0043"
FT   CDS_pept        complement(40944..41069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01954"
FT                   /db_xref="UniProtKB/TrEMBL:A2S283"
FT                   /protein_id="ABN01954.1"
FT                   /translation="MRPAHVLSTGNTCAAKSADRSLKPESAYARIKNVDKTHINL"
FT   gene            complement(41076..41402)
FT                   /gene="trx"
FT                   /locus_tag="BMA10229_A0044"
FT   CDS_pept        complement(41076..41402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="BMA10229_A0044"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01697"
FT                   /db_xref="GOA:A2S284"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2S284"
FT                   /protein_id="ABN01697.1"
FT                   /translation="MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDE
FT                   VAKDYGDKLQIAKINVDENQATPAKFGVRGIPTLILFKNGAVAAQKVGALSKSQLTAFL
FT                   DSHL"
FT   gene            42066..44543
FT                   /locus_tag="BMA10229_A0045"
FT   CDS_pept        42066..44543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0045"
FT                   /product="putative DNA polymerase III, subunit gamma"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03843"
FT                   /db_xref="GOA:A2S285"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:A2S285"
FT                   /protein_id="ABN03843.1"
FT                   /translation="MTYQVLARKWRPKDFASLVGQEHVVRALTHALDGGRLHHAYLFTG
FT                   TRGVGKTTLSRIFAKALNCETGVTSQPCGVCRACREIDEGRFVDYVEMDAASNRGVDEM
FT                   AALLERAVYAPVDARFKVYMIDEVHMLTNHAFNAMLKTLEEPPPHVKFILATTDPQKIP
FT                   VTVLSRCLQFNLKQMPAGHIVSHLERILGEERIAFEPQALRLLARAAQGSMRDALSLTD
FT                   QAIAYSANEVTETAVSGMLGTLDQTYMVRLLDALAAADGPQILAVADEMALRSLSFSAA
FT                   LQDLASLLHRIAWAQFAPASVLDEWPEAADLRRFAELLSPEQVQLYYQIATVGRGELGL
FT                   APDEYAGFTMTLLRMLAFEPATTGGGAPAGGVPARVAGAAPKSGARAAAAVGASAVPAV
FT                   TGATGATGAALAPKAAAARAATRAEAPPAAPARPATAERGDDASDGDAPVPAKANARAS
FT                   ADSRCDERDAQPPADSGSASGAASSAPPDTAFESAPRAAAPSAATPAAVPDARAPAAAS
FT                   AEDAVEAAAPAAPESRPPTPAAGAPVSRATGAAAALDVLRNAGMRVSSGRGAGAARPAA
FT                   GPAASPTKPAPRAQVSVPTPRARAATGDAPPNGAARAEARAESRGAPPPWEDIPPDDYV
FT                   PLSMDDGFIPPDDGFVPVFDSGPDDVRVAPKPAPAPPVDTRPLPEPIPLDAIGYDGEWP
FT                   TLAASLPLKGVAYQLAFNSELTAADGGTLKLAVPVPQYADAAQVAKLKAALADALGKPV
FT                   DVAVEVGPARRTAAALAAAERAKRQREAEQEMSADPFVQQLLREFGASIVEGSIRPVGA
FT                   EAGAADGASPTLH"
FT   gene            44640..44966
FT                   /locus_tag="BMA10229_A0046"
FT   CDS_pept        44640..44966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0046"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02778"
FT                   /db_xref="GOA:A2S286"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S286"
FT                   /protein_id="ABN02778.1"
FT                   /translation="MMKGQLAGLMKQAQQMQENMKKMQEQLALIEVEGQSGAGLVKVTM
FT                   TCRNEVRRVAIDPSLLADDKDMLEDLVAAAFNDAVRKAEATSQEKMSGMTSGLPLPPGF
FT                   KLPF"
FT   gene            44998..45600
FT                   /gene="recR"
FT                   /locus_tag="BMA10229_A0047"
FT   CDS_pept        44998..45600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BMA10229_A0047"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02939"
FT                   /db_xref="GOA:A2S287"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S287"
FT                   /protein_id="ABN02939.1"
FT                   /translation="MSIKPPSALSELVEALRALPGVGPKSAQRIAYHLMQHDREGAERL
FT                   GRSLLFATEHLRHCEKCNTFTEAQICEVCSDPERDPALLCVVETPADQIMLEQTMTYRG
FT                   LYFVLMGRLSPLDGIGPKEIHFDRLVRRASDGIVKEVVLATNFTNEGEATAHYLGQTLK
FT                   ARGLAVTRLARGVPVGGELEYVDAGTIARAMLDRRTL"
FT   gene            45670..46875
FT                   /locus_tag="BMA10229_A0049"
FT   CDS_pept        45670..46875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0049"
FT                   /product="CAIB/BAIF family protein"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01584"
FT                   /db_xref="GOA:A2S288"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A2S288"
FT                   /protein_id="ABN01584.1"
FT                   /translation="MSATPGPLAGVKVLELGTLIAGPFAARLLAEFGAQVIKIEDPNGG
FT                   DPLRKWRKLYPEAGGTSLWWAVQARNKKSVTINLKSDEGKEIVRRLARDADIVVENFRP
FT                   GLLEKLGLGYDVLSADNPGLVMVRLSGYGQTGPYRDRPGFGAIAESMGGLRHITGYPEL
FT                   PPPRIGISIGDSIAALHGVIGALMALHHRNVNGGAGQVVDVALYEAVFNMMESVVPEYG
FT                   VYGLVRERTGASLPGIVPSNTYPCRDGSVVIGGNSDPIFKRLMKAIGRDDLADDPALAH
FT                   NDGRVPRTGEIDAAIGAWLAERTIDDALAVLNAADVPASRIYSVADMFDDPQFVARQMI
FT                   QRFKLADGAQIPLPNVTPKLSGTPGETRWLGPALGEHTDEVLGTLGYDAPAIAALRARR
FT                   AI"
FT   gene            complement(46827..46955)
FT                   /locus_tag="BMA10229_A0048"
FT   CDS_pept        complement(46827..46955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02245"
FT                   /db_xref="UniProtKB/TrEMBL:A2S289"
FT                   /protein_id="ABN02245.1"
FT                   /translation="MRESDGPERFARRARRRANACRAALGAQIARLARSAAIAGAS"
FT   gene            46980..47741
FT                   /gene="surE"
FT                   /locus_tag="BMA10229_A0050"
FT   CDS_pept        46980..47741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="BMA10229_A0050"
FT                   /product="5'/3'-nucleotidase SurE"
FT                   /EC_number="3.1.3.5"
FT                   /EC_number="3.1.3.6"
FT                   /note="identified by match to protein family HMM PF01975;
FT                   match to protein family HMM TIGR00087"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02093"
FT                   /db_xref="GOA:A2S290"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S290"
FT                   /protein_id="ABN02093.1"
FT                   /translation="MRILLSNDDGYLAPGLAALYEALRPLAEILVMAPEQNCSGASNSL
FT                   TLSRPLSVSRSAATGFYYVNGTPTDSVHVALTGMLDTKPDLVVSGINNGQNMGDDTLYS
FT                   GTVAAATEGIMFGVPAIAFSLVHKEWAHLGDAARVAAEIVRHYLDHPLPGQPLLNVNIP
FT                   NLPYEELKGWRVTRLGKRHPSQPVIRQTNPRGEPIYWIGAAGDALDASEGTDFHATASG
FT                   YVSITPLQLDLTHTQMLGATRDWARAGSGAS"
FT   gene            47738..48706
FT                   /gene="pcm"
FT                   /locus_tag="BMA10229_A0051"
FT   CDS_pept        47738..48706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcm"
FT                   /locus_tag="BMA10229_A0051"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="identified by match to protein family HMM PF01135;
FT                   match to protein family HMM TIGR00080"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03328"
FT                   /db_xref="GOA:A2S291"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S291"
FT                   /protein_id="ABN03328.1"
FT                   /translation="MSGERAKRFPLALEDLKREPRKPEGRVAERQAAGDAARQRLTAAA
FT                   AVPAAASPIVPERRAPHGGVFAAKPARAKQHAPAAPGAAKRAPQGGAKQGDRSAAPNVA
FT                   LSGALALTSERVRERMVERLRANGVADPRVLAAMSAVPRHMFVDPGLAAQAYEDAALPI
FT                   GHQQTISKPSVVARMIELAAAGRALERVLEIGTGCGYQAAVLSRVARDVYSIERVRPLY
FT                   ERAKLNLRPLRVPNIRLHYGDGRVGLPAAAPFDAIVIAAAGLDVPRALLEQLAIGGRLV
FT                   APVGEQAGEQVLTLVERVAPAQWRESRLDRVFFVPLKSGVI"
FT   gene            48718..49608
FT                   /locus_tag="BMA10229_A0052"
FT   CDS_pept        48718..49608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0052"
FT                   /product="putative lipoprotein NlpD"
FT                   /note="identified by match to protein family HMM PF01476;
FT                   match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02417"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A2S292"
FT                   /protein_id="ABN02417.1"
FT                   /translation="MLRAMQNNRSKVPLSLAQRAICMAAFALLGACATRLDQAPVVDRS
FT                   GSLGTTAATQPPAPLPPAPPGYYRVKPGDTLYRIALENGQNYRDIAAWNNLTNPNQIEV
FT                   DQLLRVSPTAGGATAAAPAAGAVVTPPLSSGPSNGAAAVPPIYGSGSTASAAPSAPAAS
FT                   ASSEPSAPAANGNVSFAWPVRGALLNTFDDSKNKGINIGGPAGEAVKAAADGRVVYAGN
FT                   GLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNSDSDRVMLHFEVR
FT                   RQGKPVDPLKYLPPQ"
FT   gene            49620..50699
FT                   /gene="rpoS"
FT                   /locus_tag="BMA10229_A0053"
FT   CDS_pept        49620..50699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoS"
FT                   /locus_tag="BMA10229_A0053"
FT                   /product="RNA polymerase sigma factor RpoS"
FT                   /note="identified by match to protein family HMM PF00140;
FT                   match to protein family HMM PF04542; match to protein
FT                   family HMM PF04545; match to protein family HMM TIGR02394;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02573"
FT                   /db_xref="GOA:A2S293"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012761"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2S293"
FT                   /protein_id="ABN02573.1"
FT                   /translation="MPKSKRHDPQAESEKISRAKQASVERTGASADEDEDAADNERDYE
FT                   SRDADPDESGEGRGDAQPDLDDFRALLQAELTADTIQHYLNRISVKPLLTVEEEQRYSR
FT                   LAKAGEFEARQVMIERNLRLVVSIAKGYLNRGVPLLDLIEEGNLGLMHAIEKFDPTRGF
FT                   RFSTYATWWIRQSIERAIMNQARTVRLPVHVIRELNQVLRAKRHLEKNSMSTGEAAERR
FT                   EASIDDIAYLTGKTAEEVTDILALNEHTASLDAPLDLDPASSLLDLLPDDQSQSPDAEV
FT                   QHRELETLTRAWLSRLSDKHRHVIERRFGLNHIEPATLEELADEMGLTRERVRQIQQEA
FT                   LVRLKRFFASNGVRKDAVL"
FT   gene            50707..51483
FT                   /locus_tag="BMA10229_A0054"
FT   CDS_pept        50707..51483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01650"
FT                   /db_xref="GOA:A2S294"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2S294"
FT                   /protein_id="ABN01650.1"
FT                   /translation="MTPILVFDIETIPDVDGIRRLEDLPADLADAEVAEHAFAARREKT
FT                   GSDFLPHHLQRIAAISCVFRDNNGFRVRSLGTPDDPEATLIQSFYRVIEKYTPQLVSWN
FT                   GGGFDLPVLHYRALVHGVAAPRYWDMGEDDRDFKWNNYLSRYHTRHLDLMDLLALYQPR
FT                   ASAPLDALAKLCGFPGKLGMDGSQVWTAFREGRIEEIRNYCETDVVNTYLLYCRFQQMR
FT                   GGLSPAEYTEEIALVKNTLVQEPAPHWAEYLAAFDA"
FT   gene            51493..51690
FT                   /locus_tag="BMA10229_A0056"
FT   CDS_pept        51493..51690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0056"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03620"
FT                   /db_xref="UniProtKB/TrEMBL:A2S295"
FT                   /protein_id="ABN03620.1"
FT                   /translation="MRGVRAAAHRMGVARSVGFESPLVARQPRLAGRRFAPLEPLALLD
FT                   PFRSACASRRYASLNSSTIG"
FT   gene            complement(51657..52517)
FT                   /locus_tag="BMA10229_A0055"
FT   CDS_pept        complement(51657..52517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0055"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01148"
FT                   /db_xref="GOA:A2S296"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A2S296"
FT                   /protein_id="ABN01148.1"
FT                   /translation="MRLISWNVQWGRDANGTVDLARTVDAARGLGDFDVLCAQELTRGF
FT                   HALPGGPSGDQYAELAALLPGYAVFDAIGVDLPPLEPGAPRRQFGNALATRLPVERALR
FT                   HALPWPASAAAPSMPRCALEVTLRAPFGPLRVVVTHLEYYSAQQRLAQVDALRRLHREA
FT                   AAHARASAPPETPASPFAPSARAADAIVCGDFNSAYRSDAYRRFLAPFPDAPRFVDAWL
FT                   ARHPGKTPPMTAGVYDTAQWSEGPMTCDFAFVTDTLVRRLSRCEIDGTVRASDHQPIVL
FT                   ELSDA"
FT   gene            52595..53992
FT                   /gene="rumA"
FT                   /locus_tag="BMA10229_A0057"
FT   CDS_pept        52595..53992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="BMA10229_A0057"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF05958;
FT                   match to protein family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02320"
FT                   /db_xref="GOA:A2S297"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:A2S297"
FT                   /protein_id="ABN02320.1"
FT                   /translation="MSEAVPLSTRRASSAGDAPGRAPVLDIDSLDMEARGVGRVVDENG
FT                   EPGKVIFVEGALPGERVTYSSFRRKPTYEQAQVVDILRPSVMRTQPKCAFFGTCGGCSM
FT                   QHLDMRAQVAIKQRVLEDNLWHLAKLRAEAMFAPIHGPSWGYRYRARLTVRHVAKKGGV
FT                   LVGFHEKKSSYVADMTSCEVLPPHVSAMLVPLRRLVEQLSIRDRMPQIELAVGARVTAL
FT                   VLRVLEPINAADEALLREFADTHRVQFWLQPKGPDTVAPFYPLDAQLDYTLPEFGIRMP
FT                   FKPTDFTQVNHQINRVLVGRALRLLAPERGDRVLDLFCGIGNFTLPLARLAREVVGIEG
FT                   SDALTARALENAKENGVDGHTSFACRNLFEVTADDLRALGAFDKFLVDPPREGALAVSK
FT                   ALAEIAQSGAGPLPARIVYVSCNPSTLARDAGLLVHEAGYRLKGAGVVNMFPHTSHVES
FT                   IALFERD"
FT   gene            complement(54066..54764)
FT                   /locus_tag="BMA10229_A0058"
FT   CDS_pept        complement(54066..54764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0058"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01027"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02904"
FT                   /db_xref="GOA:A2S298"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A2S298"
FT                   /protein_id="ABN02904.1"
FT                   /translation="MNDYPYNFGRGGAIGTAETRNRVLRNTYWLLALSMVPTVLGAWVG
FT                   VATGFSLFAATSPMMSLLAFFAIAFGFMFAIERTKNSSAGVFVLLGFTFFMGLMLSRLL
FT                   SFILGFSNGPSLIMLAFGGTGVIFAAMATVATVSKRDFSGLGKWLFVGAIVLLLAMVAN
FT                   MFLQLPALMLTVSVLAIVIFSAYMLFDVQRVVNGGETNYISATLAIYLDLYNVFTNLLA
FT                   LLGIFGGNRN"
FT   gene            55013..55438
FT                   /gene="ndk"
FT                   /locus_tag="BMA10229_A0059"
FT   CDS_pept        55013..55438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="BMA10229_A0059"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="identified by match to protein family HMM PF00334"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01762"
FT                   /db_xref="GOA:A2S299"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S299"
FT                   /protein_id="ABN01762.1"
FT                   /translation="MALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRA
FT                   DAEKFYAVHAERPFFKDLVDFMISGPVMIQVLEGEDAILKNRDLMGATDPKKAEKGTIR
FT                   ADFADSIDANAVHGSDAPETARAEVAFFFPEMNVYSR"
FT   gene            55480..56616
FT                   /locus_tag="BMA10229_A0060"
FT   CDS_pept        55480..56616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0060"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00048"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00829"
FT                   /db_xref="GOA:A2S2A0"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2A0"
FT                   /protein_id="ABN00829.1"
FT                   /translation="MAGETIVNLLDLDAEGLVAYCGSLGEKAFRAKQLQRWIHQYNAAD
FT                   FDGMTDLAKSLREKLKGRAVIGTPDILSDHVSADGTRKWLINVGNGNAVETVFIPEETR
FT                   GTLCVSSQAGCAVNCRFCSTGKQGFSRNLSTGEIVGQLRMAEFALRASLGRAPGPNGKA
FT                   ERVITNVVMMGMGEPLLNYSAVVPAMRLMLDDNAYGLSRRRVTLSTSGVVPMMDRLGAE
FT                   LPVALAVSLHAPNDALRDELVPLNKKHPLRELMAACQRYLKVAPRDFITFEYCMLDGVN
FT                   DTEAHARELLAVTRDVPCKFNLIPFNPFPESGLVRSKTEQIKRFAQVLIDAGVVTTIRK
FT                   TRGDDIDAACGQLAGAVKDRTRLAERTGASKIIEVRAV"
FT   gene            56683..57846
FT                   /locus_tag="BMA10229_A0061"
FT   CDS_pept        56683..57846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03614"
FT                   /db_xref="GOA:A2S2A1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2A1"
FT                   /protein_id="ABN03614.1"
FT                   /translation="MCDNGGAVSPAGAGAGVQARRIDARMRMSEPQPSKSPETNAGEKP
FT                   ATAGGGMASVAAVGARLAELRRTKGWSVDDVSARLKVAAPKLQALEAGDTSQLPGTTFA
FT                   LGLVRSYAKMLGVDPEPFAQALRREKGVPEVDLSMPASAGTDLPRGRVSIPLGGASRGR
FT                   PWLWAVAAVVVALVAAAMWRTGGDSSNWLARFKSSGAGEAASAAHAQQEGAASDLPASA
FT                   AVSGTVMQAGALAASATQSVGGASAGDTAAASVPAAGAAPVVASAAAALSASAPVAAAQ
FT                   PAQGAQQPAASAADGASAAVTAAPGQSVVALKVAQDCWFSVRDKNGKELFSALVRAGET
FT                   RQVAGDAPLKVTIGNKAGLESVAFDGKPVDPAKYSTARGNVARFALP"
FT   gene            57936..59240
FT                   /gene="ispG"
FT                   /locus_tag="BMA10229_A0062"
FT   CDS_pept        57936..59240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="BMA10229_A0062"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="identified by match to protein family HMM PF04551;
FT                   match to protein family HMM TIGR00612"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03067"
FT                   /db_xref="GOA:A2S2A2"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2A2"
FT                   /protein_id="ABN03067.2"
FT                   /translation="MQSEAQSPRSSQICSTEPVFGGHAPRRVSHAVDVRWGGTLVTIGG
FT                   AAPVRVQSMTNTDTADAIGTAIQVKELANAGSELVRITVNTPEAAAAVPAIREQLDRMG
FT                   VTVPLVGDFHYNGHLLLRDYPDCAQALSKYRINPGNVGQGAKRDSQFAQMIEAAIKYDK
FT                   PVRIGVNWGSLDQDLLARMMDENGARAEPWEAQSVMYEALIQSAIGSAERAVELGLGRD
FT                   KIVLSCKVSGVQDLVAVYRELSRRCGFALHLGLTEAGMGSKGIVASTAAIGLLLQEGIG
FT                   DTIRISLTPEPGAPRTGEVVVGQEILQTMGLRSFAPMVVACPGCGRTTSTLFQELALRI
FT                   QTYLREQMPVWRSEYPGVEKMNVAVMGCIVNGPGESKHANIGISLPGSGENPAAPVFVD
FT                   GEKVKTLRGEHIAEEFQQIVSDYVARTYGRAAAQN"
FT   gene            59259..60599
FT                   /gene="hisS"
FT                   /locus_tag="BMA10229_A0063"
FT   CDS_pept        59259..60599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="BMA10229_A0063"
FT                   /product="histidine--tRNA ligase"
FT                   /EC_number="6.1.1.21"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM TIGR00442"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03242"
FT                   /db_xref="GOA:A2S2A3"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2A3"
FT                   /protein_id="ABN03242.1"
FT                   /translation="MTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQ
FT                   NIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFVDALNGENLTLRPENTAAVVRAAIEHNM
FT                   LYDGPKRLWYLGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIIMMCQRLWDDLG
FT                   LTGIKLEINSLGLAEERAAHRVELIKYLEQHVDKLDDDAQRRLYTNPLRVLDTKNPALQ
FT                   EIVRNAPQLIDFLGDVSRAHFDGLQQLLKANNLPFTINPRLVRGLDYYNLTVFEWVTDK
FT                   LGAQGTVAAGGRYDPLIEQLGGKPTAACGWAMGVERILELLKEEHLVPEQEGVDVYVVH
FT                   QGDAAREQAFIVAERLRDTGLDVILHCSADGAGASFKSQMKRADASGAAFAVIFGEDEV
FT                   ANGTVSVKPLRGTGAEGEKNVQQSVPVESLTEFLINAMVATAEDGDD"
FT   gene            60652..61281
FT                   /locus_tag="BMA10229_A0064"
FT   CDS_pept        60652..61281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02622"
FT                   /db_xref="GOA:A2S2A4"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2A4"
FT                   /protein_id="ABN02622.1"
FT                   /translation="MSYHDEQESIESLKAWWARWGNLTTWVAIAVLAAAAAWNGWNYWQ
FT                   RRQATQAAVLYEQAQQAVRSNDKAKISRVASDMEDKFGGTAYAQMTALEAAKALYGAGD
FT                   AAGAKAQLQWAADHAKDDEYKQIAKLRLASLLLDEKAYDAGLALLSGTPSDAFKGAVAD
FT                   RRGDLLAAQGKSDDAKAAYKLALDALPKDDASARQLVQFKLDALGG"
FT   gene            61326..62471
FT                   /locus_tag="BMA10229_A0065"
FT   CDS_pept        61326..62471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0065"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF01011;
FT                   match to protein family HMM TIGR03300"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01494"
FT                   /db_xref="GOA:A2S2A5"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017687"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2A5"
FT                   /protein_id="ABN01494.1"
FT                   /translation="MNLLKRYAAPVACAAAVLVFAACSSTKDARRVPTPLTEFKPVLDV
FT                   QQVWTASVGKGGRYSFSPVAVGDAVYVAGANGSVEKIDAKTGQQVWRTKIGSDLSAGVG
FT                   SDGNLTAVGALKGGVFVLGPDGKQLWKATVQGEIFSPPLVGNGLVIVRTIDGQVIAFAA
FT                   QTGEQKWTYRNRAVPLNLRVSAGMTFAGDAAVLAGFPGGGLVALNLQTGEPFWQTPVSF
FT                   PKGVTEVERINDVTGAPTLVGAETCAVTFQGQLGCFDANSGRPLWEKPFSSRSGVAQDD
FT                   TVVVGGDDWSVVSAYDVATGKALWRNDKLKSRDVGVPYLLGRAVVLGDYKGFVHFLSRD
FT                   DGTFVARMKTDGSAIAAAPVLAGNTLVVLTQDGGVYGFRPR"
FT   gene            62746..64083
FT                   /gene="engA"
FT                   /locus_tag="BMA10229_A0066"
FT   CDS_pept        62746..64083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="BMA10229_A0066"
FT                   /product="ribosome-associated GTPase EngA"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00650; match to protein family HMM TIGR03594"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00811"
FT                   /db_xref="GOA:A2S2A6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2A6"
FT                   /protein_id="ABN00811.1"
FT                   /translation="MKPVIALVGRPNVGKSTLFNRLTRSRDALVADLPGLTRDRHYGEG
FT                   RVGARPYLVVDTGGFEPVAKDGILHEMARQTRQAVEEADVVVFIVDGRNGLAPQDKSIA
FT                   DYLRKTGRPIFLVVNKAEGMKYTAVASDFYELGLGDPRAISAAHGDGVNDMINEALEVA
FT                   YAGEPQESEEAAAARGIKIAIVGRPNVGKSTLVNTLIGEDRVIAFDMPGTTRDSIYVDF
FT                   ERNGKHYTLIDTAGLRRRGKVFEAIEKFSVVKTLQSISDANVVILLLDARQDISDQDAH
FT                   IAGFVVEQGRALVVGVNKWDGLDPHVRERTKADLARKLKFLEFAKFHFISAAEKTGIGA
FT                   LMRSVDDAYAAAMKKLPTPKLTRALIEAVEFQQPRRRGPVRPKLRYAHQGGQNPPIIVI
FT                   HGNALDAVTETYKRYLENRFRETFSLTGTPLRIEFRSSTNPYADKD"
FT   gene            64218..64457
FT                   /gene="hfq"
FT                   /locus_tag="BMA10229_A0067"
FT   CDS_pept        64218..64457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="BMA10229_A0067"
FT                   /product="RNA chaperone Hfq"
FT                   /note="identified by match to protein family HMM PF01423;
FT                   match to protein family HMM TIGR02383"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00737"
FT                   /db_xref="GOA:A2S2A7"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2A7"
FT                   /protein_id="ABN00737.1"
FT                   /translation="MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVV
FT                   LLRNTVTQMVYKHAISTVVPARPVNFHPDAEAAS"
FT   gene            64529..65692
FT                   /gene="hflX"
FT                   /locus_tag="BMA10229_A0068"
FT   CDS_pept        64529..65692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="BMA10229_A0068"
FT                   /product="GTP-binding protein HflX"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR03156"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03736"
FT                   /db_xref="GOA:A2S2A8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2A8"
FT                   /protein_id="ABN03736.1"
FT                   /translation="MINAALVGIDFGKTDFEASLEELSLLASSAGAHPAVTLTGRRSSP
FT                   DAALFVGSGKADELRLACEANDVEIVIFNHALAPAQQRNLERVLNRRVIDRTSLILDIF
FT                   AQRARSHEGKLQVELAQLQYLATRLIRAWTHLERQKGGIGLRGPGETQLETDRRLIGER
FT                   IKMLKSRLDKLRRQHHTQRRQRARSGTLSVSLVGYTNAGKSTLFNALTKAQAYAADQLF
FT                   ATLDTTSRRVYLGDEVGQIVVSDTVGFIRELPHQLVAAFRATLEETIHADLLLHVVDAS
FT                   SAVRLEQIEQVNDVLREIGADSIRQILVFNKIDAVPELAARGGAVERDEYGNISRVFLS
FT                   ARTGQGLDSLRAAIAEIATAEHLVGAAPLDGAPALPHEDHPVSEHGR"
FT   gene            65738..67087
FT                   /gene="hflK"
FT                   /locus_tag="BMA10229_A0069"
FT   CDS_pept        65738..67087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="BMA10229_A0069"
FT                   /product="ftsH protease activity modulator HflK"
FT                   /note="identified by match to protein family HMM PF01145;
FT                   match to protein family HMM TIGR01933"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01605"
FT                   /db_xref="GOA:A2S2A9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2A9"
FT                   /protein_id="ABN01605.1"
FT                   /translation="MNDYNERSTWRRMRALLSINDPRWGRGGNGDKPRANESKRPNGRD
FT                   DGPPDLDEMWRNFNRRLSGWFGGKGGGNNGFRPDNGRDARVGVGIVAGVLIAIYLGSGI
FT                   FIVQDGQTGVVLRLGQYKGSVGDGVHWRLPYPFESHEIVDTAQVRSIEIGRNNVVRLAN
FT                   VKDASMLTRDADIVDVRFAVQYRVGSPTDYLFHAVDPERSVSQAAQAAVREIVGARRAD
FT                   EVLAQDRDALRDALSKAIQRDLDRYRTGLVVTGVTVQSVSPPEQVQAAVDDIAKARQDS
FT                   EAAKNAAQAYASELLPRAQGDAAKMVDDAKSYAERVVAQAEGDAERFKQVYAQYSKAPA
FT                   VIRERMYLETMQEIYSNTTKVYVGNKAGNSVLYLPLDKIVEAGRQRAAEAASAGVAPPA
FT                   SGAQAPAPASAAAAASAPRVAAPAAASPASGSDSRSREALRSRSRTDDLQ"
FT   gene            67104..68003
FT                   /gene="hflC"
FT                   /locus_tag="BMA10229_A0070"
FT   CDS_pept        67104..68003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="BMA10229_A0070"
FT                   /product="ftsH protease activity modulator HflC"
FT                   /note="identified by match to protein family HMM PF01145;
FT                   match to protein family HMM TIGR01932"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00706"
FT                   /db_xref="GOA:A2S2B0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2B0"
FT                   /protein_id="ABN00706.1"
FT                   /translation="MNRIIALVVAIVIVALVASSTVLVVDPRHTAVLSSRDGGTPALAG
FT                   PGLHFKLPQPLQTATLVDVRVQTLDSADPLSLATKDKSDVLVSPVVKYRIADALKYYKE
FT                   TGGAPRGEADRLTAAAKGALGAAFAKRDLDDALGSQRAIADDAKRALQADAAPLGIDIV
FT                   DVQLTRVDLPAAQADGAYQRMTAELQREADRERAEGAAQAEEIKAEAARQQQTILAEGY
FT                   KSAQSIKGEGDAKAASIAADAFGRDPQFYQFYASLQAYRNSFKPNDVIVVDPDSEFFRF
FT                   MRSPTGGAAAPAAAPRNR"
FT   gene            68028..68219
FT                   /locus_tag="BMA10229_A0071"
FT   CDS_pept        68028..68219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03063"
FT                   /db_xref="GOA:A2S2B1"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2B1"
FT                   /protein_id="ABN03063.1"
FT                   /translation="MDLAGSLLLALALMLIIEGAFPFVFPSAWRDTFRRIAERPPHHIR
FT                   IGGFIVMALGLVLLLLVT"
FT   gene            68331..69479
FT                   /gene="hisZ"
FT                   /locus_tag="BMA10229_A0072"
FT   CDS_pept        68331..69479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisZ"
FT                   /locus_tag="BMA10229_A0072"
FT                   /product="ATP phosphoribosyltransferase, regulatory
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM TIGR00443"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02139"
FT                   /db_xref="GOA:A2S2B2"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2B2"
FT                   /protein_id="ABN02139.1"
FT                   /translation="MSTWLLPENIADVLPSEARKIEELRRRLLDRFRSYGYEMVMPPLL
FT                   EYLESLLTSGGNELRLRTFKLVDQVSGRTLGLRADMTPQVARIDAHLLNRQGVTRLCYA
FT                   GPVLHTRPRGLHASREQLQIGAEIYGHAGLEADQEIQQLMLDALHLTGLKKIRLDLCHA
FT                   GVLAALFARDAAAAERGEALYEALAGKDVPRLNELTDDLGADTRAALRALPRLYGDASV
FT                   LDDARRLLPALPEIARALDDLAHLAAQVKDAEVAIDLADLRGYAYHSGAMFAAYVDGVP
FT                   NAVAHGGRYDHVGQAYGRARPATGFSLDLREIARISPVEARGAAILAPWKQDDALRAAV
FT                   GALRDAGEVVIQALPGHDHVLDEFACDRALVERDGAWVIEPR"
FT   gene            69604..70950
FT                   /gene="purA"
FT                   /locus_tag="BMA10229_A0073"
FT   CDS_pept        69604..70950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="BMA10229_A0073"
FT                   /product="adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01977"
FT                   /db_xref="GOA:A2S2B3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2B3"
FT                   /protein_id="ABN01977.1"
FT                   /translation="MSASAVNVTPGRNVVVVGTQWGDEGKGKIVDWLTDHAQGVVRFQG
FT                   GHNAGHTLIIGGKKTILRLIPSGIMREGVACYIGNGVVLSPEALFKEIGELEEAGLSVR
FT                   ERLFISEATTLILPYHIAIDQAREARRGAGKIGTTGRGIGPAYEDKVGRRALRVQDLFD
FT                   ARTFADRLRENLDFHNFVLTQYLGGAAVDFQATLDTMLGYADRLKPMVTDVSRRLYEEN
FT                   HAGRNLLFEGAQGTLLDIDHGTYPFVTSSNCVAGAAAAGAGVGPQKLDYILGITKAYCT
FT                   RVGSGPFPSELYDADNPSRQDQIGITLANVGKEFGSVTGRPRRTGWLDAAALRRSIQIN
FT                   GVSGLCMTKLDVLDGLDEVKLCVGYKIDGEDVDLLPRGAAEVARCEPVYETFGGWKEST
FT                   VGIDSWDALPANARAYLTRVQEVAGVPIDMVSTGPDRDETILLRHPFKV"
FT   gene            70951..71550
FT                   /locus_tag="BMA10229_A0074"
FT   CDS_pept        70951..71550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0074"
FT                   /product="phosphoribosyl transferase domain protein"
FT                   /note="identified by match to protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00956"
FT                   /db_xref="GOA:A2S2B4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2B4"
FT                   /protein_id="ABN00956.1"
FT                   /translation="MQMTQNLTASITMSDPRNDDKNLWVGWDEYHRLIEMLALAVHDSG
FT                   WKFDKILCLARGGLRVGDQLSRIYDLPLAILATSSYREAAGTQQGDLDIAQYITMTRGE
FT                   LTGNVLLVDDLVDSGVTLARVQQHLKERYPAVTAVRSAVLCYKGCSKVKPDYHVQYLPT
FT                   NPWIHQPFEEWDTVRPHNLAAWIKRGNAQRDDASAA"
FT   gene            complement(71682..71858)
FT                   /locus_tag="BMA10229_A0075"
FT   CDS_pept        complement(71682..71858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0075"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03344"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2B5"
FT                   /protein_id="ABN03344.1"
FT                   /translation="MIRVGHKSGINPCWGRKNERYSNWARKNAAHWCCQHTTCCGAPSV
FT                   AWGRNAPCRDGAS"
FT   gene            71841..73733
FT                   /gene="kup"
FT                   /locus_tag="BMA10229_A0076"
FT   CDS_pept        71841..73733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kup"
FT                   /locus_tag="BMA10229_A0076"
FT                   /product="potassium uptake protein"
FT                   /note="identified by match to protein family HMM PF02705"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02370"
FT                   /db_xref="GOA:A2S2B6"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2B6"
FT                   /protein_id="ABN02370.1"
FT                   /translation="MTDTNHSSMRQHSLQSLAIAAIGVVFGDIGTSPLYSLKEAFSPAH
FT                   GIPLTPSAILGVISLLFWAIILVVGIKYVLFVMRADNNGEGGVLALMALSLRPLNPKSR
FT                   ITGLMMALGIFGACMFYGDAVITPAISVMSAVEGLEVATPQLSHLVLPITIVILIALFW
FT                   IQRHGTATVGKLFGPIMLLWFVTIAALGIYHIARAPMIVSAINPYYAFSFMSEHVLLAY
FT                   VVLGSVVLVLTGAEALYADMGHFGAKPIRLAAYVLVMPSLVLNYFGQGALLLLDPKAIE
FT                   NPFFLLAPQWAALPLVVLSTVATVIASQAVISGAYSLTSQAIQLGYVPRMKILHTSELA
FT                   IGQIYVPVVNWLLLFVILCIVIGFKSSDNLAAAYGIAVTATMVITTILAAVVMVKVWNW
FT                   NKLLVAMIIGVFLVIDLGFFGANLLKVEQGGWLPLGIGALLFFLLMTWYKGRHIVKERT
FT                   AADGIPLAPFLQGLLAHPPHRVSGTAIYLTGNDTLVPVSLLHNLKHNKVLHERTIFMTF
FT                   VTRDIPYVKDHERVTVHDAGEGLYIVKAEYGFNETPDVKAVLEEVARQRGMTFELMDTS
FT                   FFLARETVVPTHLPGMSIWRERVFAWMHQNAAKPTDFFAIPANRVVELGTKIEI"
FT   gene            complement(73968..76292)
FT                   /locus_tag="BMA10229_A0077"
FT   CDS_pept        complement(73968..76292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0077"
FT                   /product="putative tex protein"
FT                   /note="identified by similarity to SP:Q45388; match to
FT                   protein family HMM PF00575; match to protein family HMM
FT                   PF09371"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02267"
FT                   /db_xref="GOA:A2S2B7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2B7"
FT                   /protein_id="ABN02267.1"
FT                   /translation="MTETVALKIVQRIADELSVQPRQVAAAVQLLDEGSTVPFIARYRK
FT                   EVTGNLDDTQLRQLEERLLYLRELEERRATIIASIDEQGKLTDELRAAIDAADSKQTLE
FT                   DLYLPYKPKRRTRAQIAREAGLEPLAQALLANPLLDPQAEAAAYVNTDRGVADVKAALD
FT                   GARDILSEQFGETAELLGKLRDYLFERGVVSSAVVDGKQGEEGEKFRDYYDYSETIKTV
FT                   PSHRALALFRGRNAGVLTVKLGLGEELDAQVPHPGEAMIARHFGIANQNRPADKWLSDV
FT                   CRWCWRVKVQPHIETELLTQLRETAEHEAIRVFARNLKDLLLAAPAGPKAVIGLDPGLR
FT                   TGVKVAVVDRTGKLLATDTIYPHEPRRDWDGSLAKLARLAAQTQAELVSIGNGTASRET
FT                   DKLASELIAKHPELKLQKIVVSEAGASVYSASELAAKEFPELDVSLRGAVSIARRLQDP
FT                   LAELVKIEPKAIGVGQYQHDVNQRELARSLDAVVEDCVNAVGVDANTASAALLARVSGL
FT                   NSTLARNIVDYRDANGPFPSREHLRRVPRLGDKTFEQAAGFLRINGGENPLDRSSVHPE
FT                   AYPVVERMLAKISKRIDDVLGNRDALAGLSPAEFVDERFGLPTVRDILSELEKPGRDPR
FT                   PEFKTATFREGVEKVSDLAPGMVLEGVVTNVAAFGAFVDIGVHQDGLVHVSAMSTKFIK
FT                   DPHEIVKAGQVVKVKVLDVDVKRQRISLTMRLDDDAAPSAPGNRGGAERGAMRGGARAQ
FT                   RSREPEPAGAMAAAFAKLKQR"
FT   gene            76299..76421
FT                   /locus_tag="BMA10229_A0078"
FT   CDS_pept        76299..76421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0078"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01539"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2B8"
FT                   /protein_id="ABN01539.1"
FT                   /translation="MCVYCLQKSPGPAGCAVGRTGRVNGAGHFAINAKGSSRGC"
FT   gene            76432..77181
FT                   /locus_tag="BMA10229_A0079"
FT   CDS_pept        76432..77181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0079"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02444"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2B9"
FT                   /protein_id="ABN02444.1"
FT                   /translation="MIRSFPTTLPTSRFSVVAFAVALAATLSCAPVAGVAQTPAPAATS
FT                   PAAAADAGAFAAPANFDARQKVLNQRTAENDYRYAVAQHNCYSTFFVNHCLDKARETMR
FT                   AERANISQEQLALDDEQRAVRAQERDRQLALKEAERQAQAPQRAADEQANAAAYEGKQQ
FT                   ENALKRAQRDAQAPQRAANQQAYDAKQAEFQRKLDAAHAQAAKDAQQRAENAARYEQKQ
FT                   RDAAQHKADVDERQRQAAEKAKQKQQQ"
FT   gene            77290..77505
FT                   /locus_tag="BMA10229_A0080"
FT   CDS_pept        77290..77505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03145"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2C0"
FT                   /protein_id="ABN03145.1"
FT                   /translation="MQTRSAETQQELYNRLVSLQELHQQLAREIEQKEGRSDIDDLTLH
FT                   RLKKEKLLAKDKIIMLQSQLEPDKRA"
FT   gene            77568..79826
FT                   /locus_tag="BMA10229_A0081"
FT   CDS_pept        77568..79826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0081"
FT                   /product="putative ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01878"
FT                   /db_xref="GOA:A2S2C1"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2C1"
FT                   /protein_id="ABN01878.1"
FT                   /translation="MNSPLDAHPDARRDDPSAARSPTSGAATGAYTPSVKRIVELDAIF
FT                   GEGGLFARALDNYRPRASQIDMARAVAAAMEASGKLMPEPEIFETRKRPARRMQDGAAA
FT                   GRDDACAAPPGDESADSGDNTLIVEAGTGTGKTYAYLVPAMLWGGKVIVSTGTKHLQDQ
FT                   LFQRDIPTVRDALAVPVTVAMLKGRANYLCHYYLQRTADNGRLPSRQDTAYLQDILRFA
FT                   KITRSGDKAELASVPETSPVWSMVTSTRDNCLGQECPHYKDCFVMQARREAQQADIVVV
FT                   NHHLFFADIMLRDTGMAELLPSANTIIFDEAHQLPETATLFFGETLSTTQLLELARDAV
FT                   AEGLAHARDAVEWVKLGGALERAARDVRLAFADDGIVRMSLAQLGDGHPLFGALDALDA
FT                   ALDALSTALAGQAERAESIAACQRRARELQDLLAGWVAPGAQDGAADAADAKPAAQTGE
FT                   HGDPAEKVRWVEVFAHTVQLHETPLSVAPIFAKQRAGVPRAWIFTSATLSVRGDFTHYA
FT                   AQMGLSSRRSMTLPSPFDYQAQGLLYVPRNLPQPSSPAFTDAVFDAALPAIEASGGGVF
FT                   VLCTTLRAVDRIAMKLRDTIDARGWSTPLLVQGDASRTELLDRFRAYGNAILVGSQSFW
FT                   EGVDVRGDALSLVVIDKLPFAPPDDPVLAARLDALTKKGLSPFAVHQLPQAVITLKQGA
FT                   GRLIRAETDRGVLMICDTRLVDKPYGRRIWQSLPPFKRTREIDVVREFFAERREAEQA"
FT   gene            complement(80002..80826)
FT                   /gene="comL"
FT                   /locus_tag="BMA10229_A0082"
FT   CDS_pept        complement(80002..80826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comL"
FT                   /locus_tag="BMA10229_A0082"
FT                   /product="competence lipoprotein ComL"
FT                   /note="identified by match to protein family HMM TIGR03302"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01694"
FT                   /db_xref="GOA:A2S2C2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2C2"
FT                   /protein_id="ABN01694.1"
FT                   /translation="MMHSTKRVAKPAAAWAALAAAAALVAGCHGLPQKSDETATWSNNK
FT                   LYSEAQDALTGGDWGKCAKYFEALQGRDPFGHFAQQAQINVAYCNWKDNETATADQAVD
FT                   RFIQLHPDHPDVAYAYYLKGMIHFNDDLGLFGRFSGQDMSERDPQALRESYDAFKAVVD
FT                   RYPKSKYAPDAAARMRYIVNALASHEVHAADYYYRRGAYVAAINRAQLAIKEYKNAPAI
FT                   EDALHIMMLSYAKLNQPQLADDTKRVLASTFPDSPYVTGHARPGSKKSWWQF"
FT   gene            80898..82067
FT                   /locus_tag="BMA10229_A0083"
FT   CDS_pept        80898..82067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0083"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02819"
FT                   /db_xref="GOA:A2S2C3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2C3"
FT                   /protein_id="ABN02819.1"
FT                   /translation="MNARAGKSNRDDYSPSASPADASAGDSLDDDLTSDTLVAPARADT
FT                   GADAPRTVDVPLALAGERLDKALAQLFPEFSRSRLQQWIESDRVRVSGAPAKIRQPVPL
FT                   GATIELLPELLPEQLAFTPEPVPLSIVYEDDTIVVVDKPAGLVVHPAAGNWSGTLLNGL
FT                   LHRYADAAGLPRAGIVHRLDKETSGLMVVARTLAAQTDLVRQLQARTVKRRYFALAWGR
FT                   MPDEGTIDAPIGRDPRERTRMAVVTGAAGKPARTHFRTVDTTLWARQPVSAIHCDLETG
FT                   RTHQIRVHCAHVGHPLLGDPVYGRARGKRSVAPLPGGFARQALHAWRLGLVHPASGRSM
FT                   QWRAPLPADLAALVDALGFGADDAEFGDDDAVYDDGYDEGMPYADDDED"
FT   gene            82074..82910
FT                   /locus_tag="BMA10229_A0084"
FT   CDS_pept        82074..82910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0084"
FT                   /product="conserved hypothetical protein TIGR00726"
FT                   /note="identified by match to protein family HMM PF02578;
FT                   match to protein family HMM TIGR00726"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03541"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2C4"
FT                   /protein_id="ABN03541.1"
FT                   /translation="MTMLRPLTLADCVQPDWQAPPRVRALVSTRNGGVSEPPYGAWGGD
FT                   GGEVAGGMNLGRHTGDDPAHVEANRARLLALAGQSRAAWLEQVHGTEVVRAEDVLAAGE
FT                   GGAVRADASVAATPGAVCVVMVADCLPVLLCDDAGRAVGAAHAGWRGLVAGIVEKTAER
FT                   VAALAGGGADRLHAYLGPAIGPGAFEVGADVRSAFLDAAPLADYAATECAFAARAHAPG
FT                   KYLANLYALARLRLARVGVTRVSGGAACTATERERFYSYRRDRVTGRMAALIWLAD"
FT   gene            83427..85241
FT                   /gene="phbC"
FT                   /locus_tag="BMA10229_A0085"
FT   CDS_pept        83427..85241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbC"
FT                   /locus_tag="BMA10229_A0085"
FT                   /product="poly-beta-hydroxybutyrate polymerase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM PF07167; match to protein
FT                   family HMM TIGR01838"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00609"
FT                   /db_xref="GOA:A2S2C5"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR010963"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2C5"
FT                   /protein_id="ABN00609.1"
FT                   /translation="MQQLFESWLGAWRSFADPARAAAGDAPSPSPSPFAAFQPPQPFAF
FT                   AMPAMPPMPPMPDWSGAAASFAGLAPVASVPPARLQKLQADYSRDCLALIQQASAATPT
FT                   VPELKDRRFSADAWKASPAHGFAAAWYLLNARYLQELADALETDPKTRERIRFTVQQWT
FT                   AAASPSNFLALNPEAQKNLVETQGESLRLGMMNLLADMQRGKISQTDESQFVVGKNLAV
FT                   TPGAVVYENDLIQLIQYTPTTATVFERPLLIVPPCINKFYILDLQPENSLVAHALSCGH
FT                   QVFLVSWRNADASVAHKTWDDYIDEGLLAAIDVVQQVSGREQINTLGFCVGGTMLATAL
FT                   AVLAARGEHPAASMTLLTSMLDFSDTGILDVFVDEAHVQMREQTIGGKGGAPAGLMRGV
FT                   EFANTFSFLRPNDLVWNYVVDNYLKGRTPAPFDLLYWNGDSTSLPGPMYAWYLRNTYLE
FT                   NKLREPDALTVCGEPVDLSRIDVPTFIYGSREDHIVPWQTAYASTSLLTGPLKFVLGAS
FT                   GHIAGVINPPAKRKRSYWSYGASAKELPESANDWLDAAVEHPGSWWPVWIEWLDQYGGK
FT                   KVKPRAHLGCARFPVIEPAPGRYVLQRD"
FT   gene            85338..86519
FT                   /gene="phbA"
FT                   /locus_tag="BMA10229_A0086"
FT   CDS_pept        85338..86519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbA"
FT                   /locus_tag="BMA10229_A0086"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02183"
FT                   /db_xref="GOA:A2S2C6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2C6"
FT                   /protein_id="ABN02183.1"
FT                   /translation="MTDVVIVSAARTAVGKSGGSLAKIAAPELGASVIRAVLERAGVKP
FT                   EQVSEVILGQVLTAGSGQNPARQALIAAGLPNAVPGMTINKVCGSGLKAVMLAANAVVA
FT                   GDAEIVVAGGQENMSAAPHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNKYHMGITAEN
FT                   VAKEYGITREAQDQFAALSQNKAEAAQKAGRFDDEIVPIEIPQRKGEPLRFATDEFVRH
FT                   GVTAESLASLKPAFAKEGTVTAANASGINDGAAAVLVMSAKKAEALGLEPLARIKAYAN
FT                   AGVDPSVMGMGPVPASRRCLERAGWSVGDLDLMEINEAFAAQALAVHKQMGWDTSKVNV
FT                   NGGAIAIGHPIGASGCRILVTLLHEMLKRDAKRGLASLCIGGGMGVALALERP"
FT   gene            86645..87385
FT                   /gene="phbB-1"
FT                   /locus_tag="BMA10229_A0087"
FT   CDS_pept        86645..87385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB-1"
FT                   /locus_tag="BMA10229_A0087"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF08659; match to protein family HMM TIGR01829"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03062"
FT                   /db_xref="GOA:A2S2C7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2C7"
FT                   /protein_id="ABN03062.1"
FT                   /translation="MSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGPNSPRRVKWL
FT                   EDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFRKMTRED
FT                   WQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKGQFGQTNYSTAKAGIHGF
FT                   TMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEKIVATIPVRRLGSPDEIGSIVA
FT                   WLASEESGFSTGADFSLNGGLHMG"
FT   gene            87522..88094
FT                   /gene="phaR"
FT                   /locus_tag="BMA10229_A0088"
FT   CDS_pept        87522..88094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaR"
FT                   /locus_tag="BMA10229_A0088"
FT                   /product="polyhydroxyalkanoate synthesis repressor PhaR"
FT                   /note="identified by match to protein family HMM PF05233;
FT                   match to protein family HMM PF07879; match to protein
FT                   family HMM TIGR01848"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03728"
FT                   /db_xref="GOA:A2S2C8"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2C8"
FT                   /protein_id="ABN03728.1"
FT                   /translation="MTTTKKTGERLIKKYPNRRLYDTETSTYITLTDVKQLVLEQEDFK
FT                   VIDAKSSEDLTRSILLQIILEEESGGVPMFSSSMLSQIIRFYGHAMQGMMGTYLEKNIQ
FT                   AFIDIQSKLADQSKNLYENNAMNPEVWSQFMNMQAPMMQGMMTSYIEQSKNMFVQMQEQ
FT                   MQNQAKTMFSSFPFKPATPPGSEPEKK"
FT   gene            88665..90056
FT                   /locus_tag="BMA10229_A0089"
FT   CDS_pept        88665..90056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0089"
FT                   /product="MiaB-like tRNA modifying enzyme YliG, TIGR01125"
FT                   /note="identified by match to protein family HMM PF00919;
FT                   match to protein family HMM PF04055; match to protein
FT                   family HMM TIGR00089; match to protein family HMM
FT                   TIGR01125"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02171"
FT                   /db_xref="GOA:A2S2C9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2C9"
FT                   /protein_id="ABN02171.1"
FT                   /translation="MENSLKSSGKPLAAPKVGMVSLGCPKALVDSEQIITQLRAEGYEI
FT                   SGTYDGADLVVVNTCGFIDEAVQESLDAIGEALAENGKVIVTGCLGAKKSASGSGLIAE
FT                   VHPKVLAVTGPHAVGEVMQAVHSHLPKPHDPFVDLVPAAGIKLTPRHYAYLKISEGCNH
FT                   RCSFCIIPSMRGELVSRPVAEVMLEAENLFKSGVKELLVISQDTSAYGVDVKYRTGFWN
FT                   GRPLKTRMTELVGALGELAAQYGAWVRLHYVYPYPHVDEIIPMMAQGPLKGHVLPYLDV
FT                   PFQHAHPEVLKRMKRLANAERVLERVQKWREICPDLTIRSTFIAGFPGETDAQFETLLD
FT                   FIREAELDRVGCFAYSPVEGASANALDGALPDDVREARRARFMEVAEEVSAARIARKIG
FT                   KTLKVLIDEVNAEGGIGRTAADAPEIDGVVYVEPAAKASKRYKVGEFVSVKITGADGHD
FT                   LWGEV"
FT   gene            90059..90985
FT                   /locus_tag="BMA10229_A0090"
FT   CDS_pept        90059..90985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0090"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02906"
FT                   /db_xref="GOA:A2S2D0"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2D0"
FT                   /protein_id="ABN02906.1"
FT                   /translation="MPATFPDVLALGEAMVEFNQARLGEPNYLQGFGGDTSNFCIAAAR
FT                   QGARAGFVSAVGGDHFGRLLLDLWRGERVDTSYVRVDDGAPTGVYFVSHGEHGHAFDYL
FT                   RAGSAASCYAIRDLPLDALAAARFVHLSGVSLAISTSACDAAFAAIAHARANGARVSFD
FT                   TNLRLKLWPLPRARAVMTEALRHTDVCLPSWDDVTALTGLDERDAIVDALLALGPRVVA
FT                   LKLGREGAYVATPGERRVVPGFVVDALDATGAGDCFGGAFVARLAAGDDPFSAARYANA
FT                   AAALSTQGFGAVAPIPSRDAVERLLGA"
FT   gene            91081..92265
FT                   /locus_tag="BMA10229_A0091"
FT   CDS_pept        91081..92265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0091"
FT                   /product="acetyl-CoA C-acyltransferase"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02395"
FT                   /db_xref="GOA:A2S2D1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2D1"
FT                   /protein_id="ABN02395.1"
FT                   /translation="MQREVVVVSGVRTAIGDFGGSLKDFAPTELGARVVREVLSRAQVS
FT                   GDEVGHVVFGNVVHTEPKDMYLARVAAINGGVAQHAPALTVNRLCGSGLQAIVSAAQNV
FT                   LLGDADIAVAGGAENMSRAPYSVPAARFGQRMGDAKLVDMMIGALNDPFQSIHMGVTAE
FT                   NVAAKYGITRDAQDALALESHRRASHATKSGYFKDQILPIEIASRKGTVVFDADEHVRH
FT                   DASLDDFTKLKPVFAKENGTVTAGNASGINDAAAAVVLMERGVADKRGAKPLARLVSYA
FT                   HAGVDPAYMGIGPVPATKKALERAGITVADLDVIEANEAFAAQACAVSNALGLDPAKVN
FT                   PNGSGISLGHPIGATGALITVKALYELQRIGGRYALVTMCIGGGQGIAAVFERL"
FT   gene            92282..92863
FT                   /locus_tag="BMA10229_A0092"
FT   CDS_pept        92282..92863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01350"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2D2"
FT                   /protein_id="ABN01350.1"
FT                   /translation="MKLITAIRGAALAAALATAAGLAFAQSSAARAAAAPGAADAAPAA
FT                   ATAQADAPPPAVPLKPNPAYARLPRYEGTVGGRPVVVRLGPKTDEPGVHGECQYLDTGA
FT                   VILLAGDRDGDTLEIEESDDGTNITGVWIGRFDPSGGLSADRMNADQSDPLPVALHPAG
FT                   AQSASAAVGAPQAGAPGQSVGGVSNLRTGE"
FT   gene            93164..94348
FT                   /gene="metC"
FT                   /locus_tag="BMA10229_A0093"
FT   CDS_pept        93164..94348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="BMA10229_A0093"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM TIGR01324"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00914"
FT                   /db_xref="GOA:A2S2D3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2D3"
FT                   /protein_id="ABN00914.1"
FT                   /translation="MTASIPKRALQTRVVQPDDRIPAGFESFVVPVARASTVVFPDLAT
FT                   MRNLDWRQDGQWRYGLHATPTSLALAQRLAEIEGGAHALLQPSGLCAITNVYFGLVKEG
FT                   DDVLIPDNAYGPNGDFGKWLAKDFGITARFYDPMIGAGIADLIQPNTRIVWLEAPGSVT
FT                   MEVPDVRAITAVARARGIVTAIDNTYSAGLAFKPFEHGVDISVQALTKYQSGGSDVLMG
FT                   ATITADGELHAKLKLARMRLGIGVSADDCSLVLRGLPSMQARFDAHSRSALSLARWLKT
FT                   RAEIATVLHPQLPDCPGHDTFMRDFTGAGGLFSVVFDERYDAAQVDRFVEALELFAIGW
FT                   SWGGACSLAMPYDVQSMRTGKWPHRGTLVRFYVGLEDEADLRADIERALTSALA"
FT   gene            complement(94612..95457)
FT                   /gene="serB"
FT                   /locus_tag="BMA10229_A0094"
FT   CDS_pept        complement(94612..95457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="BMA10229_A0094"
FT                   /product="phosphoserine phosphatase SerB"
FT                   /EC_number="3.1.3.3"
FT                   /note="identified by similarity to SP:P06862; match to
FT                   protein family HMM PF00702; match to protein family HMM
FT                   TIGR00338; match to protein family HMM TIGR01488"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01776"
FT                   /db_xref="GOA:A2S2D4"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR025138"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2D4"
FT                   /protein_id="ABN01776.1"
FT                   /translation="MTTNLVVQSTAPLSDAHHKPLAALAHGARVVALDAQSIRIERANP
FT                   AQRADIDAYCGTHALDYAFVDAARKLADFGLVAMDMDSTLITIECIDEIADFCGLKAEV
FT                   SAITEAAMRGEIKDFNESLTRRVALLAGLEASALERVYEERLRLSPGAESMLAGVKAAG
FT                   LKTLLVSGGFTFFTERLKARLGLDFAHSNTLEIVDGKLTGKVVGEIVNADVKARAVRET
FT                   CAALGIEPARAIVIGDGSNDLKMMAAGGFSIAFRAKPIVRSAASAAFDHVGLDGLLRLF
FT                   "
FT   gene            95500..96237
FT                   /locus_tag="BMA10229_A0095"
FT   CDS_pept        95500..96237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0095"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02670"
FT                   /db_xref="GOA:A2S2D5"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2D5"
FT                   /protein_id="ABN02670.1"
FT                   /translation="MRRTRYCSRLRPDASGWAPGGRHRGCPFERWRARRRARAPCVSDG
FT                   DFRFSSVGFAFSRCSLCGARRSMPCFRNSVLGIGIGAGAGAGAGAGASIWHSAIGTQFP
FT                   ALGSRLSALGSRLSALGSRADSVRYPTFAVGPLRRTERRHTKICDESNLLRASPMSSRA
FT                   IASRSGSMRASVTYRRFVSSAPGDIRAKREPGGRAAAAAGTNTGAPSCEWRACDCAPRT
FT                   PDADRASRGNTRCAAGATRAASR"
FT   gene            96308..96853
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0096"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(97521..98339)
FT                   /locus_tag="BMA10229_A0097"
FT   CDS_pept        complement(97521..98339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0097"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03649;
FT                   match to protein family HMM TIGR00245"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03257"
FT                   /db_xref="GOA:A2S2D7"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2D7"
FT                   /protein_id="ABN03257.1"
FT                   /translation="MNTPLQDLSLVDVGIAAALVAINGAISVALSLGLGRKLAWAAART
FT                   VVQLLAIGYVLGWVFGHPRWYVVLPLVALMTLIAGFAGAARGKRTYAGQRADSVLSIWA
FT                   SSWFVAAIGLFVVIRIHPWYAPQYAIPILGMILGNTLTGVSLGVERMMEELTARRDRVE
FT                   TALALGATRWEAAQDAARQAVRAGMLPTLNQMAVVGVVSLPGMMTGQVLAGQSPLQAVR
FT                   YQIVIMFLIAAASALGTVGAVLSTYRRLFSAEHRFLASRLVERERTANGG"
FT   gene            complement(98336..99031)
FT                   /locus_tag="BMA10229_A0098"
FT   CDS_pept        complement(98336..99031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0098"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02198"
FT                   /db_xref="GOA:A2S2D8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2D8"
FT                   /protein_id="ABN02198.1"
FT                   /translation="MTADVLIEARQLARRDAARGKTLLAPSDFALAAGERIALTGPSGS
FT                   GKSVFLRALALLDPIDGGELLWRGTRVPRPAIPRYRRSVAYVRQRPATAEGTVEDLLRY
FT                   PYSLAVYRDARFDAARVARLAAQAGRGDDFLRKAASELSGGEAQIAALLRVLQLDPDVL
FT                   LLDEPTSALDPDSTRAIEALVAAWFDAAPAARAYLWISHDPAQAARVGRRRLTMRAGVL
FT                   GDAATQDAR"
FT   gene            99165..101657
FT                   /locus_tag="BMA10229_A0099"
FT   CDS_pept        99165..101657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0099"
FT                   /product="AsmA family protein"
FT                   /note="identified by match to protein family HMM PF05170"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03225"
FT                   /db_xref="GOA:A2S2D9"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2D9"
FT                   /protein_id="ABN03225.1"
FT                   /translation="MALTRTLGKTAAWIVGIFAVLTAAVGVFIFTFDWNRAKPWINEQA
FT                   SASIGRPFEIRGDIKVGWRRPDGETGWRAWVPWPVFSASRIVIGNPPWAKAPNFATLDE
FT                   ARFELAVLPLLAHEVVIPTIELVNPALDIERLADGRNNWTFEFKQSAGPSPWKVQLRDF
FT                   GFAKGTVVYRDAITKADLSVAVDTLGQPIPLGDVLRQQEETSRAASAQRVGKRGAAQLA
FT                   AKAQAQIASDASAASAAGAPNASGAAAASGASGVNAAASAAKVSGNDRSRAARATAGAS
FT                   AASKPAAAASGGSAAAVAAGKAPAAGAGGAVASASASAASSASAVSTSAAVSGASGARG
FT                   ASGASAASAAEQRSAGPTYAFGLTVKGRYKGVPIDGTGKVGGVLSLRDASRPFPLQADV
FT                   KAGDTRLAIVGTLTDPVHLAAIDLRLWLQGSSMSHLYPLTGVTLPDTPPYATEGRLVGR
FT                   FKRAASTFRYENFNGRVGGSDLRGTLVYQQRAPRPLLSGELVSNLLQFSDLAPIIGADT
FT                   AASKARRGDTTKQPPGRVLPVETFRTDRWRALDADVKFTGRKLIKSAALPISDLYTHIV
FT                   MTDGVLSLEPLKFGVAGGSLATTAHLDGSAAPLKGRFSVAARHLKLKQLFPTQKVMQSA
FT                   LGEINGDAALSATGNSPAALAATSNGEVKMLMTDGAISRLLMEAAGLNVANVLYEKMFG
FT                   SHDVKINCAAVDFVATNGLLDTKLFAFDTDDALINIDGPIDLRNESMNLKVHPHTKGFR
FT                   VFSLRSPLYVKGTFKNPDVGVDAAALALRAGAMVGLGLVNPFAALIPLIAPSNNRDVPC
FT                   SELFAQLKAPQKAANARK"
FT   gene            101908..103707
FT                   /locus_tag="BMA10229_A0100"
FT   CDS_pept        101908..103707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0100"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02256"
FT                   /db_xref="GOA:A2S2E0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2E0"
FT                   /protein_id="ABN02256.1"
FT                   /translation="MRGMPPNGTRKPRTRRPIDLAPFLRFRSRPEKSAWPVRFRGPKRM
FT                   RRSDSSTPAKIPGFPSIYLLTGSAVLSTANITMQFGPKPLFENISVKFGEGNRYGLIGA
FT                   NGCGKSTFMKILGGDLEPSAGNVALEPNVRLGKLRQDQFAYEDVRVLDVVMMGHTEMWA
FT                   AMTERDAIYANPEATDDDYMHAAELEAKFAEYGGYDAEARAGALLLGIGIEEKFHSGPM
FT                   RDVAPGWKLRVLLAQALFSNPDVLLLDEPTNNLDINSIRWLEDTLNNYDSTMIIISHDR
FT                   HFLNSVCTHMADMDYGTLKVWPGNYDDYMLASAQARERQAAANARAKERVAELQDFVRR
FT                   FSANKSKARQATSRAKQIDKIKIEEFKPSSRQNPFIRFEFEKKLHNIAVVADSITKKYE
FT                   RTIFENFNLSVQPGERIAIIGENGAGKTTLLRALFGNLTLDHGTVKWAENANVGYMPQD
FT                   TYEEFPNDVTLMDWIDQYRKDGDDETMVRGTLGRLLFSADDIKKSVKVLSGGEKGRMIW
FT                   GKLMLGRHNVLLMDEPTNHMDMESIESLQIALEKFEGTLIFVSHDREFVSGLANRIIEV
FT                   TTEGKLVDFGGNYEDFLASKGLQ"
FT   gene            complement(104054..104452)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0101"
FT                   /note="hypothetical protein; this gene contains a premature
FT                   stop which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            104804..106240
FT                   /gene="aldA"
FT                   /locus_tag="BMA10229_A0102"
FT   CDS_pept        104804..106240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldA"
FT                   /locus_tag="BMA10229_A0102"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03774"
FT                   /db_xref="GOA:A2S2E2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2E2"
FT                   /protein_id="ABN03774.1"
FT                   /translation="MKTCEQFYIGGAWRPSTGKGMIDVIDSGTEAVIGRVPEGTAEDAK
FT                   AAVAAARAAFDGWAATPPAERARYLHKITENLKARSEELAQSITGEVGMPIKLSRAIQV
FT                   GGPIYNWGAYAKLAETFAFEEQVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAA
FT                   GCTVALKPSEVAPLNAFILAEAIHDAGLPAGVFNLVCGYGPVVGEALASDADVDMVSFT
FT                   GSTRAGKRVAELAAAGVKRVALELGGKSASVILDDADFAAAVKGTVSACYLNAGQTCSA
FT                   HTRMLVPESRYEEARDLAKAAAQAYVAGDPRDDATRLGALASSVQQKRVQDYIRRSIDE
FT                   GAELVTGGLGMPEGITRGFFVKPTVFGRVKPDATIAQEEIFGPVLSILTYRDEDDAVRI
FT                   ANDSPYGLGGAVWAGSDERAMRVARRIRTGQVDINGGAWNMAAPFGGFKQSGIGRENGV
FT                   YGLDEYLEYKSMQLRPHKRA"
FT   gene            106439..107629
FT                   /locus_tag="BMA10229_A0103"
FT   CDS_pept        106439..107629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0103"
FT                   /product="oxidoreductase, 2-nitropropane dioxygenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01626"
FT                   /db_xref="GOA:A2S2E3"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2E3"
FT                   /protein_id="ABN01626.1"
FT                   /translation="MTGSIPFPPLMIRGRSLLPIVQGGMGVGISAHRLAGSVAREGALG
FT                   TIASIDLRHHHTDLIERCKRHPDRETMEAANLEALAREIQRAKTWGEGRGMIAVNVMKA
FT                   VRSHADYVRIACEFGADAIVMGAGLPLDLPDMTQGHDIALIPILSDSRGIALVLKKWMK
FT                   KGRLPDAIVIEHPARAGGHLGVTSLDDMDDPRFEFARVIDETRQTFATLGLERERIALV
FT                   VAGGINSHEAVRAALAEGANGVQVGTPFAVTEEGDAHPNFKRVLANAKPDDIVEFLSVT
FT                   GLPARAVKTPWLERYLRHETRIRAKIGALKQRCPSALECLSVCGLRDGIERFGHFCIDT
FT                   RLAAALRGDVANGLFFRGREALPFGQAIRSVRDLLELLLTGTAPEAAANRPTFSLS"
FT   gene            107702..108346
FT                   /locus_tag="BMA10229_A0104"
FT   CDS_pept        107702..108346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0104"
FT                   /product="outer membrane protein, OmpW family"
FT                   /note="identified by match to protein family HMM PF03922"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01923"
FT                   /db_xref="GOA:A2S2E4"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2E4"
FT                   /protein_id="ABN01923.1"
FT                   /translation="MRRQTIRTCTTAIACAAGLAMIPSLSHAASPGEGINQGDIIARVR
FT                   GISIMPDERTSNTLSALNVGVNNAIVPELDFTYMIRDYLGVELILGTSRHQITSSLGDL
FT                   GGVGVLPPTLLLQYHFNHAGKVRPYVGAGINYTLFYNNGLHAGGEGIGINNHSFGPALQ
FT                   FGVDVQVTKKVFVNVDVKKIWMHTDATLGGQPLGRLNIDPLVVGVGVGMKF"
FT   gene            complement(108472..108675)
FT                   /locus_tag="BMA10229_A0105"
FT   CDS_pept        complement(108472..108675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06945"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00922"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2E5"
FT                   /protein_id="ABN00922.1"
FT                   /translation="MTSNLHDKPDSPCIGVCSTLFDEVCKGCGRTALEVANWVFMTDAE
FT                   KQAVWERITREGTAMRFQYDKL"
FT   gene            complement(109086..110393)
FT                   /locus_tag="BMA10229_A0106"
FT   CDS_pept        complement(109086..110393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0106"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="identified by match to protein family HMM PF01566;
FT                   match to protein family HMM TIGR01197"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03307"
FT                   /db_xref="GOA:A2S2E6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2E6"
FT                   /protein_id="ABN03307.1"
FT                   /translation="MNSRPLAARSPSSRRPSASGGPGGGRRWAAFVGAGVLVAVGYMDP
FT                   GNWATALAGGAGYGYALLGVVIAASLMAMLLQWLAARIGVVSGRDLAQLCRERFDPRAT
FT                   VLLWIAAEIAIVACDVAEVVGAAVALQMLLGVSLSTGVLVSAVGTLAMLGLERHGRRTL
FT                   EAAIASLIFFVGLCFVIEVALARPDWHAALAGAAPSPRLLREPGMLWLAAGILGATVMP
FT                   HNLYLHSMLVKHHASTRDEPSIRRALFGVNLDTFVSLGFAFVINAALLIVAAAVFHASG
FT                   HDDVTDLADAHRLIAPLVGNRWAGPLFAAALLACGLSATVTGTLAGQAIMEGFLKLTLP
FT                   RWQRALLTRALAIGPALAAVGLFGQHGSNQLLVASQVVLSLQLPLAMVPLVVFASSRAL
FT                   MGRWRVRGLPLAAAWMCAAAIVALNGALVWQVVAAG"
FT   gene            110420..111874
FT                   /gene="potF"
FT                   /locus_tag="BMA10229_A0107"
FT   CDS_pept        110420..111874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potF"
FT                   /locus_tag="BMA10229_A0107"
FT                   /product="putrescine ABC transporter, periplasmic
FT                   putrescine-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02934"
FT                   /db_xref="GOA:A2S2E7"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2E7"
FT                   /protein_id="ABN02934.2"
FT                   /translation="MHGRAAGAAFGRAGARPPTRNDERAPPEFRVGDPFGPRGLFSGWT
FT                   RADNPIKLRPPAASRRPAPCNRKVRMCSVCATTAGNFCGGDGLVVAFGVFKGRRETTRR
FT                   SGEADGDRIGSIRENGMKAKVAGRLTALALCAGATVAAAKDTQLNVYNWSDYIAKDTIP
FT                   NFEKQTGVKVRYDNYDSDDTLQAKLLTGNSGYDIVVPTGNYAGKQIQAGIFTPLDKSKL
FT                   PNLKYLDAQLMALVAGADPGNKYVVPWAYGTTGLGYNVDKAQKVLGKVPLDNWDILFKP
FT                   ENLSKLKTCGVSVLDAPDQMFAATLHYIGKDPMSTNPADYQAAMQVLKKIRPYITQFNS
FT                   SGYINDMVGGDICFAFGWSGDVVIAKHRALEAKKPYKLEYYVPKGGAPVWFDVMAIPKD
FT                   AKNKDAALQWINYIEDPKVHASITNAVYYPSANAQARKYVRPDVANDPAVYPPPDVVKT
FT                   LFLLKPLPPEIQRLQTRLWTELKSGR"
FT   gene            111965..113125
FT                   /gene="potG"
FT                   /locus_tag="BMA10229_A0108"
FT   CDS_pept        111965..113125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potG"
FT                   /locus_tag="BMA10229_A0108"
FT                   /product="putrescine ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402; match to protein
FT                   family HMM TIGR01187"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02096"
FT                   /db_xref="GOA:A2S2E8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2E8"
FT                   /protein_id="ABN02096.1"
FT                   /translation="MNSQSGAAMAGAPSYRPQTGADGRAENFVQIIDVVKKFGETVAVR
FT                   NVELSVRKGELFALLGSSGCGKSTLLRMLAGLETITSGKILIDGEDLAQMPPYKRPVNM
FT                   MFQSYALFPHMTVEANVAFGLKQEGVPKAELKERVRDALELVQMARYASRKPHQLSGGQ
FT                   QQRVALARSLVKRPKLLLLDEPMSALDKQIRQRTQIELVNILDKVGVTCIMVTHDQEEA
FT                   MTMAGRLAVMSEGQIVQIGTPHEVYEYPNCRFSAEFIGSTNLFEGVTVEDEPDHVFIES
FT                   PDLPCRLYVNHGITGPLGMPVTVSVRPERIALTRKPADGAYNWGRGVVTNVAYMGGYSL
FT                   YHVKLDSGKTVIANVSSLAIADLDSPGWGDEIYVRWSAAAGVVLTS"
FT   gene            113122..114051
FT                   /gene="potH"
FT                   /locus_tag="BMA10229_A0109"
FT   CDS_pept        113122..114051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potH"
FT                   /locus_tag="BMA10229_A0109"
FT                   /product="putrescine ABC transporter, permease protein
FT                   PotH"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01138"
FT                   /db_xref="GOA:A2S2E9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2E9"
FT                   /protein_id="ABN01138.1"
FT                   /translation="MNALSSLFAWPVRKFGLTGRTAVIAGPFFWLVLFFLVPFVLVVKI
FT                   SFAQLQLGIPPYTELTALADGVLSIKLNLQHYAFLFSDSLYFATYVNSVVVAAVTTLLC
FT                   LLIGYPMAYYIARSNPGTRNLLMMAVMLPFWTSFLIRVYAWIGILKNNGLLNNFLLWTG
FT                   LISTPIELYRTNVGVYIGMVYSYLPFLVMPLYAHLVKMDLRLLEAAYDLGAKPWKAFVQ
FT                   ITLPLSKNGIIAGCLLVFIPAVGEYVIPELLGGANTLMIGRVMWNEFFNNADWPMASAV
FT                   TCAMVLLLLVPMAMFQHFQAKEQEGHCR"
FT   gene            114048..114866
FT                   /gene="potI"
FT                   /locus_tag="BMA10229_A0110"
FT   CDS_pept        114048..114866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potI"
FT                   /locus_tag="BMA10229_A0110"
FT                   /product="putrescine ABC transporter, permease protein
FT                   PotI"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01849"
FT                   /db_xref="GOA:A2S2F0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2F0"
FT                   /protein_id="ABN01849.1"
FT                   /translation="MKPNRYLQVLMLAIGFGFLYIPIASLVVYSFNDSKLVTVWSGFST
FT                   RWYAALVEDDELIAAAWLSLKIAVMTAFASVFIGTWAGFVLARMGRFRGFALYSGMINA
FT                   PLVIPEVIQGISLLLLFIELGKWFGWPAGRGMFTIWLGHVMLCISYVAIIVQSRVRELN
FT                   PSLEEAALDLGATPFRVFFSITLPLISQALVSGWLLSFTLSIDDLVLSAFLSGPGSTTL
FT                   PLVVFSRVRLGLNPEMNALATLFIVAVTIGVVAANYVMLRQEKRRMAEAA"
FT   gene            complement(115118..115237)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0111"
FT                   /note="putative membrane protein, truncation; comparison of
FT                   this gene to its homologs suggests this gene has been
FT                   truncated"
FT   gene            115349..115612
FT                   /locus_tag="BMA10229_A0112"
FT   CDS_pept        115349..115612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0112"
FT                   /product="Transposase subfamily"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03921"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABN03921.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            115636..116469
FT                   /locus_tag="BMA10229_A0113"
FT   CDS_pept        115636..116469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0113"
FT                   /product="IS1404 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03459"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABN03459.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            116753..117253
FT                   /locus_tag="BMA10229_A0114"
FT   CDS_pept        116753..117253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0114"
FT                   /product="putative peptidase"
FT                   /note="identified by match to protein family HMM PF01478"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01118"
FT                   /db_xref="GOA:A2S2F3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2F3"
FT                   /protein_id="ABN01118.1"
FT                   /translation="MIHLFSIGFFFAWAAAVAIADCRDRRIPNELVLVGLAAVIIFTVC
FT                   RQNPFGTTLSGALIGGAVGLVSLFPFFALRVMGAADVKVFAVLGAWCGLSALPRLWVVA
FT                   SVAAGVHALALMLLTRTPPGSLGRGGAPAFALGARRAAPYAAFLVAPAAAWLAYLIHTG
FT                   GTR"
FT   gene            117250..117717
FT                   /locus_tag="BMA10229_A0115"
FT   CDS_pept        117250..117717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07811"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01593"
FT                   /db_xref="GOA:A2S2F4"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2F4"
FT                   /protein_id="ABN01593.1"
FT                   /translation="MTRALGRLRSPRRQRGATAIEFAILFPMFFLILYGIITYGMIFAA
FT                   QQSLTLAATEGARAALNYQVAQTQSAALGLRAAAACTAANNLTGWLSGATCTTSTNYTC
FT                   SYDSTMYCIQVTLTYPYAANPLVPAVALFDAVLPTTLTSRATVQINPTNII"
FT   gene            117795..118694
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0116"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF08666; match to
FT                   protein family HMM TIGR03177"
FT   gene            118758..120083
FT                   /locus_tag="BMA10229_A0117"
FT   CDS_pept        118758..120083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0117"
FT                   /product="type II/III secretion system protein"
FT                   /note="identified by match to protein family HMM PF00263"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00809"
FT                   /db_xref="GOA:A2S2F6"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2F6"
FT                   /protein_id="ABN00809.1"
FT                   /translation="MKNKLIAWAVAFGVLLSFAARAAETGTIELAAGTQRQIAVGHGVQ
FT                   RVAIADPNVADVLVIKGGRGGVLLVAKAAGTTSLMVWERGRDEPAAYTVNVVSGAARAL
FT                   LDGGSPSVKAYNGTAVVAGSAATLDAHARALAVGKGMAGKDGGVLDVSTVGGKNVVQVD
FT                   VRVVEFSRSVLKQAGLNFFKQNNGFTFGSFAPAGLASVTGGGTSSMSVSANIPIASAFN
FT                   LVVGSATRGLFADLSILEANNLARVLAQPTLVALSGQSASFLAGGEIPVPVPQSLGTIS
FT                   IDWKPYGVGLTLTPTVLSPRRIALKVAPESSQLDFVHSITINGVTVPALTTRRADTTVE
FT                   LGDGESFAIGGLIDRETTSNVDKVPFLGDLPIIGTFFKHLSYQQNDKELVIIVTPHLVA
FT                   PIAKNASLPATPGELSEQRDGPVWRSYLGGVLSPDAGPGFSK"
FT   gene            120171..121388
FT                   /locus_tag="BMA10229_A0118"
FT   CDS_pept        120171..121388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01663"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031580"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2F7"
FT                   /protein_id="ABN01663.1"
FT                   /translation="MAEPAVTDYFVCASPHGEHVSWLAQTLVSAGTVEPAPLEPTALAQ
FT                   RIAGLNPVLVFVDFSGGHAQAASAAAAALRVSHPGLPIVALGSLGEPESALAALRAGVR
FT                   DFIDFSAPAEDALRITRGLLDHVGDQPSRHGRLIALLGARAGMGASTLAANLSVLVQKR
FT                   SAALGRQTALVDLGLPAGDGALFLNTRCEFDFVEAVRNLRRFDRTFVNTALARHASGVA
FT                   LTSLPPNLAGLRDVSYASCVGLMNRLRAFFDCQIVDLGGFSNRDFVAQTANAADESWLL
FT                   CDQGVASVVSAVELLESLRDTGVDTENVRLVVNQYDPALGLAPAQIAERLGLALAATLP
FT                   SRRVPIGHAANQGKLIVDVAERDPYVRALEPLVERATGGAGAAAPRPAGGLSALRRFIQ
FT                   PTSKRS"
FT   gene            121726..122733
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0119"
FT                   /note="putative secretion system protein; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00437"
FT   gene            122726..123646
FT                   /locus_tag="BMA10229_A0120"
FT   CDS_pept        122726..123646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0120"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03613"
FT                   /db_xref="GOA:A2S2F9"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2F9"
FT                   /protein_id="ABN03613.1"
FT                   /translation="MSSAALWALALALLCVAGAFALWRRGEANRERAHAARYIDSRLEP
FT                   GARAEKPAEGLARWRERAADAWLNVSNRAGVSEIRAPLAALAATTAVATLWAGLRGGLL
FT                   AACAALVAGATLAVFWLVSRMQKRRLRIVRQLPSFLDGIVRLVTLGNSVPAAFQATLQT
FT                   TEAPLRGCLDHVSRMLRSGVEIDRAMVSIAALYRIKEFELVGSVLRLSVKYGGRADVML
FT                   DRMAVFMRDLEQAERELVAMSAETRLSAWVLGALPVGIGSFVIATNPKYFSAMWLDPTG
FT                   RQLVYLAFILQIAGGYWLYRLARLR"
FT   gene            123652..124662
FT                   /locus_tag="BMA10229_A0121"
FT   CDS_pept        123652..124662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0121"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01168"
FT                   /db_xref="GOA:A2S2G0"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2G0"
FT                   /protein_id="ABN01168.1"
FT                   /translation="MDPSRLGAIALVLGAIGVLMLAALAIMQAVLARRTGRTLADALDQ
FT                   RAAALEAAAARVAAGAAGAARAGMPEAAPDARRPRFAALLDRAGRFGMRLLDTRLGKQI
FT                   VADEDRMLLEQCGYVDAHTRGIFLSARIACAIALPAAVALVGGEPVRTHLGAWVALSVI
FT                   AGFMLPKTYVRRRAAARRQSVVDEMPLLVDMLRLLQGVGLSLDQSIQVVTNDFRGMLPV
FT                   LSSELGIAQRQFVAGRTREQSLQRLATSFDNEDLRAIVRLLIQVDKHGGAVQEPLKQFG
FT                   DRLREVRRAMLRERIGRLTVKMTGVMILTLLPALFIVTAGPGMLAVTHALTAARR"
FT   gene            124699..125634
FT                   /locus_tag="BMA10229_A0122"
FT   CDS_pept        124699..125634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0122"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00846"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016931"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2G1"
FT                   /protein_id="ABN00846.1"
FT                   /translation="MRRNGFSPMTTAALAALALSLAACGAFKESGYGIGAQAERAALMQ
FT                   AAADKNATPDTPGMYLGLIGRMQSQGLYYASLAHIDAYEKQYGASPDTILLRADALRST
FT                   DQPAASTVAYRQLLGTPLAARGYRGLGLLAGASGDFDAASQALAQASALAPTDSPTLSD
FT                   LAYARMRSGDIAGARVPLMKAAELDQNNPKILSNLALFLLATGQTRDALGLMNQLKLAP
FT                   AVRAEIRNDATRIAAAARARQRALARPGAPGAAASAGATLAASAAGSNGGAAAGKGAVA
FT                   GSGASAPGAAATATAAAFEPTVPLLQRFSQ"
FT   gene            125656..126042
FT                   /locus_tag="BMA10229_A0123"
FT   CDS_pept        125656..126042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01492"
FT                   /db_xref="InterPro:IPR022053"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2G2"
FT                   /protein_id="ABN01492.1"
FT                   /translation="MTTHDLTQTAAPRAGRGRALCAAALALALACAVGAARAQSPQRDA
FT                   PSASEIGHATQTWFALQASNREAAPAQPMIGEAASLAYARYIESFRTKIPAFYGSAAGM
FT                   SGMSGGGGGGGGAGYSLAPAPGSQ"
FT   gene            126050..127858
FT                   /locus_tag="BMA10229_A0124"
FT   CDS_pept        126050..127858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02495"
FT                   /db_xref="GOA:A2S2G3"
FT                   /db_xref="InterPro:IPR018705"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2G3"
FT                   /protein_id="ABN02495.1"
FT                   /translation="MPLARRRAERRPPARGRGPIARERGSFALVAAIWMLVAIAALGAV
FT                   DIGNVFFVRRDLQRVADMAALAGAQRMDDQCAQPNAAAAANARSNGFDPAAGGNTLALA
FT                   CGRWDTQSNAGPSYFNAAATPLNAVQVTATQSVPYFFLGPSRTVSATSTAKATNVDQFT
FT                   IGTTLASVQGGLVNNVLNALLGTNLGLSALSYQALASTQIKIGDLMAAANVLTVNELLA
FT                   TQVTAGQYAQLMLTALSRTQVVNANLQASVAALQAIAGAHLGGGTFKLGGQPGAPGVFA
FT                   LGLSDTQAAADAKINVFDALMVAAEVAAAGKPAVDVATGLQLAGQGARLKLQVIEPPTI
FT                   VIGEAGTDPKTGAWRTQANNAQIRLYVSVDLGTTGLSPTGVLLPIAPLVSLVQNLIQVD
FT                   LSLPLTLQVATGSAWLQSTSCAASAAASRATLGVQPGLANLCIGDVPTDLPAQQTFACN
FT                   VPATLATLGVLSAPLLQVKSAVALPAVVPKASAATLTFNGVAGDADDYQTTNSNAVGSV
FT                   IANALSGAAQSLTGSNGLALYVLGVSVPVGTILNPVVSVLLNLLGPVLSSLDQVVVPLL
FT                   NLLGVQLGAATVHNLALTCGTAQTVY"
FT   gene            127875..129266
FT                   /locus_tag="BMA10229_A0125"
FT   CDS_pept        127875..129266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0125"
FT                   /product="sigma-54 dependent transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02018"
FT                   /db_xref="GOA:A2S2G4"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2G4"
FT                   /protein_id="ABN02018.1"
FT                   /translation="MRNTNAIEGLDLYVWEGKADIVDRVARCMSSFDVEVIRADNEELS
FT                   AERTAMRPSLAIISVSMIESGAAFLRTWQAEIGMPVVWVGAARDHDPSLYPPEYSHILP
FT                   LDFTCAELRGMISKLAVQLRAHAAKALEPSTLVAHSDCMQALLQEVDTFADCDTNVLLH
FT                   GETGVGKERIAQLLHEKHSRYGMGEFVPVNCGAIPDGLFESLFFGHAKGSFTGAVGTHK
FT                   GYFEQAAGGTLFLDEVGDLPLYQQVKLLRVLEDGAVLRIGATAPVKVDFRLVAASNKKL
FT                   PQLVKDGLFRADLYYRLAVIELSIPSLEERGPVDKIALFKSFVASIVGEDRLAALPELP
FT                   YWLAEAVADSYFPGNVRELRNLAERVGVTVRQTGGWDTVRLQRLIAHARSAAQPAPAES
FT                   APDVFVDRSKWDMTERNRVIAALDANGWRRQDTAQHLGISRKVLWEKMRKYQIFDEEPE
FT                   ARESE"
FT   gene            129357..130070
FT                   /locus_tag="BMA10229_A0126"
FT   CDS_pept        129357..130070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02917"
FT                   /db_xref="InterPro:IPR021350"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2G5"
FT                   /protein_id="ABN02917.1"
FT                   /translation="MGRVFVAIAAAGGLCGAHAQALEGNGGAASPALTASGAAASPGVS
FT                   APAVVNLSAPAGAPAAGASTEAGGKSTIDELQRQIQARELTEMRTTYNGSYGASLLLNI
FT                   QEGTYFVALFQQKAFWRVIRTASEARAEAVYRDFAKQSETLAVNELQAAKLESQKALTD
FT                   RQIAVAQERASRLQADLSIAREQRAAVATRQKDKLDETVALREQKSERQDQLRKLQQQV
FT                   RSLQRQAEAGLPKVR"
FT   gene            complement(130221..130898)
FT                   /locus_tag="BMA10229_A0127"
FT   CDS_pept        complement(130221..130898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0127"
FT                   /product="hfq protein"
FT                   /note="identified by match to protein family HMM PF01423;
FT                   match to protein family HMM TIGR02383"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02639"
FT                   /db_xref="GOA:A2S2G6"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2G6"
FT                   /protein_id="ABN02639.1"
FT                   /translation="MANPAESHPQNDFINAARKERKRVEIYLVNGIRLTGCIESFDQYL
FT                   VMLRTPVGLQGIYKRAISTIQLDTGGSRPGGRGPRAGGAHGGGGRPGGREGGGHGPYGS
FT                   HGGSREPRGDGGGYGARESRGDGGYGSRESRGDGGYGSRESRGDGGYGSREPRGDGGYG
FT                   SREPRGDGGYGAREPREPREPRESYGAPQEGASTPSGTQERNGNGPVIVTRRRRSLGPT
FT                   DGQ"
FT   gene            131203..131475
FT                   /locus_tag="BMA10229_A0128"
FT   CDS_pept        131203..131475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0128"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01089"
FT                   /db_xref="InterPro:IPR024446"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2G7"
FT                   /protein_id="ABN01089.1"
FT                   /translation="MKKWLTITMLGVALLGAAGAATAGGVDLSIGVGVPVAPVYVAPQP
FT                   VYVAPQPAVVGYPAYGWRGDDEDDDWKHYHKHWRKWHRHHDDDDD"
FT   gene            131490..131663
FT                   /locus_tag="BMA10229_A0130"
FT   CDS_pept        131490..131663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0130"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02525"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2G8"
FT                   /protein_id="ABN02525.1"
FT                   /translation="MPRRRGPVAPPQRTPQRKKNAARAMKAARRFSSPPDGVAGAPVTR
FT                   VEHDATMTAQNL"
FT   gene            complement(131651..132661)
FT                   /locus_tag="BMA10229_A0129"
FT   CDS_pept        complement(131651..132661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01822"
FT                   /db_xref="InterPro:IPR011465"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2G9"
FT                   /protein_id="ABN01822.1"
FT                   /translation="MTTRFSIAFWEECMPHTLPLHPSSSSRTRFARRRLATASAALSLS
FT                   LSLMLGHGAAHAQVNAEASAAVESGAQEAALPAELAKVAKLPVEQQACWLRTAARQGTL
FT                   EKLDDATLTALFKSLDPQTVPDYVAAGPIGHPSYEFTMLRQERISGKWSDTPDHMLVKV
FT                   TRSPLRVYAKWLPDGAHSGQEVIYDSSKRADEMYGHLGGLLGKVPMWTAVDGTLARAQS
FT                   NHQVRDLGTEFVANLYLTEAKKYREAGALKPTHVEAKTVKGVRVVALTYETPGGRPQFY
FT                   AKKETLGLDLRQPYFRTVESYDNDGRVFEKIVFEKITPKSLDETAFDPKNPDYKF"
FT   gene            complement(132682..134454)
FT                   /gene="fadD"
FT                   /locus_tag="BMA10229_A0131"
FT   CDS_pept        complement(132682..134454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="BMA10229_A0131"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03686"
FT                   /db_xref="GOA:A2S2H0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2H0"
FT                   /protein_id="ABN03686.1"
FT                   /translation="MTAPVAPAHAHTHAPNTDGIWYASYPKGVPHDIDVTRYESLAQYF
FT                   DECTTRYAQRVAFISAGARMTYAALARKAAAFASYLQSLGVKPGDRVAIMLPNTFQYPV
FT                   TLFGTLKAGAIVVNVNPLYTARELAHQLKDSGAQTIIVFENFAKTLQDALPETQIKHVV
FT                   VTALGDLLADGLNPKGRLINFVLKHVKKLVPAYRLPQAVRLRAALAAGAKKAPAPVALK
FT                   RDDLAFLQYTGGTTGVAKGAMLTHGNLIANLLQAKAWIEDQLTGDVETVLTPLPLYHIY
FT                   SLTVNAFIFLGLGGRNILIANPRDTKTMMKILRHETFTGITGINTLYNAFLDNEEFRKR
FT                   DFSKLKLAMAGGMAMQRAVAERFEQVTGCPIVEGYGLTECSPIVTMNPYDAHEKRAFSG
FT                   TIGLPAPSTIVRFRTEDGAWANVGEPGELCVHGPQVMRGYWQRPDETAKVIDADGWLAT
FT                   GDIGVMDEQGFIRLIDRKKDMILVSGFNVYPNEIEDVLVSHPGIREAAAIGIPDPVHGE
FT                   RIKVFVVPRDASLTVEDVLTHCRKNLTGYKMPKAVEFRDALPQTNVGKILRRALRDEEL
FT                   AKLANAPADPHAKH"
FT   gene            complement(134451..134564)
FT                   /locus_tag="BMA10229_A0132"
FT   CDS_pept        complement(134451..134564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0132"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01278"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2H1"
FT                   /protein_id="ABN01278.1"
FT                   /translation="MPAFSSFTPARASPGECARCPAGARAPAHTNDSGDKR"
FT   gene            complement(134639..135595)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0133"
FT                   /note="transcriptional regulator, TetR family; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00440"
FT   gene            complement(135812..137038)
FT                   /locus_tag="BMA10229_A0134"
FT   CDS_pept        complement(135812..137038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0134"
FT                   /product="MFS transporter, sialate:H+ symporter (SHS)
FT                   family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00871"
FT                   /db_xref="GOA:A2S2H3"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2H3"
FT                   /protein_id="ABN00871.1"
FT                   /translation="MAMSWTREQRNVTIAAYLGWTLDAFDFFLMVFVLKDIAAEFNTKI
FT                   PAVAFAITLTLAARPIGALIFGRLADHFGRRPTLMINIACYSLLELASGFAPSLAALLV
FT                   LRTLFGVAMGGEWGVGSALTMETVPPRARGAVSGLLQAGYPSGYLLASVVFGLLYPYIG
FT                   WRGMFMIGVLPALLVLYVRAKVPESPAWKQMEKRARPGLVATLKQNWKLSIYAVVLMTA
FT                   FNFFSHGTQDLYPTFLREQHHFDPHTVSWITIVLNIGAIVGGLTFGWLSERIGRRRAIF
FT                   IAAMIALPVLPLWAFSTGALALAAGAFLMQISVQGAWGVIPVHLNEISPDEIRATFPGF
FT                   VYQLGNLLASGNATLQAQFAVDHGNNYGMALATVAGIVAVVICVLIVFSRERRGIDMTQ
FT                   TAAMSPTSG"
FT   gene            137449..138003
FT                   /locus_tag="BMA10229_A0135"
FT   CDS_pept        137449..138003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0135"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01723"
FT                   /db_xref="GOA:A2S2H4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2H4"
FT                   /protein_id="ABN01723.1"
FT                   /translation="MNPDAQAHSSLPTLETDRLWLRPRVLADLDACIEMDRDPDVTRHI
FT                   AGPWADPVEHRRFVEHRITRAYPPGLGYWSIFEKARPDRFVGWVLLIPDYVEGGRDVEI
FT                   GWRLVRASWGRGIASEAARRVVRHAFETVRLPRIVADIAAANSASLNVARKLGMRRVGI
FT                   VQDGIPYVRHRLERADLAARG"
FT   gene            138147..138773
FT                   /locus_tag="BMA10229_A0136"
FT   CDS_pept        138147..138773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08857"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02312"
FT                   /db_xref="InterPro:IPR014956"
FT                   /db_xref="InterPro:IPR016932"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2H5"
FT                   /protein_id="ABN02312.1"
FT                   /translation="MTIGQDVHLIPAKLDALRPTQITVGYREVKAKRKHWKALGKKARK
FT                   AAIESHWFPAVLGPGGDYFITDHHHLGLALLEEGVTEVKAMLLKDLSWLDETIFWRMME
FT                   HNQWVHPFGANGARHDYDHLPTSLVGLKDDPYRSLAGELRAAGGYAKDATPFSEFLWAD
FT                   FLRPRIALAQIRKEFAKALEAALGYAHTQEARYLPGWSGVIAAPR"
FT   gene            138820..140532
FT                   /locus_tag="BMA10229_A0137"
FT   CDS_pept        138820..140532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0137"
FT                   /product="sulfate permease family protein"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916; match to protein
FT                   family HMM PF01740"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03235"
FT                   /db_xref="GOA:A2S2H6"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2H6"
FT                   /protein_id="ABN03235.1"
FT                   /translation="MDLRSKHIDAPPQHAAHFAPLDEPPAPRARRTALDALAGLSIAGL
FT                   LIPEAVAYAGLANLPPQAGLIALVVGLVVYAIAGSSRFAIVSATSSSAVVLAATVMSEA
FT                   GPGAAAQLMLAAALVATTGILFILAGAARLGGMSDFIARPVLRGFTFGLALTIVIKQLP
FT                   KMLDVPIHHGDTLRVALDLLLGIAGCNVRSAALGATALAILFALGRRTRVPATLVVIVL
FT                   GIAAGYWIDWHRYGIAVVGTIDLQNLAFGMPVLGRSGWMQTAEFGFALMLILYAESYGS
FT                   IRNFALKHGDTVSPNRDLVALGCANLVSGLLHGMPVGAGYSATSANEAAGAQTRMAGLF
FT                   AAAVIALIAWLLLPQLARIPEPVLAAIVIFAVSHSLHPEVFRPYWTWHRDRIVVIAALA
FT                   AVIVLGVLHGLLAAIGVSLLLTLRQLSEPNVSVLGRLRGSHDFVDVSMHEDAKPIPGVL
FT                   IVRPEAQLFFANAERVLTMARRLARDAQPPVHTVMLSLEESPDVDGTTIEALKTFGAEC
FT                   DARGWRLALVRLKPNVLRVLQRAADGGLRADALSELSVDESLQSLTAGELPRA"
FT   gene            140553..140714
FT                   /locus_tag="BMA10229_A0138"
FT   CDS_pept        140553..140714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03761"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2H7"
FT                   /protein_id="ABN03761.1"
FT                   /translation="MRRCVTLDVGCRMSDVGCPMSDVRCCRRAVDRVPGARPPYRRAAS
FT                   FRFSHRRP"
FT   gene            complement(140838..142424)
FT                   /locus_tag="BMA10229_A0139"
FT   CDS_pept        complement(140838..142424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_108476.1"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02905"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2H8"
FT                   /protein_id="ABN02905.1"
FT                   /translation="MASFKSSLRRGLRVSGCALWLALSKLDAAHAAAGPDASPDAWPSA
FT                   ALSDRAAVEVDASQLLPTPQLVRWQVDLDRRGLRSTGSPAHERYIDVLRRRLARAGVQQ
FT                   LHTEATTLAHWAVRHWRLDVADGAPRERIDVAGYLPYSGDTGRDGIVAPIRYLAAGQTP
FT                   DADVAGKIAVVEWPALPLTGAFFRERALRVFDPDNAFAPSAPYVRTSFMLGTLTAMLDR
FT                   LQAAGAAGVVMIADTSSAEATRLYAPYDGRLRRVPGLFVDRATGAKLASLAERRATLRL
FT                   SLDAGVERVHTRNLIGIIPGMSDELTVVNSHTDGTNGIEDNGPNAIVAIAQYLSRLPRA
FT                   ALPRTVMILLSSGHFAGGVGAEDFIARHARDGLVARIACVVTIEHLGAQEWLPSEQGAL
FT                   APTGRAEPTALFMPAVPALVDAADALVRRANAAPAFVMPPLNPNGDGSANDALWPGEGQ
FT                   YFWGRARVPTINLITGPTYLLNYGVSTAEKIDYARLRREIAATTQTLLDLSRVPFDALR
FT                   AVPPRTRAAAP"
FT   gene            complement(142651..144138)
FT                   /locus_tag="BMA10229_A0140"
FT   CDS_pept        complement(142651..144138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0140"
FT                   /product="phosphoesterase family protein"
FT                   /note="identified by match to protein family HMM PF04185"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03842"
FT                   /db_xref="GOA:A2S2H9"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2H9"
FT                   /protein_id="ABN03842.1"
FT                   /translation="MANSLSRIEHIVHLMLENRSFDQMLGFLYTDDGNRSPTGQPFDGL
FT                   TGNESNPDDLGRPVGVYRIRATDPHPYLMPGADPGEGFQNTNYQLFCDDHPAPGAVPTN
FT                   QGFVVNFKSAIATDQSRHDKDALPGTTPEQIMGMYTPELLPVLSGLAKGYAVCDRWFAS
FT                   APTMTMPNRAFALAATSQGHLDDHVKIFTCPSIFGRLSDQGVDWAIFGYNRDPLTRHDF
FT                   PDTQNADDSHFGHFRDFQARAASGTLPAFTFLEPSWDASGNSQHPNYDVAAGEQLIHDV
FT                   YYALRNGPGWNSTLFIVTYDEHGGNYDHVAPPSGATPPGDGTVGEFGFDFTRFGVRVPA
FT                   VLVSPLIAAGTVFRSAAGTIDHTSVLKTIGERFGTAPLTARDRAAPSLGDALTLASPRA
FT                   ASDDPLAGVTVPVSRVSHPNAAMPSKLDKLQAARIAALPLRNEKGYYEEADTPLASSAE
FT                   LSNFIRDRGAAWSQHRQRQQQRRQQQQRQQPRSKPRR"
FT   gene            144820..146385
FT                   /locus_tag="BMA10229_A0141"
FT   CDS_pept        144820..146385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0141"
FT                   /product="methyl-accepting chemotaxis domain protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01090"
FT                   /db_xref="GOA:A2S2I0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2I0"
FT                   /protein_id="ABN01090.1"
FT                   /translation="MSTQLANELRRSSDDLTRLARTYVATGDAKWEQQYNEILAIRSGK
FT                   APRPLDYDRIYWDFRAADEPLRAEQGETISLQEMMKRAGFTDEEFAKLHDAEQNSNDLV
FT                   KTETVAMNLVKGLTPDDAGHFTKQGPPDLEKARALMFDANYHRFKAKIMHPIDDFLKLL
FT                   DARTEGAIARAQASAQTWKIISAAVAIGILAFFALMLHIMFKRVLAGLEAAASTASRVA
FT                   AGDLTSHFDAHRVDPQAKDEISRVMRALQTMNDGLVRIVTDVRSGTDTIATASHEIMAG
FT                   NNDLSARTEQQAASLQETAASMSELTATVKLNLENARQANMIGSNAVSTVEKGSVSVEQ
FT                   LVTTVNAISTNSGKIADIISLIEGIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRS
FT                   LAQRSSSAAKEIKDLIETSIDTVRDGVSKADEVGQHIVEVKQAIRRVADLVGEITAASE
FT                   EQTRGIEQVDAAVSQMDRVTQQNAALVEQAAAASKAMDDQAGNLRAAASIFKLPGRASL
FT                   FAHA"
FT   gene            complement(146566..146652)
FT                   /locus_tag="BMA10229_A0142"
FT   tRNA            complement(146566..146652)
FT                   /locus_tag="BMA10229_A0142"
FT                   /product="tRNA-Leu"
FT   gene            146838..148319
FT                   /locus_tag="BMA10229_A0143"
FT   CDS_pept        146838..148319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0143"
FT                   /product="ISBma2, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02068"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A2RZF7"
FT                   /protein_id="ABN02068.1"
FT                   /translation="MFFNGVMLKTPMPTQHELEMVTLEELVPKDHLLRQIDAAVDFEFI
FT                   RAKVAHLYCADNGRPALDPVVMFKLLFIGYLFGVRSERQLMREVQVNVAYRWFARFRLT
FT                   DKVPDASTFSQNRRRRFTDTTVYQEIFDEIVRQAIKRGLVDGRVLYTDSTHLKANANKG
FT                   KFDVVKLEQTPAAYTEALNAAVDADRAAHGRKPLDRDDDEPPSSKDTKLSRTDPDSGYM
FT                   VRDDKPKGFFYLDHRTVDAKHAIITDTHVTPASVHDSQPYLDRLDRQRERFEFKVEAVG
FT                   LDAGYFTPAVCQGLEERGIAGVMGYRTPNHKPGMFYKRQFKYDAYRNEYVCPQGQALPY
FT                   STTNRLGYREYKSNAQICGRCPVRSQCTNSAIAVKVVTRHVWERAKERVDARRLTEWGQ
FT                   RIYARRKQTVERSFADAKQLHGHRYARMRGLRKVAEQCLLAAAAQNIKKIAMLLARKRK
FT                   KGPAGPDWRFVRMLLRLVSGLRCSFDYPLAANPQS"
FT   gene            complement(148401..148487)
FT                   /locus_tag="BMA10229_A0144"
FT   tRNA            complement(148401..148487)
FT                   /locus_tag="BMA10229_A0144"
FT                   /product="tRNA-Leu"
FT   gene            148634..151150
FT                   /gene="vacB"
FT                   /locus_tag="BMA10229_A0145"
FT   CDS_pept        148634..151150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacB"
FT                   /locus_tag="BMA10229_A0145"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF00773; match to protein
FT                   family HMM PF08206; match to protein family HMM TIGR00358;
FT                   match to protein family HMM TIGR02063"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03021"
FT                   /db_xref="GOA:A2S2I2"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2I2"
FT                   /protein_id="ABN03021.1"
FT                   /translation="MSGAPVRLRLPRSRKPNATRKIIDKPLSKYPYPIPSREEILGVLR
FT                   TSDAPLAANDIAEALSIKRQEREGFFRRVAAMERDGQIRLDKRGHYQLTHPSNFVAGRV
FT                   QGHRDGYGFVIRDDGQDDLFLPNAEMQKVMHNDRVLARIVGYDRRGRPEGHVVEVTERA
FT                   NKRVIGRLLNENGALIVAPEDKRISHDILVTQNAKKAKVGQVVVVELTDFPSRHSQPLG
FT                   RVCEVLGDIDDPGMEIEIAVRKYGVPHEFGAQALGEAAALPDKVRPADLRYRVDLRDVP
FT                   LVTIDGEDARDFDDAVYCEPAAVGRGEGFRLIVAIADVSHYVQPGSPLDADAVERSTSV
FT                   YFPRRVIPMLPEKLSNGLCSLNPQVDRCVLACDMIINARGDIKAYQFYPAVIHSAARLT
FT                   YTEVAAVLSNTKGPEAARRAELMPHLQHLYGVYKALFVARQKRGAIDFDTTETYIVCNA
FT                   QGKIEQILPRQRNDAHRLIEECMLAANVCAADFLKRNKHPGLYRVHAGPTPEKLENLRA
FT                   FLRDMGLTLGGGDTPHASDYAALMAHIRDRPDAQMLQPMLLRSMQQAVYSPDNIGHFGL
FT                   AYDAYAHFTSPIRRYPDLLTHRAIYAILSGKKYTPKSPEGVELNTALSPRARAMQREDD
FT                   EARGRARSNAAIWEELGLHCSSNERRADEASRDVEAWLKCYFMRDKLGEEYGGMVNGVT
FT                   SFGIFVQLDALFIEGLVHVTELGADYFQYDEVKNELRGERTGIRYRLSDRVRVQVSRVD
FT                   LDARKIDFRLVRETPVKAPRPASAVAAEAGAGGPRVRALPPAEGAARRKKAASAPSAAV
FT                   KEARAARKKGAASKPAAKKARSRKKY"
FT   gene            151282..152025
FT                   /locus_tag="BMA10229_A0146"
FT   CDS_pept        151282..152025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0146"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03126"
FT                   /db_xref="GOA:A2S2I3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2I3"
FT                   /protein_id="ABN03126.1"
FT                   /translation="MSRLKVLYGFHAVTARMRHDASTVAEVFYDATRRDRRMQDFLQAA
FT                   KEAGVRLIAADETRLWGLAHTERHQGVVARVEDLPLAQNLAELLDGIAGPALLLVLDGV
FT                   TDPHNLGACLRVADAAGAHAIIAPRDRAAGLNATAAKVASGAADTVPYITVTNLARALR
FT                   ELKDAGVWVIGTSDDATASVYDTKLDGPVALVMGAEGEGMRRLTRDTCDEVMFIPMAGS
FT                   VESLNVSVASGVCLYEAVRQRGAKK"
FT   gene            152037..152336
FT                   /locus_tag="BMA10229_A0147"
FT   CDS_pept        152037..152336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0147"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00759"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2I4"
FT                   /protein_id="ABN00759.1"
FT                   /translation="MRSFAAGFAGAVRGAAFAMPGGRSAAAFAVRRASACFYSLFTPSM
FT                   RALARRDTCWAARTGRAAPAPLACTPRSAFARARRAAAFAKETRNAQECERRSV"
FT   gene            152399..153298
FT                   /locus_tag="BMA10229_A0148"
FT   CDS_pept        152399..153298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0148"
FT                   /product="N-acetylmuramoyl-L-alanine amidase domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01471;
FT                   match to protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01623"
FT                   /db_xref="GOA:A2S2I5"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2I5"
FT                   /protein_id="ABN01623.1"
FT                   /translation="MKFPLRHTLLASFSMLAAACTTPTLVNRGDYYADTSLPARSVDSR
FT                   IRFLVMHYTEIGEAPSLRVLTQENVSAHYVVPDAPRTERGAPVVYQLVPESERAWHAGV
FT                   SAWQGATELNGVSIGIENVNRGPIDTPHGRMWAPYPPAQVDAIVRLAKDIVARYRIPPT
FT                   RVVGHSDIAPQRKIDPGPLFPWRALAKAGVGAWPDDETVAARLAGRPPKSLVDVRELQL
FT                   KLARYGYDVATDGVLDDRTRRVFSAFQMHFRPTDYAGNPDAETDAIAQALLDKYMPSQP
FT                   APERDAAALDAASGVAAQ"
FT   gene            153567..154262
FT                   /gene="rpiA"
FT                   /locus_tag="BMA10229_A0149"
FT   CDS_pept        153567..154262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="BMA10229_A0149"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by match to protein family HMM PF06026;
FT                   match to protein family HMM TIGR00021"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02649"
FT                   /db_xref="GOA:A2S2I6"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2I6"
FT                   /protein_id="ABN02649.1"
FT                   /translation="MTQDELKRLVGEAAARYVTENVPQGAVIGVGTGSTANCFIDALAA
FT                   VKDRYRGAVSSSVATTERLKSHGIKVFDLNEIESLQVYVDGADEIDGSGAMIKGGGGAL
FT                   TREKIVASVAETFVCIADASKRVAVLGQFPLPVEVVPMARTAIGRRLAALGGVPVLRVK
FT                   QDGAPYVTDNGNEILDVKGLRIDDPRALEAAINGWPGVVTVGLFAQRGADLCLLGTERG
FT                   VETLRYAAH"
FT   gene            154600..155313
FT                   /locus_tag="BMA10229_A0150"
FT   CDS_pept        154600..155313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0150"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02770"
FT                   /db_xref="GOA:A2S2I7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2I7"
FT                   /protein_id="ABN02770.1"
FT                   /translation="MEQGKDRSLVSKVMDGLVTGIVEDKYGGVLPPQDVLSKEFDVSRT
FT                   VMREALSMLLARDMLDVRPKVGTRVRPMSHWRMIDEDVVNWRFRAKPDRQFIRDVIEFR
FT                   TLIEPRATAQAASRATTAEIAGIREAYELFKLAEPGTPAYDEADELLHTRIVHASGNQF
FT                   FQQMAAIIRGALRVVNPRMSQRDDIRALALKSHGRVVDAIERRDARDAEAAALELIDYT
FT                   AEEMRDFAVDMPERN"
FT   gene            155413..156396
FT                   /locus_tag="BMA10229_A0151"
FT   CDS_pept        155413..156396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0151"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF01408"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01913"
FT                   /db_xref="GOA:A2S2I8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2I8"
FT                   /protein_id="ABN01913.1"
FT                   /translation="MTDHQPTPIRFGIVGAGSIARRFAHSIAHVRGAELSRIWARRADA
FT                   AAAFCAAHGGAPCDSVDALLASDIDAVYIATLNDSHAHYARTALAAGKAVLCEKPATVN
FT                   ARELETVLDAAHAAKRLFMEAMKPPFYPLYRKLRAHLERDPIGEIALVRAGCASSRVPA
FT                   DHPVYRFEQAGGALLDIGVYEMFLAVDWLGAPLDVQTLGRVGATGVDVFASVNARHARG
FT                   VSQLFCGLDVMGRGDALLAAPGGYVTIHENWWNPARATIRYADGRVVELDEPFDGGGLN
FT                   YEIAHFCELLRAGELESPVMTHDHSRRMIAMTDAARAALGVRYPMD"
FT   gene            complement(156591..157313)
FT                   /locus_tag="BMA10229_A0152"
FT   CDS_pept        complement(156591..157313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0152"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00907"
FT                   /db_xref="GOA:A2S2I9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2I9"
FT                   /protein_id="ABN00907.1"
FT                   /translation="MLAARLVKLAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAG
FT                   LAVRRRRKRHGVMIEREQLALPGAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVD
FT                   IVVDHGISGLYVARALDRAARFRGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAG
FT                   KPTQNAYIESFNGKFRDECLNEHWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEF
FT                   AAKHRATADAPAAFQELV"
FT   gene            complement(157993..160365)
FT                   /locus_tag="BMA10229_A0153"
FT   CDS_pept        complement(157993..160365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0153"
FT                   /product="putative penicillin amidase"
FT                   /note="identified by match to protein family HMM PF01804"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03766"
FT                   /db_xref="GOA:A2S2J0"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2J0"
FT                   /protein_id="ABN03766.1"
FT                   /translation="MASRTNRLPRWLKILPGVILLGALLVAAGAALFLRASLPRLDGDV
FT                   RAPTLGGPMTIERDAAGVPTVAARDRFDAAYGIGYLHAQDRFFQMDYLRRTGAGELAEL
FT                   LGPAALDFDREHRLFRFRARAAAAFAQLPPDERRLLERYTQGVNDGLAALRARPFEYAL
FT                   LGEPPARWRPEDSLLVIWAMYFQVQGTLASRDIARNWLTAHATQQQRAFLLPSSSGFDA
FT                   PLDAPRIDEAPAPLPDAAPDWFRAAGDGAAKRASLDFRSSVGSNNWAIAGSRSARGAAI
FT                   VGDDMHLVLGLPNTWYRAAFTYPGGAAPVRRAVSVTLAGLPAIVAGSNGHVAWGLTVGY
FT                   ADCLDLVPLERDGDDSRAFRMSGARQIARQYVESIRVRGGASVSLTVLETTVGPVREIG
FT                   GRPYAVHWVAQSPGAVNLGLARLADAVDVDGAMRVANTLGIPAENIVVGDRAGRIGWTI
FT                   AGALPDRRAPRGGEGAAWRSLLPPDAYPRVVDPSGGQLWTANSRQLAGDAYRLIGDGGT
FT                   DLGARATQLRDGLTALGRTDEQAAYRIDLDDRALFIAQWRDRALRVLDDAALAGHPSRA
FT                   EFRRLLEHGWTGRASVDSVGYTLARGFLYRLYDVTFDGLNARLKQVDAGADYELANLRW
FT                   PAVVARLLDAQPPGWLPAGASSWRDVQLIAIDRTIAALTADGAPLARASWGARNTLRIA
FT                   HPFAGSLPLLGGWLTAPAAQMPGDSHMPRVAAPDFGQSERMVVSPGHEEFGIFNMPGGQ
FT                   SGHPLSPFFLAGHDAWVRAEPTPFLPGVARHTLRFAP"
FT   gene            complement(160490..161665)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0154"
FT                   /note="carbamoyltransferase family, truncation; comparison
FT                   of this gene to its homologs suggests this gene has been
FT                   truncated; identified by match to protein family HMM
FT                   PF02543"
FT   gene            161753..162016
FT                   /locus_tag="BMA10229_A0155"
FT   CDS_pept        161753..162016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0155"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02352"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABN02352.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            162040..162873
FT                   /locus_tag="BMA10229_A0156"
FT   CDS_pept        162040..162873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0156"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01356"
FT                   /db_xref="GOA:A2RWN9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWN9"
FT                   /protein_id="ABN01356.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQGYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            162895..164454
FT                   /locus_tag="BMA10229_A0157"
FT   CDS_pept        162895..164454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0157"
FT                   /product="putative liporotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00897"
FT                   /db_xref="InterPro:IPR031929"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2J3"
FT                   /protein_id="ABN00897.1"
FT                   /translation="MALSKGAGHHGTLRTTLIAATVAAMLSLSACGGSGTISKGLDGSG
FT                   SGSGGGNAISTTGGSGSGGSGGSGGSGSGGSGSSGSTGGLSGGGGSTSGGTSTSSSINA
FT                   LGTIAGNTGGIISGAGSTVSGLGTVVGSQTLPGVNPQTTQALGGIVQDLGGAVSALGSG
FT                   VTSGIGQLGSSTNPIGTTVASTGGVVSQLGGAVTQTGNLVTSLGTGPLAPLAPLTSPLG
FT                   GAVSTLGNTITAGGTTLTTALSTGPVQQLTQTVSSAITPITSMVTGTTQTVGNVTGLGA
FT                   PVNTLLGTIGGGLNQAGALISKTGNNPVTTGLGQTVSATGNTITSVGGLLTGGSGATNP
FT                   LAPITAAVGGLTGTLSGVSGATSGTPLAPLTNVVSTVTGALSGATGSATSTSPLAPITG
FT                   LVSTVTGALSGATGGATGSTSPLAPVTGLVSTVTGALSGATGGTTSTSPLAPVTNLVST
FT                   ATGALGGATAAPATSTTTSATNPVASLTAPLTGTSSGTSGATNLLAPVTSLVGGLLGGI
FT                   KK"
FT   gene            164504..165769
FT                   /locus_tag="BMA10229_A0158"
FT   CDS_pept        164504..165769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0158"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03273"
FT                   /db_xref="InterPro:IPR031929"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2J4"
FT                   /protein_id="ABN03273.1"
FT                   /translation="MTQQRFAPSFALAAWRVPLTALATACVLAACGGSDVTAPPSAGGG
FT                   TSGTSGTSGTSGTSGTSGTSGTAGTSGVVNTLGKTATDLGNTISSTSVPGLGSGVTQGV
FT                   GATVGSTGGIINAAADALSNGLGQTGSTQNPVGTTVAGLGNVVSATSNTVQGLSQTVQA
FT                   LGTGPLAPLSPVTTPVAGALATAANGVNAAGTMLGNALSTGPVQQVTQPISSALTPLVI
FT                   TAGQVTQTVGTTTGVGQPVSGLLQQVGGAISSAGTQIAGTSPSQPLVGDVGQLVSAVGN
FT                   TVTNAGGLVNPAAPNGAAPIPGLITSVVGGSTATVATGSSSGSTLGSPLNGLLSSLGGG
FT                   ALPSGPLGGSAVSGGASNPLAPITSLASGGTGASTNPLAPVTGLLNTVTGTLSGATSST
FT                   GGSTGLLAPVTGSLGTLGSFGK"
FT   gene            165944..167599
FT                   /locus_tag="BMA10229_A0159"
FT   CDS_pept        165944..167599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08479"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02714"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2J5"
FT                   /protein_id="ABN02714.1"
FT                   /translation="MLLLALVAAAGAAHAQSRSGGNPLEALPQINTPQKPSVTVQVAPQ
FT                   EVQVQALLARHLTPSSFQVEGVKSIPFEEISQRFTPLVGKDITIGQLIETANGVTKLYQ
FT                   ERGYALSFAFVPAQTFEGGVVRVTVVEGYVANLKITGRPGAMEPKVRAIAAHIMADRPL
FT                   RRATFERYVNTFGLLPGVTVKANVPPPQNTDGATTLELNVDRKPFNVSASLNTNNPGLQ
FT                   GLFTVTENGLTSLGEQMSISALFPKGPNNQTYVSFNGAVPIGSNGLVTRLDASHYRGNP
FT                   SVDQTVLPNVQRTVINDKLGLSASYPLMLSNQRSLLGTVSGYASHSEDRYQNQSTGATI
FT                   GMRSQVRVLQMQFDYTSVQPKQVQKLSFNVAKAFDILGASKSGFTNLPGVIATNPASTT
FT                   FVRTGATFVQTNEWPFKIGSTVQLTGQYSPDSLPSTEQISFGAQRFALGYQPGETSGDS
FT                   GWGASLELNRAFAPGFTYLKNITPYIVYDMARVYLHSGTPVPRRLSSAGFGVRLTDSRF
FT                   YNLDVSIAKPVGDAPIESASRSPRVNASFSYQLY"
FT   gene            167596..167808
FT                   /locus_tag="BMA10229_A0160"
FT   CDS_pept        167596..167808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01734"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2J6"
FT                   /protein_id="ABN01734.1"
FT                   /translation="MTLARPARTPPARSRIAARRPTGRARLHFFSSPRRLAASIRSTCI
FT                   KRRARIHVFCAQLACIAVRRRRPAS"
FT   gene            167843..168304
FT                   /locus_tag="BMA10229_A0161"
FT   CDS_pept        167843..168304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03554"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2J7"
FT                   /protein_id="ABN03554.1"
FT                   /translation="MFQMTRSLRSITVAGALLVCAASAFAQADSPVGMWQTIDDHTGKP
FT                   KALVQISADSNGELSGKVVKGLGENDTPDRRCTACTDERKDQLIKGMTIIKAMKKDGEG
FT                   WDGGNILDPENGKVYKCKMKLEDGGQKLVVRGYIGVSLLGRSQTWMRSQ"
FT   gene            complement(168541..168951)
FT                   /locus_tag="BMA10229_A0162"
FT   CDS_pept        complement(168541..168951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0162"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01673"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2J8"
FT                   /protein_id="ABN01673.1"
FT                   /translation="MTPYRDITDEEWQRVAPLLPELRPRKELRGRPLADTRAVLNGVLW
FT                   VIYSGANWSAMPRRFPAYQTCHRRFKAWHESGALKRVLIELFGTQSDDLCELMAMRMRT
FT                   HARSKAAQARSEAASTTSSPVPRHDHTLEHVV"
FT   gene            complement(169146..170246)
FT                   /locus_tag="BMA10229_A0163"
FT   CDS_pept        complement(169146..170246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0163"
FT                   /product="ATPase, AFG1 type"
FT                   /note="identified by match to protein family HMM PF03969"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01657"
FT                   /db_xref="GOA:A2S2J9"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2J9"
FT                   /protein_id="ABN01657.1"
FT                   /translation="MMNVTEYYEHELKTRGYQSDAAQRAAVERLQRCYGEWVAYKARRS
FT                   NAFKKLVVRPDLPRGVYMWGGVGRGKSFLMDSFYAVVPVQRKTRLHFHEFMREVHRELE
FT                   ELKGQADPLDELARRIAKRYRLICFDEFHVSDIADAMILYRLLDRLFSNGVQFVMTSNY
FT                   DPDDLYPDGLHRDRMLPAIALLKERLDVLNVDAGVDYRQRTLTQVRMYHTPLGADADRE
FT                   LRHAFAQLAAVPDESPILHIEKREIKALRRADGVVWFDFATLCGGPRSQNDYLELASRF
FT                   HAIVLSDVPQMSPRMASEARRFTWLIDVLYDHKVKLLMSAAVPADDLYVEGPMANEFSR
FT                   TVSRIVEMQSKEYIEAPRRLIDTSLT"
FT   gene            complement(170350..171780)
FT                   /gene="lpdA_1"
FT                   /locus_tag="BMA10229_A0164"
FT   CDS_pept        complement(170350..171780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA_1"
FT                   /locus_tag="BMA10229_A0164"
FT                   /product="dihydrolipoyl dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by similarity to GB:CAA62982.1; match to
FT                   protein family HMM PF00070; match to protein family HMM
FT                   PF00890; match to protein family HMM PF02852; match to
FT                   protein family HMM PF07992; match to protein family HMM
FT                   TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02411"
FT                   /db_xref="GOA:A2S2K0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2K0"
FT                   /protein_id="ABN02411.1"
FT                   /translation="MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKL
FT                   GGTCLNVGCIPSKALLASSEEFENAQHHLADHGISVDGVKMDVAKMLARKDGIVEKMTG
FT                   GIEFLFKKNKITWLKGHGKFTGKSDAGVQIEVSGEGETQVVTAKNVIIATGSKARHLSN
FT                   VPVDNKIVADNEGALAFDSVPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPAFLGA
FT                   ADEALAKEAAKLFKKQGLDIHLGVKIDGVKTGANGVSIAYTDKDGNAKTLDADRLIVSV
FT                   GRVPNTDNLGLEAIGLKANERGFIDVDDHCRTAVPNVYAIGDVVRGPMLAHKAEDEGVL
FT                   VAEVIDGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGREIKSGKFPFSINGRALG
FT                   MNAPDGFVKMIADAKTDELLGVHVIGANASDLIAEAVVAMEFKAASEDIARICHPHPSM
FT                   SEVMREAALAVDKRSLNS"
FT   gene            complement(171880..173154)
FT                   /gene="sucB"
FT                   /locus_tag="BMA10229_A0165"
FT   CDS_pept        complement(171880..173154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="BMA10229_A0165"
FT                   /product="dihydrolipoyllysine-residue succinyltransferase,
FT                   E2 component of oxoglutarate dehydrogenase
FT                   (succinyl-transferring) complex"
FT                   /EC_number="2.3.1.61"
FT                   /note="identified by match to protein family HMM PF00198;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF02817; match to protein family HMM TIGR01347"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03185"
FT                   /db_xref="GOA:A2S2K1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2K1"
FT                   /protein_id="ABN03185.1"
FT                   /translation="MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKV
FT                   VLEVPAPAAGVLAQVLQNDGDTVVADQVIATIDTEAKAGAAAAAAGAADVQSAAAPVAA
FT                   PAPAAQPAAAASSTAATSPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPKAA
FT                   PAAAPAKAAAKPALPEVKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILT
FT                   TFNEVNMQPVMDLRAKYKDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIV
FT                   YHGYFDIGIAVGSPRGLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTF
FT                   SISNGGVFGSMLSTPIINPPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIID
FT                   GREAVLSLVAMKDALEDPARLLLDL"
FT   gene            complement(173282..176146)
FT                   /gene="sucA"
FT                   /locus_tag="BMA10229_A0166"
FT   CDS_pept        complement(173282..176146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="BMA10229_A0166"
FT                   /product="2-oxoglutarate dehydrogenase, E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="identified by match to protein family HMM PF00676;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM TIGR00239"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01370"
FT                   /db_xref="GOA:A2S2K2"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2K2"
FT                   /protein_id="ABN01370.1"
FT                   /translation="MSDVMKQFQLNSYLFGGNASYVEELYEAYLDNPASVPDNWREYFD
FT                   ALQNVPATDGSNASDVAHNPIVESFAQRAKANAFIPRESGGNLATARKQVHVQSLISAY
FT                   RFLGSQWANLDPLKRRERPAIPELEPAFYDFSEADLDQTFSASNLYFGFEQASLRDIVK
FT                   GLRDTYCGTIGAEFMYISDPEQKRWWQERLESTRATPNFSADKKKHILNRLTAGEGLER
FT                   YLHTKYVGQKRFSLEGGESFIAAMDEVVQRAGSKGVQEIVIGMAHRGRLNVLVNTLGKM
FT                   PADLFAEFEGKHVDDLPAGDVKYHKGFSSDIATEGGPVHLSLAFNPSHLEIVNPVVEGS
FT                   AKARMDRRGDADGLQVLPVQIHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQI
FT                   GFTTSDPRDARSTLYCTDVVKMIEAPVLHVNGDDPEAVVLATQIAIDYRMQFHKDVVID
FT                   IVCFRKLGHNEQDTPAVTQPLMYKKIAQHPGTRALYAEKLVQQGVISADDADGFVKAYR
FT                   KAMDDGHHTVDPVLSNYKSKYAVDWMPFLNRKWTDAADTAVPLAELKRLGERITTVPEN
FT                   FKVHPLVERVINDRRNMARGDQPLDWGMGEHLAYASLVASGYAVRLTGQDSGRGTFTHR
FT                   HAVLHDQNRERWNDGTYVPLQNVSEGQAKFNVIDSVLSEEAVLGFEYGYSTAEPNTLVL
FT                   WEAQFGDFANGAQVVIDQFISSGEVKWGRVSGLTMLLPHGYEGQGPEHSSARIERYLQL
FT                   CAEHNMQVVQPTTPAQIFHLLRRQMIRLFRKPLIVATPKSLLRHKEAVSDLSELAKGSF
FT                   QPVLGEVDGGIDAKKVKRVIACSGRVYYDLVAHRREAKANDVAIVRIEQLYPFAHKQFE
FT                   AEMKKYENATEVVWVQDEPQNQGPWFYVEHHLKEGMKEGQKLAYSGRPASASPAVGYYA
FT                   KHYEQQKALVEGAFGRLKSASIAK"
FT   gene            complement(176485..178311)
FT                   /gene="typA"
FT                   /locus_tag="BMA10229_A0167"
FT   CDS_pept        complement(176485..178311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="BMA10229_A0167"
FT                   /product="GTP-binding protein TypA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01411"
FT                   /db_xref="GOA:A2S2K3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2K3"
FT                   /protein_id="ABN01411.1"
FT                   /translation="MTRALRNIAIIAHVDHGKTTLVDQLLRQSGTFRENQQVAERVMDS
FT                   NDIEKERGITILAKNCAVEYEGTHINIVDTPGHADFGGEVERVLSMVDSVLLLVDAVEG
FT                   PMPQTRFVTKKALALGLKPIVVINKIDRPGARIDWVINQTFDLFDKLGATEEQLDFPIV
FT                   YASGLNGYASLDPAARDGDMRPLFEAILQHVPVRPADPDAPLQLQITSLDYSTYVGRIG
FT                   VGRITRGRIKPGQPVVMRFGPEGDVLNRKINQVLSFQGLERVQVDSAEAGDIVLINGIE
FT                   DVGIGATICAVEAPEALPMITVDEPTLTMNFLVNSSPLAGREGKFVTSRQIRDRLMKEL
FT                   NHNVALRVKDTGDETVFEVSGRGELHLTILVENMRREGYELAVSRPRVVMQEIDGVKHE
FT                   PYELLTVDLEDEHQGGVMEELGRRKGEMLDMVSDGRGRTRLEYRIPARGLIGFQSEFLT
FT                   LTRGTGLMSHIFDSYAPVKEGSVGERRNGVLISQDDGAAVAYALWKLQDRGRMFVKPGD
FT                   ALYEGMIIGIHSRDNDLVVNPIKGKQLTNVRASGTDEAVRLVPPIQMSLEYAVEFIDDD
FT                   ELVEVTPQSIRLRKRHLKEHERRRASREAEAG"
FT   gene            178264..178404
FT                   /locus_tag="BMA10229_A0168"
FT   CDS_pept        178264..178404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0168"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02140"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2K4"
FT                   /protein_id="ABN02140.1"
FT                   /translation="MVDVGDDGDVAKGAGHRNLKTDGTRKRARTVLSDARALCSLESLK
FT                   L"
FT   gene            178604..179101
FT                   /locus_tag="BMA10229_A0169"
FT   CDS_pept        178604..179101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0169"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02741"
FT                   /db_xref="GOA:A2S2K5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2K5"
FT                   /protein_id="ABN02741.1"
FT                   /translation="MSDPSSPQPDQDLALYQINDSVGYLMSRVKSLMTNMVTQRTQTEL
FT                   GITGTQATMLFMLAVGKCSTAAELAREYGIDASAITRLLDRVEKRGLLQRVRSSEDRRV
FT                   VRLELTDEGRALTKRMPAIFRSVLDEVLDGFTPEEVGFLKSMLRRILVNSGECPGATGS
FT                   TS"
FT   gene            179201..180697
FT                   /locus_tag="BMA10229_A0170"
FT   CDS_pept        179201..180697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0170"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01001"
FT                   /db_xref="GOA:A2S2K6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2K6"
FT                   /protein_id="ABN01001.1"
FT                   /translation="MKTFPLSACRTAVAVAVAALALAGCANYFGLKNDKAIAPAAQFES
FT                   ARSLPAQGGQWPSLDWANQFGDPQLPKLIDEALEGNPTIAQAQARIAKASSYIESSRST
FT                   LLPKADAKYSWTRELYSGNALFPPPYGGQWYSENNALASASWELDLWGKNRARLNAAVS
FT                   QEKAAEADLQQARVTLATSVARTYNQLAQLYALRDIAGREISNRQTVDKITDGRVGAGL
FT                   DTNVERQTARGNIATSQSTLSDLDGQITNVRYQLAALLGKGPDRGLQIAAPVLSAGGAV
FT                   ALPENLPADLVSRRPDLVAARWQVEAAMHDVKEAKAEFFPDINLAAGFGFDAFGWGRFL
FT                   NFASRQAQFGPAIHLPIFDGGALRAQLKGRYADFDLSVANYNQTLINALNDVATQVASI
FT                   RSVDTQMGDAQRALDASTRAYELAVIRYKAGLSPQLQVLNADSNRLAAEQTVTNLKMRR
FT                   RDLQIGLVKALGGGFDAAGTRLAAPAPASAPAAPAQHASN"
FT   gene            180765..182000
FT                   /locus_tag="BMA10229_A0171"
FT   CDS_pept        180765..182000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0171"
FT                   /product="putative multidrug resistance protein"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03238"
FT                   /db_xref="GOA:A2S2K7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2K7"
FT                   /protein_id="ABN03238.1"
FT                   /translation="MSDPQQNAAPAQPQNNGKRKRMMTLLVVVIAIAAIAYGLYYLLVA
FT                   RFHETTDDAYVNGNVVQITPQVTGTVIAVKADDTQTVKSGDPLVVLDPADSQVALQQAE
FT                   ANLAQTVRQVRGLYVNDDQYRAQVALRQSDLSKAQDDLRRRLAVAQTGAVSQEEISHAR
FT                   DAVKAAQASLDAAGQQLASNRALTANTTVADHPNVLAAAAKVRDAYLNNARNTLPAPVT
FT                   GYVAKRSVRVGQRVSPGTPLMSVVPLNAVWVDANFKEVQLKHMRIGQPVELTADIYGSS
FT                   VKYHGKVIGFSAGTGAAFSLLPAQNATGNWIKVVQRLPVRVELDPKELKEHPLRIGLSM
FT                   QVDVDIKDESGNQLGNVQNTVYETDVFAKYGDEADAEIARIIAQNAGGGAAGGASAPTP
FT                   AAKLVGRASNLM"
FT   gene            182023..183582
FT                   /locus_tag="BMA10229_A0172"
FT   CDS_pept        182023..183582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0172"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02628"
FT                   /db_xref="GOA:A2S2K8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2K8"
FT                   /protein_id="ABN02628.1"
FT                   /translation="MAQPHAPLPPLAGGQLILGTIAVSLAVFMNVLDTSIANVAIPTIS
FT                   GDLGVSSDQGTWVITSFAVANAISVPLTGWLTDRIGQVRLFLASIILFVISSWMCGLAP
FT                   TLPFLLASRVLQGAVAGPMIPLSQALLLSSYPRAKAPMALALWSMTTLIAPVAGPILGG
FT                   WISDNYSWPWIFYVNIPVGIAAAAVTWMIYRSRESAVRRAPIDGVGLALLVIWVGSLQI
FT                   MLDKGKDLDWFASTTIVVLALTALIAFAFFVVWELTAEHPVVDLSLFRMRNFSGGTIAL
FT                   SVGYGLYFGNLVLLPLWLQTQIGYTATDAGLVMAPVGFFAILLSPLTGKFLSRTDPRYI
FT                   ATAAFLTFALCFWMRSRYTTGVDEWSLMAPTFVQGIAMAGFFIPLVSITLSGLPGHRIP
FT                   AASGLSNFVRIMCGGIGTSIFQTAWDHRNNFHHAQLVEQANPYNPTFNQAVTQMGQLGF
FT                   TRDQAHGLINNMATQQAAQLGVNDLFYISAAIFVLLIALIWITKPERAGGGDSSAAASA
FT                   AH"
FT   gene            complement(183853..184818)
FT                   /gene="truB"
FT                   /locus_tag="BMA10229_A0173"
FT   CDS_pept        complement(183853..184818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="BMA10229_A0173"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF01509;
FT                   match to protein family HMM PF09157; match to protein
FT                   family HMM TIGR00431"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01712"
FT                   /db_xref="GOA:A2S2K9"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2K9"
FT                   /protein_id="ABN01712.1"
FT                   /translation="MSIARALVQTMTTVSPRPRMARRALDGVLLLDKPVGLSSNDALMR
FT                   AKRLYQAKKAGHTGTLDPLASGLLPLCFGEATKFSQDLLEADKTYEATMRLGVRTTTGD
FT                   AEGDVLDTRDVSCDEAAVRAALARFVGEIVQVPPMYSALKRDGKPLYEYARAGQTVERE
FT                   GRTVTIRALALVSCALPDVTFRVTCSKGTYVRTLAEDIGEALGCGAHLTMLRRTGVGPL
FT                   TLEHAVTLDALDAATQDERDARLAPVDALLSTFPCVKLDAALATRFLHGQRLKLSELAA
FT                   RPDAAEGGRVRVYDADDRLLGVARASEGVLAPERLVVTGA"
FT   gene            complement(184815..185231)
FT                   /gene="rbfA"
FT                   /locus_tag="BMA10229_A0174"
FT   CDS_pept        complement(184815..185231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="BMA10229_A0174"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by match to protein family HMM PF02033;
FT                   match to protein family HMM TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01184"
FT                   /db_xref="GOA:A2S2L0"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2L0"
FT                   /protein_id="ABN01184.1"
FT                   /translation="MNGVARFADQPDGGFIMSKKRSSPNRNVQIADQIQRDLSELIMRE
FT                   VKDPRIGIVTIQSVELTPDYAHAKVYFTALTGTPADTQEALNHAAGHLHNLLFKRLHIH
FT                   TVPTLHFHYDQTIEKAVAMSRLIDEANATRAKDD"
FT   gene            complement(185289..188216)
FT                   /gene="infB"
FT                   /locus_tag="BMA10229_A0175"
FT   CDS_pept        complement(185289..188216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="BMA10229_A0175"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM PF03144; match to protein family HMM PF04760;
FT                   match to protein family HMM PF08364; match to protein
FT                   family HMM PF08477; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03072"
FT                   /db_xref="GOA:A2S2L1"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2L1"
FT                   /protein_id="ABN03072.1"
FT                   /translation="MASNNVAQFAAELKMPAGVLLEQLQAAGVQKASEDDALSETDKAR
FT                   LLDHLRKSHGATDGDKRKITLTRRHTSEIKQADATGKARTIQVEVRKKRTFVKRDDVSE
FT                   TGADQAQAQTDEQAEAELKRREEEARREAELLEKQAQELRERQERLEREEAERRAREEA
FT                   AEAERRRAEEEAAAKRAAAAQAEAAQQAAAAREQAQRAQSEPAEQSAQDEARAAAERAA
FT                   QREAAKKAEDAAREAADKARAEQEEIRKRREAAEAEARAIREMMNTPRRAQVKAVEPPK
FT                   PAEPPAAKAAEAKGTLHKPAKPAGEAAAARPAAKKPASGAPAPAAAPAGDRTKKPGTGK
FT                   SGWQDDAAKRRGIKTRGDSSGGVDRGWRGGPKGRGKHQDSASSFQAPTEPIVREVHVPE
FT                   TISVADLAHKMSIKASEVIKVMMKMGQMVTINQVLDQETAMIVVEELGHRALAAKLDDP
FT                   EALLVEGEIGSDAEQLPRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAY
FT                   HVETPRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAISHAKAGG
FT                   VPIVVAINKIDKPEANPDRVKQELVAEGVVPEEYGGDSPFVPVSAKTGAGIDDLLENVL
FT                   LQAEVLELKAPVESPAKGIVIEAKLDKGKGPVATVLVQSGTLSRGDVVLAGTAYGRVRA
FT                   MLDENGKPTKEAGPSIPVEIQGLSEVPGAGDEVIVLPDERKAREIALFRQGKFRDVKLA
FT                   KQQAAKLESMLEQMGEGEVQNLPLIIKADVQGSQEALVQSLLKLSTDEVRVQIVHSAVG
FT                   GISESDVNLATASKAVIIGFNTRADAQARKLAEANGIDIRYYNIIYDAVDEVKAAMSGM
FT                   LAPEKREVVTGMVEVRQVFKVPKVGTVAGCMVTDGVVKRSSSVRVLRNNVVIFTGELDS
FT                   LKRFKDDVKEVKQGFECGMSLKNFNDIVEGDQFEVFEVTEVARTL"
FT   gene            complement(188308..189783)
FT                   /gene="nusA"
FT                   /locus_tag="BMA10229_A0176"
FT   CDS_pept        complement(188308..189783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="BMA10229_A0176"
FT                   /product="N utilization substance protein A"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF08529; match to protein
FT                   family HMM TIGR01953; match to protein family HMM
FT                   TIGR01954"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01993"
FT                   /db_xref="GOA:A2S2L2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2L2"
FT                   /protein_id="ABN01993.1"
FT                   /translation="MSREVLMLVDALAREKNVDKDVVLGALEAALASASKKLFDEGAEI
FT                   RVHIDRESGEHETFRRWLVVPDEAGLQEPDREILLFEAREQKPDVEVGDYIEESVPSIE
FT                   FGRIGAQAAKQVILQKVRDAEREQILNDYLERGEKIMTGTVKRLDKGNFIVESGRVEAL
FT                   LRRDQLIPKENLRVGDRVRAYIAKVDRTARGPQIELSRTAPEFLMKLFEMEVPEIEQGL
FT                   LEIKAAARDPGVRAKIGVVAYDKRIDPIGTCVGIRGSRVQAVRNELGGENIDIVLWSED
FT                   PAQFVIGALAPAAVQSIVVDEEKHSMDVVVDENELAVAIGRSGQNVRLASELTGWQINI
FT                   MTPDESAQKQNEERDALRGLFMARLDVDEEVADILIDEGFTSLEEIAYVPLNEMLEIEA
FT                   FDEDTVHELRNRSRDALLTMAIANEEKVETAALDLKSLDGVTPELLAKLAEQGVQTRDD
FT                   LAELAVDELVDMTGMEEEAAKALIMKAREHWFQ"
FT   gene            complement(189780..190241)
FT                   /locus_tag="BMA10229_A0177"
FT   CDS_pept        complement(189780..190241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:17428301; match to
FT                   protein family HMM PF02576"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03360"
FT                   /db_xref="GOA:A2S2L3"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2L3"
FT                   /protein_id="ABN03360.1"
FT                   /translation="MQLTELIETTVTGLGYELVDLERTGRGMVCVYIDQPAGITIDDCE
FT                   KVTRQLQHVLTVENIDYERLEVSSPGLDRPLKKLADFTRFAGSEAVITLKKPLDGRKTY
FT                   RGILHAPNGETIGLEFERKKGEAAMLDFTLADIDKARLIPHVDFRSRKQ"
FT   gene            complement(190546..192210)
FT                   /locus_tag="BMA10229_A0178"
FT   CDS_pept        complement(190546..192210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0178"
FT                   /product="RNA pseudouridine synthase family protein"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02596"
FT                   /db_xref="GOA:A2S2L4"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2L4"
FT                   /protein_id="ABN02596.1"
FT                   /translation="MTDTHDIDSSESAHAVATARADDAPEQSAADAGGEDRPRRGLRRG
FT                   PRSLIARRRAAAKSKHSDAPESADAAPAADAGAGADVAKAPARAPRGKDAAAKPPRKTA
FT                   GKREGAARQGAQPKRGAQQAAAAVAPSAEAGQDDVFAYVISPAFDADNNAPGGGVRAPM
FT                   LRRGRQTQPKRVLSPDDDAPKLHKVLAEAGMGSRREMEELIIAGRVSVNGEPAHIGQRI
FT                   MPTDQVRINGKPVKRKLPSKPPRVLLYHKPTGEIVSHADPEGRPSVFDRLPPMKTAKWL
FT                   AVGRLDFNTEGLLMLTTSGDLANRFMHPRYSVEREYAVRVVGELSEASRQKLLHGVELD
FT                   DGPANFLRIRDGGGEGTNHWYHVALAEGRNREVRRMFEAVGLMVSRLIRTRHGPIPLPR
FT                   GLKRGRWEELDEAQVRRLMSTVGLKAPTEDKGGKRGGPVERRQPDPMQTSMGFINREPV
FT                   LTTHGQLDQPRRGRRGPAGGGFGAGLGGGYAGLPGYGGASRQGGRDVDGNRASYGGAGA
FT                   NKRGAGKGGRNPNGNRAEGGARGGPRTPQQRNRSRSR"
FT   gene            complement(192274..193602)
FT                   /gene="scpB"
FT                   /locus_tag="BMA10229_A0179"
FT   CDS_pept        complement(192274..193602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpB"
FT                   /locus_tag="BMA10229_A0179"
FT                   /product="segregation and condensation protein B"
FT                   /note="identified by match to protein family HMM PF04079;
FT                   match to protein family HMM TIGR00281"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02306"
FT                   /db_xref="GOA:A2S2L5"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2L5"
FT                   /protein_id="ABN02306.1"
FT                   /translation="MNAQEAKIVLETALICAQEPLKLGDLRKLFADGVSADTVRTLLED
FT                   LKQEWTGRGVELVALASGWRFQSKPAMRTYLDRLHPEKPPKYSRAVLETLAIIAYRQPV
FT                   TRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGQRDVPGRPALYATTKQFLDDLGLKALDD
FT                   LPALEEPAAHLEASLLAQQAIDFPDDARGDGEAPAVAPETDAAAAQAGEVAEPASDSVV
FT                   LRNEDTARADEPRQEGATDGLAARIGDPADNDAGRADVDVDAAPALGEADAPRGGDASG
FT                   HAAREIDSREMTEPADAGGEAAGTTASHTHAVAPYHDAQSAADAVAAPHAGDAAADGER
FT                   AESPSGTNENANYVAQPDAEPADAAHAATREAAADPAAGRATKEDHGAIGGIPHDAEPV
FT                   RAHAEEALDDTSDSLADAVRSASEAAPEHERQDDEDAPAKRRA"
FT   gene            complement(194021..194923)
FT                   /locus_tag="BMA10229_A0180"
FT   CDS_pept        complement(194021..194923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0180"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01750"
FT                   /db_xref="GOA:A2S2L6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2L6"
FT                   /protein_id="ABN01750.1"
FT                   /translation="MNITLRQLRVFIEVARLKSFSRAGDEIGLTQSAVSRSVRELEGEI
FT                   GLKLIDRTTRDVQLTDVGTNLIASVSRLLGDLDDALREIREIGEQRRGRVIVAASPTIA
FT                   CRLMPRVVAACERRFPFVTLGLRDDVQSDVLRKVKSGEVDFGVVIGPLATSELISEPLM
FT                   TDSFCLVARADHPLAARDRVPWTALAGERLVLLDYASGSRPLIDAALAAHRVAAGVVQE
FT                   LGHSATVFGLVEAGVGVSVLPWLSLPLPAGSSLVARPLAPRAERTVELVRRRDRSLSPA
FT                   ADAVWGLVKEMPARVEDLN"
FT   gene            195345..195743
FT                   /locus_tag="BMA10229_A0181"
FT   CDS_pept        195345..195743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0181"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02179"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2L7"
FT                   /protein_id="ABN02179.1"
FT                   /translation="MLFDDLRDNEWALLEGLFCSEPARSERRGRPRVEARSVVNAVLWV
FT                   LSTGEGWSKLPGRYPSPPTCRRRFDEWQADGTLAEVVKRLGTSGRQISLRGRIGASAVK
FT                   PPAPPSRDRLRGAFWTNPESWRAPVKMA"
FT   gene            complement(196365..196658)
FT                   /locus_tag="BMA10229_A0182"
FT   CDS_pept        complement(196365..196658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0182"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02440"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2L8"
FT                   /protein_id="ABN02440.1"
FT                   /translation="MLDALRRVQYRQVPWARRPGVFEYLRALGLMDTVRQKTVAPAPGF
FT                   HAPVDIAVLTDNGRVEFTRLERDEKQPDWETRRIEDYALSEASAVSILESRL"
FT   gene            196883..197605
FT                   /locus_tag="BMA10229_A0183"
FT   CDS_pept        196883..197605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02698"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02692"
FT                   /db_xref="GOA:A2S2L9"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2L9"
FT                   /protein_id="ABN02692.1"
FT                   /translation="MILFNSFGLLFVVFLLCRKRRGAFAILAAGAALLWLIASGWLAAP
FT                   LVALAQAGMQPVAHPTMTGDTVIVMLGAGIERRDGVAIPPRDALARIDKTAELYSACRR
FT                   TAQRCTVVVSGGDPQVRGIAEADTYAPYLLARGVASADLIREKRSHTTYENARFTAPIL
FT                   RAQHYDDLILVTSSYQMKRALLDFERFGFAPQPVYANRRDARLGWLPRAANLANAELAL
FT                   HEIVGVAQFHVYRRLGWF"
FT   gene            197844..198122
FT                   /locus_tag="BMA10229_A0184"
FT   CDS_pept        197844..198122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03838"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2M0"
FT                   /protein_id="ABN03838.1"
FT                   /translation="MKKMTMAILVSMSALAGAAQAQESTEIKTITDPAKIAEIEQRAQA
FT                   LQQQQAAAPAAEAMPMHEQHKPKHHAKKAHKGAKKAAKAAPADAASQ"
FT   gene            198271..198528
FT                   /locus_tag="BMA10229_A0185"
FT   CDS_pept        198271..198528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01683"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2M1"
FT                   /protein_id="ABN01683.1"
FT                   /translation="MSNIQLDIEWTEAATRKIKQLMPRGSDDAFLALPPIECLPMEGDV
FT                   LFLGPQGKQQPFIVAERQYHHDGDADWTIILILDVPNASH"
FT   gene            complement(198578..198868)
FT                   /locus_tag="BMA10229_A0186"
FT   CDS_pept        complement(198578..198868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0186"
FT                   /product="antibiotic biosynthesis monooxygenase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01968"
FT                   /db_xref="GOA:A2S2M2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2M2"
FT                   /protein_id="ABN01968.1"
FT                   /translation="MSEVAVVALIVAKPGAEAKLLEQLEGIVGPTRSEEGALQYDLHRD
FT                   LQEPRRFIFIERWASEAALAAHARSAHIDAYKRAAADWIESSEIRVASKVA"
FT   gene            199018..199281
FT                   /locus_tag="BMA10229_A0187"
FT   CDS_pept        199018..199281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0187"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02648"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABN02648.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            199305..200138
FT                   /locus_tag="BMA10229_A0188"
FT   CDS_pept        199305..200138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0188"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03353"
FT                   /db_xref="GOA:A2RWN9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RWN9"
FT                   /protein_id="ABN03353.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQGYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            200213..200824
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0189"
FT                   /note="ISBma2, transposase, truncation; comparison of this
FT                   gene to its homologs suggests this gene has been truncated"
FT   gene            complement(200937..202163)
FT                   /locus_tag="BMA10229_A0190"
FT   CDS_pept        complement(200937..202163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0190"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01516"
FT                   /db_xref="InterPro:IPR010653"
FT                   /db_xref="InterPro:IPR042268"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2M5"
FT                   /protein_id="ABN01516.1"
FT                   /translation="MWKDSQNMTDLRLTKRFAALLATGAFVAGCSSPSPTKIDYKSDSK
FT                   SKEVSLAVPPNMLDETPDQRSLPPQGGATSLSSLQQVQQAAPPTDSVAPAVPGMHIQRD
FT                   GTESWLVIDDKAPAQIWPQVRRFWQEQGFLLVVEQRDKGVMETDWNETHPQINDGLIRG
FT                   VISKAMGNSYVTAERNKYRTRLDAAPNGGTYVFISQKGMREALTGANNDSSKWEPKPND
FT                   PGLETEYLKRLMAVIAQNDARVKAAGVPITDDAAPSRAKASSNKSKEAAAAIAAKNVAS
FT                   ASTSSAPSGASVPDVPPEVTLAEPYDRSWLHVGLALDRANFTVDDRDRTKGLYYVRYVD
FT                   PKDLSVEEQGFWSQLFHGKKEKKAKQYLVNVKAVTEGETRIAVVDDKGNVDASAPARQI
FT                   MSLLVNQLR"
FT   gene            202320..202451
FT                   /locus_tag="BMA10229_A0191"
FT   CDS_pept        202320..202451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0191"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02262"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2M6"
FT                   /protein_id="ABN02262.1"
FT                   /translation="MGPRRARTSASARCAAHPRPLGITSIRFPQFQAPRAPALTIMN"
FT   gene            202492..202983
FT                   /locus_tag="BMA10229_A0192"
FT   CDS_pept        202492..202983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0192"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01775"
FT                   /db_xref="InterPro:IPR021267"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2M7"
FT                   /protein_id="ABN01775.1"
FT                   /translation="MNNKKSSPPTRRRPTRALVAAAAVTFAPVTAQSQLGSTVASPSAR
FT                   ALVQASSATLPNGAVTMRSYVDAGGTTIHEYATRAGLVFAYTWDGPTSPNLRKLLGERF
FT                   PTFQSHAVTTDAHARASLHAGRVAQSDFVVEAGGRMRAYVGRAWLPGAVPPGVSIDDLR
FT                   "
FT   gene            202994..204196
FT                   /locus_tag="BMA10229_A0193"
FT   CDS_pept        202994..204196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0193"
FT                   /product="putative liporotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01295"
FT                   /db_xref="InterPro:IPR021847"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2M8"
FT                   /protein_id="ABN01295.1"
FT                   /translation="MPLKIAWYTAALAATLAACGGGGGGGGSTTSNSNGTGVTPSSAAN
FT                   VQPVTVSAGITGAANMLMTSVTVCVPNTNQCQTIDNVQVDTGSDGLRILAAALPSSVAL
FT                   PVVPAANAPITGACAIFGTGFTWGAVRRADVRIAGEIAANIPIQVIADSSTPNAPIDCT
FT                   QSAGPMQTQGALRANGILGIGLFVTDCGTACANSALPGWYYGCTTSGTCASTSQPIAQQ
FT                   IANPIGAFASDNNGSIIVLPAISPTGAATVNGSLIFGIGTQANNGLGTATPLVTTASDA
FT                   YVTSVLNGNTNARTFFDSGSNGIFFANASLPQCGSWFCPASTQTFDITLSSGNGASKAT
FT                   TFQVASSQVLFSTFNFAFNDLAGPIGNVVDLGLSFFYGRNVYTALEGSATPAGPGPYYA
FT                   Y"
FT   gene            204419..204495
FT                   /locus_tag="BMA10229_A0194"
FT   tRNA            204419..204495
FT                   /locus_tag="BMA10229_A0194"
FT                   /product="tRNA-Pro"
FT   gene            204821..206941
FT                   /locus_tag="BMA10229_A0195"
FT   CDS_pept        204821..206941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0195"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF05665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03302"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2M9"
FT                   /protein_id="ABN03302.1"
FT                   /translation="MRSCAGTAVTLAVLSAGCAESTPKSGNGGAASTAIERTKADRLAR
FT                   EQQTARTVPTLASIKIDQPRPLTLRDSGQSGTLAFLREVDFRIVGDLGFLVHELSATLV
FT                   PTHPGAPTVFDDPTSFDIAVHRGTVTLDNTKLNALFGGYIFGYRNAPLRNVRVSAGDGF
FT                   LDIRGEMQRDGWVPFALKGKLEIRDGSTLVFHPTDVHVSGIEAGPVMRAAKVQVSDLLK
FT                   IDTPIVRLNGNDLVLNVDKLLPPPHLKINIVSLKLTSAGLDLVLDDGTKAGFTMPENAP
FT                   KHAMYLRGGDVKFMRTMPMNADIVIYPPRESSPDDAFVFDMYHYRDQLVAGYFNFEPSG
FT                   ALSILMPSYRRLARPSAPSLGSAAARMNDSLIDAQQSSLGEARRQWEAFAITPNGGAAQ
FT                   PNFRKVAAKHGGDVSMFGPRHISNGTTTIHLHNADFYIAGNIGFRVEDLVVQLVSKRAG
FT                   EPVDLDDPNQYDIRILSGSVLAPWDAMSDLFNRHLLDYSPRSLNDLKLSADGGALRVRG
FT                   GIKLWNQVPPGVWLPADMKGSLTLLDERHLAFTPTQVSVLGIPQAKLLRALGIELSSLA
FT                   PLKRRGAELRGDSLVLDQYTVFPPPVLIGHMSQATVEPDGLRLTFRPAPNAPVLRPPAN
FT                   LPGSYLWLEGGDTKMFNVLVLNMRILVEDTAKPRVRFDLYDYRDVVSRGSVRMVHDGTL
FT                   YVDVGKKDPLAR"
FT   gene            complement(207063..207467)
FT                   /locus_tag="BMA10229_A0196"
FT   CDS_pept        complement(207063..207467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0196"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02745"
FT                   /db_xref="GOA:A2S2N0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2N0"
FT                   /protein_id="ABN02745.1"
FT                   /translation="MTSTVEKVVLPPIPAKRYFTIGEVSELCGVKPHVLRYWEQEFTQL
FT                   RPVKRRGNRRYYQHHEVLLIRRIRELLYEQGFTINGARNRLDAVGSERGAPPEPDELEQ
FT                   HAAEHAARETVDVAQLRRALLDVIGALKRD"
FT   gene            complement(207526..207930)
FT                   /gene="ihfA"
FT                   /locus_tag="BMA10229_A0197"
FT   CDS_pept        complement(207526..207930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfA"
FT                   /locus_tag="BMA10229_A0197"
FT                   /product="integration host factor, alpha subunit"
FT                   /note="identified by match to protein family HMM PF00216;
FT                   match to protein family HMM TIGR00987"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01868"
FT                   /db_xref="GOA:A2S2N1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2N1"
FT                   /protein_id="ABN01868.1"
FT                   /translation="MNDMNSSEFEALLTAQRSAMSRDVPASTPAGDTPTLTKAELAELL
FT                   FDSVGLNKREAKDMVEAFFEVIRDALENGESVKLSGFGNFQLRDKPQRPGRNPKTGEAI
FT                   PIAARRVVTFHASQKLKALVENGAEPDLAR"
FT   gene            complement(208003..210435)
FT                   /gene="pheT"
FT                   /locus_tag="BMA10229_A0198"
FT   CDS_pept        complement(208003..210435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="BMA10229_A0198"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM PF03147; match to protein
FT                   family HMM PF03483; match to protein family HMM PF03484;
FT                   match to protein family HMM TIGR00472"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01802"
FT                   /db_xref="GOA:A2S2N2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2N2"
FT                   /protein_id="ABN01802.1"
FT                   /translation="MQFPESWLRTFVDPQLTTDELSHALTMAGLEVESLRPAAPPTEKI
FT                   VVGRVLEVVKHPDADKLNVCQVDAGTGATLQIVCGAPNVAPGIKVPVALVGAKLPPAEE
FT                   GGAPFAIKLSKLRGVESQGMLCSARELKLSEDHSGLMILPEGTPVGQDIREALNLDDTV
FT                   FEIKLTPNKADCLSVFGIARETAAITGAPLAAPDIRPVLAELTETLPVKISAPDLCGRF
FT                   SGRVIRGVNARAKTPHWMVERLERAGQRSVSALVDISNYVMFELGRPSHVFDLDKIHGG
FT                   IDVRWGKRGESLKLLNGNTIELDETVGVISDGAQVESLAGIMGGDSTAVTLDTTNIYLE
FT                   AAFWWPDSIRGRARKYNFSTDAAHRFERGVDYSTTVEHVERITQLILDICGGQAGPVDD
FT                   QIVSLPQRAPVSMRASRANRIIGVEIGEDEIAQIFTRLGLAFERDGDVFRVTPPPHRFD
FT                   IEIEEDLIEEVARIYGFEKIPARPPVAKSEMRATDETRRSVHAIRHALAARDYAETVNF
FT                   SFVDAEWERDFAGNDNPVRLLNPIASQLSVMRTTLFGSLVGVLRHNLNRRAERVRVFEA
FT                   GRVFVADPSVKAGELAVEGYAQPKRIGALAYGPVVEEQWGTATRQVDYFDVKGDLEALL
FT                   APVPARFVKAEHPALHPGRSARIEVDGHAVGWIGELHPRLMQKYELPHAPVMFEIDTDA
FT                   LVARALPAPSEVSKFPPVRRDIAVVVDQKVEVQALFDEMKKALADDACKFVQRVALFDE
FT                   FRAKSNTSGGLSAHEKSLAFRVTLQDAAGTLQDETVDQAIQTLVDRMARVYGARLRG"
FT   gene            complement(210523..211554)
FT                   /gene="pheS"
FT                   /locus_tag="BMA10229_A0199"
FT   CDS_pept        complement(210523..211554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="BMA10229_A0199"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01409;
FT                   match to protein family HMM PF02912; match to protein
FT                   family HMM TIGR00468"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00899"
FT                   /db_xref="GOA:A2S2N3"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2N3"
FT                   /protein_id="ABN00899.1"
FT                   /translation="MEVMGSMDLDQIVADAQQSFEGAADITTLENEKARFLGKSGALTE
FT                   LLKGLGKLDPETRKTEGARINVAKQQVEAALNARRQALADALLNQRLAAEAIDVTLPGR
FT                   GAGAGSLHPVMRTWERVEQIFRSIGFDVADGPEIETDWYNFTALNSPENHPARSMQDTF
FT                   YVDGKDADGRPLLLRTHTSPMQVRYARMNRPPIKVIAPGRTYRVDSDATHSPMFNQVEG
FT                   LWIDENVSFADLKGAYTDFLKKFFERDDILVRFRPSYFPFTEPSAEIDMMFEHGKNAGK
FT                   WLEISGSGQVHPTVIRNMGLDPERYIGFAFGSGLERLTMLRYGVQDLRLFFENDLRFLR
FT                   QFA"
FT   gene            complement(211685..212044)
FT                   /gene="rplT"
FT                   /locus_tag="BMA10229_A0200"
FT   CDS_pept        complement(211685..212044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="BMA10229_A0200"
FT                   /product="50S ribosomal protein L20"
FT                   /note="identified by match to protein family HMM PF00453;
FT                   match to protein family HMM TIGR01032"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00864"
FT                   /db_xref="GOA:A2S2N4"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2N4"
FT                   /protein_id="ABN00864.1"
FT                   /translation="MPRVKRGVTARARHKKIINLAKGYRGRRNNVYRIAKQAVMRAGQY
FT                   AYRDRRNKKRVFRALWITRINAAVRQHDMTYSVFINGLKKASIELDRKVLADMAVFDKA
FT                   AFAAIVKQVKAAVAA"
FT   gene            complement(212465..212935)
FT                   /gene="infC"
FT                   /locus_tag="BMA10229_A0201"
FT   CDS_pept        complement(212465..212935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="BMA10229_A0201"
FT                   /product="translation initiation factor IF-3"
FT                   /note="identified by match to protein family HMM PF00707;
FT                   match to protein family HMM PF05198; match to protein
FT                   family HMM TIGR00168"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02754"
FT                   /db_xref="GOA:A2S2N5"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2N5"
FT                   /protein_id="ABN02754.1"
FT                   /translation="MRLVGVDGEPIGIVRLAEAFRKSEELDVDLVEIAPQAAPPVCRLM
FT                   DYGKFKYQEAKKQHEAKLKQKVIQVKEVKFRPGTDDGDYNVKLRNLVRFLEEGDKTKIT
FT                   LRFRGREMAHQEIGMRMLERLRGDLDEVGQVEQMPKMEGRQMIMVLSPKKKK"
FT   gene            complement(213039..214946)
FT                   /gene="thrS"
FT                   /locus_tag="BMA10229_A0202"
FT   CDS_pept        complement(213039..214946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="BMA10229_A0202"
FT                   /product="threonine--tRNA ligase"
FT                   /EC_number="6.1.1.3"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02824; match to protein
FT                   family HMM PF03129; match to protein family HMM PF07973;
FT                   match to protein family HMM TIGR00418"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03107"
FT                   /db_xref="GOA:A2S2N6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S2N6"
FT                   /protein_id="ABN03107.1"
FT                   /translation="MVSIRLPDGSVRQYEHPVTVAEVAASIGPGLAKAALGGKLDGELV
FT                   DTSALIDRDASLAIVTDKDADGLDIIRHSTAHLLAYAVKELHPDAQVTIGPVIDNGFYY
FT                   DFSYHRPFTPEDLEAIEKRMQELAKRDEPVTRRVVSRDEAVSYFRSIGEKYKAEIIESI
FT                   PASDEIKLYSHGSFTDLCRGPHVPSTGKLKVFKLMKVAGAYWRGDSKNEQLQRIYGTAW
FT                   TRKEDQDAYLHMLEEAEKRDHRKLGKQLDLFHIQEEAPGMVFWHPKGWTLWQQVEQYMR
FT                   RRLDAAGYLEIKTPMIMDRSLWEASGHWQNYRENMFTTESEKRDYAIKPMNCPGHVQVF
FT                   KHGLRSYRDLPLRYAEFGSCHRNEASGALHGLMRVRGFVQDDAHIFCTEDQINSEAIAF
FT                   NKLAMSVYEDFGFDRIDIKLSLRPEQRMGSDETWDHAEEGLRNALKACGLEWEELPGEG
FT                   AFYGPKIEYHIKDALGRSWQCGTLQLDMMLPERLGAEYVAEDNSRRRPVMLHRAIVGSM
FT                   ERFLGILIEHHAGAMPVWLAPAHAVVLNIAESQAEYARTVAQSLQKQGLRVSADLRNEK
FT                   ISYKIREHTLEKVPYLLVVGDKEREAQTVAVRARGGVDLGVMPVEAFVERLREDIQAFK
FT                   "
FT   gene            complement(215220..215296)
FT                   /locus_tag="BMA10229_A0203"
FT   tRNA            complement(215220..215296)
FT                   /locus_tag="BMA10229_A0203"
FT                   /product="tRNA-Val"
FT   gene            complement(215405..217642)
FT                   /locus_tag="BMA10229_A0204"
FT   CDS_pept        complement(215405..217642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0204"
FT                   /product="GTP diphosphokinase"
FT                   /EC_number="2.7.6.5"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF02824; match to protein
FT                   family HMM PF04607; match to protein family HMM TIGR00691"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03132"
FT                   /db_xref="GOA:A2S2N7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2N7"
FT                   /protein_id="ABN03132.1"
FT                   /translation="MTADSASTAAAPSLDDVLAFVREHAGDARLSSGERLADHAAGTST
FT                   IMQRLNVDPPATQAAALFALAPYLSDPDKQIAEHFGDEVAHLVADVRKLLRLGTVSLRA
FT                   AQSAPVDAGRDAQAERRAQIEALRKMLLAFAQDIRVVLIRLASRLQSLRYYAAAKIEPP
FT                   PDVARETLEIYAPLANRLGIWQLKWELEDLAFRFEDPVTYKRIAKLLDEKRVEREAYVA
FT                   GAIERLQHELAAAHIQAEVSGRPKHIYSIWRKMRGKELDFSELYDVRAFRVIVPDIKDC
FT                   YTVLGIVHHLWQPVPKEFDDYISRPKPNGYKSLHTVVIGDDGRAFEVQIRTQEMHRFAE
FT                   YGIAAHWRYKEAGARGYGGQFSASEKYDEKIAWLRQLLAWKDEIADGGGAEVSGQQAWA
FT                   QLREATLDDDHIYVLTPQARVIALPQGATPVDFAYHLHSELGHRCRGARVDGAMVPLNT
FT                   QLANGQTVEIVAVKEGGPSRDWLNPQLGYLHSSRARQKVRAWFNAVDQQENVAHGRALV
FT                   EKTLQREGKTSVNLEHLAAKLGFKSPDELFSVVGKEEFSLRNVEQALSDAPAPEPEPEA
FT                   PANFEKRASGANVAHGASAGVLVVGVDALLTQLARCCRPAPPDPISGFVTRGKGMSIHR
FT                   SDCATFRRMAERAPERVLQTTWSADVLGGRGASVYSVDLMIEATDRQGLLRDISEVFAR
FT                   EKMNVIGVKTQSRRNAAFMQFTVEVSSASQVQRACTLLGEIQGVVRAARKA"
FT   gene            complement(217687..218040)
FT                   /locus_tag="BMA10229_A0205"
FT   CDS_pept        complement(217687..218040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0205"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02402"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2N8"
FT                   /protein_id="ABN02402.1"
FT                   /translation="MAVTRHHVGPRLSEIAIHNGTVYLAGQIAEDTAQDIKGQTREVLA
FT                   HVDRLLAEANSDKAHLLSVQIFISDMANFPGMNEVWDAWVAHGATPPRATVEAKLANPA
FT                   CLVEVVVVAAQRG"
FT   gene            complement(218114..219250)
FT                   /locus_tag="BMA10229_A0206"
FT   CDS_pept        complement(218114..219250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0206"
FT                   /product="alpha/beta hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01408"
FT                   /db_xref="GOA:A2S2N9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2N9"
FT                   /protein_id="ABN01408.1"
FT                   /translation="MRLRRESMRPAHDCRNGLLARFGIGIDRAGRPASRDRPFGRPAAR
FT                   DEAVYNRLMCSAARRHRGAERSTTPIVRQDAPMSSNPATSVSPRERRVQCANPLGLHHI
FT                   AYTEWGDPANPRVLVCVHGLTRSGRDFDRLAAALSDVYRVVCPDVAGRGRSDWLADPKR
FT                   YAVPQYVSDIVTLIARLDVERVDWFGTSMGGLIGLALGGLPGTPIGRMLVNDIGPHIEP
FT                   AALERIGEYVGLDKRFATEQEGVDYLTSLSLSFGPLTPDEWRALNRPLLVRDADGSWRA
FT                   RYDPRIAEPFKTATPEANAQGEAWLWHALGAFAGPLLVVRGAQSDLLSRETLEAMKARG
FT                   QAVTSVEIAEAGHAPAFVSAEQIAIARQFFVGDAPHAS"
FT   gene            complement(219477..219647)
FT                   /locus_tag="BMA10229_A0207"
FT   CDS_pept        complement(219477..219647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0207"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03562"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2P0"
FT                   /protein_id="ABN03562.1"
FT                   /translation="MIRTSPRTTSPNSFDASWWASIMPPSPRRRSGSARTSRVFRRLAE
FT                   RIAERVGKAAG"
FT   gene            complement(220346..221251)
FT                   /locus_tag="BMA10229_A0208"
FT   CDS_pept        complement(220346..221251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0208"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03564"
FT                   /db_xref="GOA:A2S2P1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2P1"
FT                   /protein_id="ABN03564.1"
FT                   /translation="MLIDDLPALATFARIVAAGSLSAAARELDLSLSVVSKRLAQLETR
FT                   LGVRLLQRTTRQQTLTDEGALFHAQVVRILAEIEQAESLMRERRGTVSGALRITAPGEL
FT                   GRRRIAPIVAAFQRQHPQVTVQMQLTDAVVDLIAHDVDVAVRIGMLADSSLIARELAPN
FT                   YRVLCASPAYLAEHGMPAQPADLCAHRCIVLGEQPRVEWRFDGPHPAAVEVSAAFLTND
FT                   GGAARTLALEGAGIALKSIWDVGPDLAAGRLRRVLPECASSAAPLHAVYPSGRHLALRV
FT                   RTFVDYLGVELRRAWRWDER"
FT   gene            221439..221996
FT                   /locus_tag="BMA10229_A0209"
FT   CDS_pept        221439..221996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07366"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02832"
FT                   /db_xref="GOA:A2S2P2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2P2"
FT                   /protein_id="ABN02832.1"
FT                   /translation="MPALFRRRPLAAIRAAAALSLAATLAPAHADTTGLIEPAHLSVDG
FT                   SLPAVQRDAQILAARRYDTFWHNGDPALARAALADDFADRTPPPGRAPGLAGPLAASRT
FT                   MRAAIPDLSCEIEQMIVAGERVVVHLRFRGHFTGRFGPVQGKGQAIDFIATDIYRIERG
FT                   RIAENWHIEDNLTLLRELGIAA"
FT   gene            222011..223111
FT                   /locus_tag="BMA10229_A0210"
FT   CDS_pept        222011..223111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0210"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01283"
FT                   /db_xref="GOA:A2S2P3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2P3"
FT                   /protein_id="ABN01283.1"
FT                   /translation="MTTNMSDAAGAPAASFAPERRAFLARASGGLGLAAAGLALGAAAA
FT                   PGRALAAGATATADTGAASPAGGSPRRSPADEPEAAHGAFWPNGARLVISISMQFEAGG
FT                   QPPTGADSPFPPVDFPPQVPVDLASATWFAYGYREGIPRMLDLWDRHGVKVTSHMIGEA
FT                   VHRRPDLAREIVARGHEAAGHGPRWSAQYALPRDEERRFLIAAREMVETATGTRPVGYN
FT                   CNWLRRGPNTLPLLQELGYLYHIDDVSRDEPFIEQVNGQDFVVVPYTLRNNDILLIEGR
FT                   NYSPGQFLEQIKLDFDQLYDEAATRRRMMSISAHDRISGTPQMVRAWDAFLRYAQSHPG
FT                   VAFMRKDDIARHARRSPLTLREPETL"
FT   gene            223155..223877
FT                   /locus_tag="BMA10229_A0211"
FT   CDS_pept        223155..223877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0211"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00779"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2P4"
FT                   /protein_id="ABN00779.1"
FT                   /translation="MQASFNDQRVLVIGGSSGIGAAAAHAFAVLDADVTIASRDANKLA
FT                   GAARAIDGPRPVRQAVLDTTDAPAVDAFFAEAGPFDHVVMSAAHTPGGPVRKLPLADAQ
FT                   AAMNSKFWGAYRVARAARIAPGGSLTFVSGFLSVRPSASAVLQGAINAALEALARGLAL
FT                   ELAPVRVNTVSPGLVATPLWSKLDDAAREAMYASAAARLPARRVGQPEDVANAIVYLAA
FT                   TRYATGSTVLVDGGGAIA"
FT   gene            complement(224281..224922)
FT                   /locus_tag="BMA10229_A0212"
FT   CDS_pept        complement(224281..224922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0212"
FT                   /product="3-oxoacid CoA-transferase, B subunit family"
FT                   /note="identified by match to protein family HMM PF01144;
FT                   match to protein family HMM TIGR02428"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02162"
FT                   /db_xref="GOA:A2S2P5"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2P5"
FT                   /protein_id="ABN02162.1"
FT                   /translation="MAWNRDQMAARAAKELQDGFYVNLGIGLPTLVANHVPAGVEVWLQ
FT                   SENGLLGIGPSPTEDEVDADLINAGKQTVTTLPGSSIFSSADSFAMIRGGHINLAILGA
FT                   MQVSQRGDLANWMIPGKMIKGMGGAMDLVAGVKRVVVLMEHVAKGDQHKILEQCTLPLT
FT                   GVGVVDLIITDLGVIEVTPNGLKVLELADGVTVDEIQTKTGAPLDVSALA"
FT   gene            complement(224924..225628)
FT                   /locus_tag="BMA10229_A0213"
FT   CDS_pept        complement(224924..225628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0213"
FT                   /product="3-oxoacid CoA-transferase, A subunit family"
FT                   /EC_number="2.8.3.-"
FT                   /note="identified by match to protein family HMM PF01144;
FT                   match to protein family HMM TIGR02429"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02765"
FT                   /db_xref="GOA:A2S2P6"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2P6"
FT                   /protein_id="ABN02765.1"
FT                   /translation="MNKVYPSAAAALEGVVHDGQTFAVGGFGLCGIPEALIAALRDSAV
FT                   KGITCISNNAGVDGFGLGLLLETRQIKKMISSYVGENKEFERQYLSGELELEFTPQGTL
FT                   AEKLRAGGAGIPAFFTQTGYGTVIAEGKETREFDGKHYVLEPSLTADVALVKAWKADKS
FT                   GNLVYRRTARNFNPMCAMAGRITIAEVEEIVENGELDPDAIHTPGIFVQRLVLNATPEK
FT                   RIEQRVVRAKGD"
FT   gene            225881..226426
FT                   /locus_tag="BMA10229_A0214"
FT   CDS_pept        225881..226426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0214"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF08448"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02209"
FT                   /db_xref="GOA:A2S2P7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2P7"
FT                   /protein_id="ABN02209.1"
FT                   /translation="MPAIDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIG
FT                   RSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPL
FT                   AAGVWTFEDLSATRRVAVELTPREREIAAQLVTGKTSKQIGRVLDISSRTVDIYRARLM
FT                   RKYGTGNTAELLQRLLGQ"
FT   gene            226997..228529
FT                   /locus_tag="BMA10229_A0215"
FT   CDS_pept        226997..228529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01279"
FT                   /db_xref="GOA:A2S2P8"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2P8"
FT                   /protein_id="ABN01279.1"
FT                   /translation="MINAKTGFLFFIFVMSLIGCRPAFAQTNTPVTGIDLGGEIIEIIK
FT                   QNPQDPTQAINNYMSGVAATNVRWVRIHLDWSAIQPASTWIFTSDPNPGRSSGLTWGAT
FT                   DIVVRAARNYGIRILGVITSTPRWATHAQCPSYYRQSTDDAYKLCAPNLTSYTNFARAA
FT                   AKHYGNDSYGGKIDAWEIWNEPNCGPNFIPHDPVLYTRLVKSAYPAIKQANPSASVYAG
FT                   GSSGCLTSPNNGTGALPSSGVAGLVNSTDARYPAPTQWEPRDWLAVMYANGASGYFDGL
FT                   AHYPHCHSDDWQLPGDQCPSTTVNSVYPDYSNPFNIMWHTFASPSYGWPAPTGKTFASY
FT                   TGTSLRELMNANGDGGKPIVITEFGVATTASDGATDFTGQLGGSAQQYANADFQTIAPA
FT                   YLTQANQEREYKALIAWIANQPYGQYGPVYAYCYSDMALSSPYSANIYEPYFGLVTITA
FT                   STATSGTTGAPKIAGAYQAASGQYYPAWPNFGAAATAAANHTPGYAPVGPGW"
FT   gene            229458..230531
FT                   /locus_tag="BMA10229_A0216"
FT   CDS_pept        229458..230531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01263"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2P9"
FT                   /protein_id="ABN01263.1"
FT                   /translation="MAKLAASNQFGIPNQTDVFAVDGNGSLRVSWVVSAGAWNGPAQIG
FT                   PAGLFPSRAAVASSNQFGIPNQTDVFAVGRDGAQNVAWVVSADRWNGPTPISAAGLFPA
FT                   GAAIAASNQFGIPNQTDVFAVSDSGALNVAWVVSAERWNGPIPISAAGHFPAGAPLATS
FT                   NQFGIPNQTDVFVVDNKGALNVAWVVGAGSWNGPIPISPPGLFPPGAAVAASNQFGIPN
FT                   QTDVFVVDNQGALNVAWVVGADRWNGPVPISPAGLFPPGAAVAASNQFGIPNQTDVFAV
FT                   GRDGALRVAWVVSAGNWNGPVSISPTNLFPAGAAVAASNQFGIPNQTDVFAADSDGVLH
FT                   VAWVVSAGNWNGPISIA"
FT   gene            complement(230907..231338)
FT                   /locus_tag="BMA10229_A0217"
FT   CDS_pept        complement(230907..231338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0217"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03305"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Q0"
FT                   /protein_id="ABN03305.1"
FT                   /translation="MSDYTPVFEMSMPIRWGDMDAFGHVNNTVYFRYMEEARVTWFGKL
FT                   GIGGGNGEGQGPVVVNASMEFLRQLHYPGDVIARLSAAKPGRSSFDTAFELTRSDDPER
FT                   VYARGAARCVWVDYALGKSVPLPDLLRNTIESALQAKVD"
FT   gene            complement(231383..232162)
FT                   /locus_tag="BMA10229_A0218"
FT   CDS_pept        complement(231383..232162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0218"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02360"
FT                   /db_xref="GOA:A2S2Q1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Q1"
FT                   /protein_id="ABN02360.1"
FT                   /translation="MGRSINLEGKVALITGASSGLGQRFAQVLSQAGAKVVLASRRVER
FT                   LKELRAEIEAAGGAAHVVSLDVTDYQSIRAAVAHAETEAGTIDILVNNSGVSTMQKLVD
FT                   VSPADFEYVFDTNTRGAFFVAQEVAKRMMMRAGSGNAKPACRIINIASVAGLRPFSQIG
FT                   LYAMSKAAVVHMTRAMALEWGRHGINVNAICPGYIDTEINHYLWETEQGQKLQSMLPRR
FT                   RVGKPQDLDGLLLLLAADESQFINGSIVSADDGLGLA"
FT   gene            232343..234016
FT                   /locus_tag="BMA10229_A0219"
FT   CDS_pept        232343..234016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0219"
FT                   /product="putative electron transfer
FT                   flavoprotein-ubiquinone oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01494; match to protein
FT                   family HMM PF05187"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01466"
FT                   /db_xref="GOA:A2S2Q2"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Q2"
FT                   /protein_id="ABN01466.1"
FT                   /translation="MTPASLIEQYGPRESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGA
FT                   EIGVCVLEKGSEIGAHILSGAVMDPRAITELFPDWKEKGAPLNVDVTEDRFLFLTEKSS
FT                   FQVPNWALPDNFKNHGNYVISLGNVTRWLGQQAEALGVEIFPGFPAAEILYNDDGSVKG
FT                   VATGNMGVGKDGEPTENFQLGMELHAKYTLFCEGARGHLGRQLMDKFKLNANSDPQAYG
FT                   IGIKELWEIDPVKHKPGLVIHTAGWPLSSDTYGGSFLYHMDNNQVVVGFVVGLAYSNPY
FT                   LSPFEEFQRYKTHPAIRPFLEGGKRVSYGARAITAGGLLSLPKTVFPGGALVGDDAGFL
FT                   NASRIKGSHAAIKTGMLAAEAAFDAVQAGRQADELTAYPDAFKTSWLHTELYRARNFKQ
FT                   WMGKGLYLGTLMVGVEQKLMNGNVPWTLHHQHGDHEMLKPASQCQPIDYPKPDGKLTFD
FT                   RLSSVFISNTNHEENQPAHLTLKDASVPVNVNLRTYAGPEARFCPAAVYEFVKNDDGSD
FT                   RLVINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM"
FT   gene            234623..234886
FT                   /locus_tag="BMA10229_A0220"
FT   CDS_pept        234623..234886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0220"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03489"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABN03489.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            234910..235743
FT                   /locus_tag="BMA10229_A0221"
FT   CDS_pept        234910..235743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0221"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02559"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABN02559.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(235754..236290)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0222"
FT                   /note="putative histidinol-phosphate aminotransferase; this
FT                   gene contains a premature stop which may be the result of a
FT                   sequencing error"
FT   gene            complement(236318..236764)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0223"
FT                   /note="NikT protein; this gene contains a premature stop
FT                   which may be the result of a sequencing error"
FT   gene            complement(236826..237887)
FT                   /locus_tag="BMA10229_A0224"
FT   CDS_pept        complement(236826..237887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0224"
FT                   /product="jmjC domain protein"
FT                   /note="identified by match to protein family HMM PF02373"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03027"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Q7"
FT                   /protein_id="ABN03027.1"
FT                   /translation="MRASIRSGWTGEAFPPVGKRSANLRRSNSVCNASSNSGRTWCLPA
FT                   SASISINIRARESTMPYDEILPIETLVRPKVSDFREHYLEKERPVKIARALDAWPAMQK
FT                   WSLDYFENRFGDETIGVESFQPDERGPGNNSPQGYVKHLRFQELKLKELIRILRTKPDH
FT                   MYYMASHPFRKSFPNLRADLAPHPYVQGHIEHIPGAHMDSYLWIGPAGTHTPIHTDPMP
FT                   NFLTQIVGRKMVYLFPPDQASKNLYIGQFERETFSPVDLEKPDLERYPNYRHCTPYQAI
FT                   IEPGETLHIPRNWGHCVISMDISISISTFFITYPQLFRLVPEFFTQYVKRAFEGWRWKG
FT                   MENERAGLNPPPR"
FT   gene            239090..240787
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0226"
FT                   /note="putative non-ribosomal peptide synthase; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00550; match to protein family HMM PF00975"
FT   gene            complement(240745..241014)
FT                   /locus_tag="BMA10229_A0225"
FT   CDS_pept        complement(240745..241014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0225"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01562"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Q9"
FT                   /protein_id="ABN01562.1"
FT                   /translation="MSGREACAPDAQALAVARRDRSEAREVSPRRQLGRKRDAAGRATT
FT                   DRRRAGARPASSAGARGATNGHRSAAAAVLIQIMRHTAFIVSAT"
FT   gene            complement(241245..242468)
FT                   /locus_tag="BMA10229_A0227"
FT   CDS_pept        complement(241245..242468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0227"
FT                   /product="putative outer membrane porin"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02810"
FT                   /db_xref="GOA:A2S2R0"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2R0"
FT                   /protein_id="ABN02810.1"
FT                   /translation="MSARAARQLPGNRRLARLAGAAAAACAAGFGASTAHAQSSVVLYG
FT                   LIDTSITYANNQRTHGAGSPGSPGWAVTSGALNASRWGLRGREDLGDGVSAIFALENGF
FT                   SGASGALSQKGVDMFGRQAWIGLKSKEGGALTLGRQYDLILDFVTPLGASGPGWGGNLA
FT                   VHPYDNDDSNRNIRINNAVKYTSPTYRGWTLGAMYGFSNTAGPFGNNAAWSAGLSYANG
FT                   PLKLGAGYLRINRNPNAANANGALSTTDGSATITGGSQQIWAVAGRYAFGPHSIGAAWS
FT                   HSATDRVSGVLQGGSIAKLDGKSLVFDNFTLDGRYVVTPRLSLAAAYTYTMGRFDARSG
FT                   ETRPKWNHMVAQADYAFSIRTDAYLEAVYQRVSGGNGIPAFNATIWTLTPSANGNQVVV
FT                   ALGLRHRF"
FT   gene            242816..243616
FT                   /locus_tag="BMA10229_A0228"
FT   CDS_pept        242816..243616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0228"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03517"
FT                   /db_xref="GOA:A2S2R1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2R1"
FT                   /protein_id="ABN03517.1"
FT                   /translation="MHRVTHYRRADDGIEAISLDTDRAFPRHAHDEFGVGVIVSGAHRS
FT                   WSGCGTVDARAGDTIMVNPGEVHDGLPLGARAARSWRMLYLIPALVAGFAAEEGCGGVE
FT                   LAHPAVRDARLAAAVERLFARVVAGAQTPAASIACDEALALLVAALLARHASGRAPRAG
FT                   SAPAIRIARERLDASPADAVSLAELASLAGVSRFQLLRGFARELGITPHAYLIQSRARL
FT                   ARALLARGLSIAQAAAEAGFADQSHLTRAFVRQFGITPGRFASR"
FT   gene            243781..244587
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0230"
FT                   /note="putative membrane protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF00892"
FT   gene            complement(244584..244745)
FT                   /locus_tag="BMA10229_A0229"
FT   CDS_pept        complement(244584..244745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0229"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01367"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2R3"
FT                   /protein_id="ABN01367.1"
FT                   /translation="MIAPGGDAHQAASREFAAAASRGRCAPQRGRIAPTSTPATTIAMP
FT                   ASRVRSSG"
FT   gene            complement(244910..245422)
FT                   /gene="cheW-1"
FT                   /locus_tag="BMA10229_A0231"
FT   CDS_pept        complement(244910..245422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW-1"
FT                   /locus_tag="BMA10229_A0231"
FT                   /product="chemotaxis protein CheW"
FT                   /note="identified by match to protein family HMM PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02388"
FT                   /db_xref="GOA:A2S2R4"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2R4"
FT                   /protein_id="ABN02388.1"
FT                   /translation="MNAILEAPHAARMSGQDAARDAQEFVTFRLGTEEYGIDILRVQEI
FT                   RSYEEPTRIANAPAFIKGVINLRGVIVPIIDLRLKFALDSAEYNTSTVVIVLNVAARTV
FT                   GVVVDAVSDVLELAAADRRPAPEFGAAIDTGFITDLGSIAGENGNRMLILLDIERLIAA
FT                   ADVGLVG"
FT   gene            complement(245460..247202)
FT                   /locus_tag="BMA10229_A0232"
FT   CDS_pept        complement(245460..247202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0232"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01167"
FT                   /db_xref="GOA:A2S2R5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2R5"
FT                   /protein_id="ABN01167.1"
FT                   /translation="MNFQNMTVSTKLTLAFGALVGLVLLVSVLALHALGDANDRFASYV
FT                   SGISARAEAAEQVRTAVDRRAIAARNLVLVTKPADVELEKAAVTQAEDDVQAHLRRLKE
FT                   LLSSASDGNDKARGLVADIDRVEAQYGPVALAIVNAALNNRHDEAITMMNDQCRPLLAQ
FT                   LVKATNAYSEYTRGRAQEMVRESADHYASQRLLLVGLCAAAIGAAVIAAILIARGLMRA
FT                   LGAEPATLGDVTRRVANGDLSPVAGAQTAPSGSVLASMGEMQASLVRLIGQVSTAADSI
FT                   ATGSSQIASGNQDLSSRTEHQASSLQETASSMEELTSTVRQNAENAQQASSLAANASEV
FT                   AQKGSTVVGQVVDTMTDISQSSEKVAEITGIIESIAFQTNILALNAAVEAARAGEQGRG
FT                   FAVVASEVRSLAQRSSSAAKEIKDLINASVQKIHDGSALAGEAGKTMTEVTQAVARVTD
FT                   IMGEIAAASGEQSRGIEQVNQAIAQMDEVTQQNAALVEEAAAASKSLEEQGRHLTQAVS
FT                   FFRASAASAAPQARHAAPAKPKAKRGVAAPASAPRAAHAAPTFNKPAPALAAAATASDD
FT                   WQTF"
FT   gene            complement(247915..248103)
FT                   /locus_tag="BMA10229_A0233"
FT   CDS_pept        complement(247915..248103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0233"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02451"
FT                   /db_xref="InterPro:IPR021945"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2R6"
FT                   /protein_id="ABN02451.1"
FT                   /translation="MVQNRVDEIVQAIASETHTPAEAVSRLYEEALAEYSEGARVRDYL
FT                   TVLVAKRVRETLRNRTH"
FT   gene            248500..250476
FT                   /locus_tag="BMA10229_A0234"
FT   CDS_pept        248500..250476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0234"
FT                   /product="putative long-chain-fatty-acid--CoA ligase"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03172"
FT                   /db_xref="GOA:A2S2R7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2R7"
FT                   /protein_id="ABN03172.1"
FT                   /translation="MAVRDIHDIEQIERVPLHARALPANTLQVFDERAAKTPDAPALTF
FT                   FLDAGRLDRSHTWTFAELRADIVRTANVLASVGIGAGDVAAFVLPNLPDTHFAIWGGEA
FT                   AGIAMAINPLLDGAQIAELVDAARAKVLICVAPTPGVDIWPKLAPHLDAMPTVETVIWV
FT                   DLRPYVSLPKRAALAWIERREKARLRGARVRIVNLHAEMRRQPGDRLIRPRAIGPDEPS
FT                   SYFCTGGTTGRPKIAVRTHGSEVFDVWAASETQARDDEGARTVFCGLPLFHVNGQLVTG
FT                   LMAWLRGHHVVLGTPQGYRGKNVIARFWAIVEAYRINAFSGVPTLFAALLQQPVGRHDI
FT                   GSLEYAACGAAPMPVELARSFERTTGVKIVEGYGLTESACIASLNPLDGERRIGSIGLR
FT                   LPYQRMRAVIVDDTGRYVRDALVDEVGLIALAGPNVFRGYLDPAHERGLWIDIAGERWL
FT                   NTGDLGRRDAHGYFWLVGRKKELIIRGGHNIDPRIIEDALAAHPAVALAAAIGRPDAHA
FT                   GELPVAYVQLKAGASADEAALLAFAADAIAERAAVPKHVRILEAVPTTAVGKIFKPQLQ
FT                   RLEIADVVAACARDAQVALERVDVVQDARRGLVAQVAVRGAREALAERLARYAFPVDWS
FT                   GDGAHARASEAQRDAAAARERAS"
FT   gene            250547..251950
FT                   /locus_tag="BMA10229_A0235"
FT   CDS_pept        250547..251950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0235"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01126"
FT                   /db_xref="GOA:A2S2R8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2R8"
FT                   /protein_id="ABN01126.1"
FT                   /translation="MRAGDFRVTAAVVASALFMQNLDSTVVATALPSMARELGVNVVFL
FT                   SSAITSYLVALTVFIPVSGWIAERFGAKRVFIAAIAIFTAASVMCAAANGLATLVAARI
FT                   LQGAGGALMVPVGRLILYRGVSRHEMLAATTWLTMPALVGPLLGPPLGGFLTDALSWRA
FT                   VFWINVPVGVAGAALAARLVPASAGERRAPADARGMLLVGAALAALMLGVETAGRGVLP
FT                   AGAPALCLGAGVALGGLAIRHCRRVAHPAVDLSLLGIPTFHAATIAGSLFRAGAGALPF
FT                   LVPLTLQVGFGASASRSGAITLASALGSLVMRPMTHAALHRAPMRTVLIAGSVSFAAVL
FT                   AACATLSPAWPDAAVFALLLVGGLSRSLSFASLGALVFSDVPSERLSAATSFQGTAQQL
FT                   MRAVGVAVAAGALHLAMLIGGRGQASRTDFACAFAAIALVVLASVPMFAALPADAGEGL
FT                   AGPARRPRP"
FT   gene            complement(252347..253117)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0236"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF08241; match to
FT                   protein family HMM PF08242"
FT   gene            253490..254428
FT                   /locus_tag="BMA10229_A0237"
FT   CDS_pept        253490..254428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0237"
FT                   /product="amine ABC transporter, periplasmic amine-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02691"
FT                   /db_xref="GOA:A2S2S0"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2S0"
FT                   /protein_id="ABN02691.1"
FT                   /translation="MKVPRFSRTLRAAAAALAVSLCAAAPGARAAGAVTVASKIDTEGN
FT                   LLGNVISQVLKAHGIAVVDKIGLGATPIVRRALTTGEIDIYPEYTGNAAFFFNKADDPA
FT                   WKNAAQGYALARQLDYAANRIVWLAPAPANNTWGVAVLNSIAQARHLKTFSDFGKWVAA
FT                   GGKVKLAASAEFVNSASALPSFEKAYGFKLKPEQMLVLSGGDTAATIKAAAQQTDGVNA
FT                   AMVYGTDGGIAATGLAVLDDDKHVQPVYAPTPIIREAVLNAHPQIADYLKPVFASLDLK
FT                   TLQALNARIQINGEPAAGVAASYLKAKGFVK"
FT   gene            254425..255645
FT                   /locus_tag="BMA10229_A0238"
FT   CDS_pept        254425..255645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0238"
FT                   /product="amine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03588"
FT                   /db_xref="GOA:A2S2S1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2S1"
FT                   /protein_id="ABN03588.1"
FT                   /translation="MTPRTAGGAAAPAPAPRPRAMPAWAARVDKVGVLIAALVAYAAFV
FT                   LPFVTLRANRIAAGAELAPAAVFPALHAYALDALWAAGALFALVRSRAAWRAAVGVGLV
FT                   FALGVAIGAAPAHLVTPDTPLARVSPAAGAWLLLFAFAVLIADALARIALAPAMRLVAL
FT                   AAASAALAAFIHGGFWDGLSVMQEYAVCADTFRNEAIRHLALVAGSVAAAVALGVPLGI
FT                   GCTRSAALRGALLPLLNVVQTIPSIALYGLLMAPLAILAARVPLAARLGVSGIGVAPAL
FT                   IALFLYALLPIVSSVVVGFAQVPAAVVEAALAMGMTGRERLVAIELPLALPVVLSGVRI
FT                   VLVQNIGLTAVAALIGGGGFGTFIFQGIGQSATDLVLLGALPTIALALVTAVLFEAATD
FT                   LAKGARR"
FT   gene            255642..256580
FT                   /locus_tag="BMA10229_A0239"
FT   CDS_pept        255642..256580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0239"
FT                   /product="amine ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00872"
FT                   /db_xref="GOA:A2S2S2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2S2"
FT                   /protein_id="ABN00872.1"
FT                   /translation="MIEIERVSRLFGDLAAVDDVSLAVARGTVTALVGASGSGKSTLLR
FT                   MINRLIAPTSGTIRVDGVDTASVPAETLRRGIGYVIQGHGLFPHWTVARNVATVPRLLG
FT                   WRAARVDARVRELLELFELDYDTYARKLPHQLSGGQQQRVGVARALAAEPAILLMDEPF
FT                   GALDPIIRGKAQDDLVALQRRLGITVVIVTHDIDEALRLGDQIAVMDAGRILQAGSPAE
FT                   ILGRPQPGVVERLVAGLDRPLRLLALTRVDALAEPGAAPGEPISGALTLRDAISELLWR
FT                   GARALPVSSADGAAARRITLDAIVAQAKRPA"
FT   gene            256577..257395
FT                   /locus_tag="BMA10229_A0240"
FT   CDS_pept        256577..257395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0240"
FT                   /product="amine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01801"
FT                   /db_xref="GOA:A2S2S3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2S3"
FT                   /protein_id="ABN01801.1"
FT                   /translation="MTRAIKAASAATEAGALGAAGRRAPVMLARVAALAALAVMLARPG
FT                   WLEPLFAPFADNGAPAIYRRASLLDLTLSHLAIVGAASAAGAVVALAAGIFVTRRAGAE
FT                   FLPVARSVVHIGQTFPPVAVLALAVPAVGFGVKPVLIALILYGLLPIFESTIAGLQDVP
FT                   AGAVDAARAMGMSALQRLAWIELPLAFPVVLNGIRLAVVINLGTATIGSTVAAKGLGDV
FT                   IIAGLQTSNTAFVLQGGLVVALLAVLIYDALGVIGRWLAPASAAREEGGA"
FT   gene            257431..258348
FT                   /locus_tag="BMA10229_A0241"
FT   CDS_pept        257431..258348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0241"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02290"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2S4"
FT                   /protein_id="ABN02290.1"
FT                   /translation="MAAECAGARARAAARRRRAPGTRISPRRAPGESIRAPSAAPPPAA
FT                   PVPPGSAHATRARGTCPSPKNMPRDPRSRAARRAFATVGRSSGSNARVTVESAAPRGAM
FT                   PIGIRHSTPFDAHRPGRHVETALRARTSPALDADGLAARRRDASMNGRRTRPRPSPLLR
FT                   FGVDDVWLRPLRSGCPTGSIAKAKRMKVRARRAPARQVSPGRRPRQSGRRCTRRSPHAL
FT                   SARPIPLPCAARHGTPATLAAFGRMGSRPLVHSRRHAATTIFQSGGIAPHRTSRFAERA
FT                   RSASRAPAHPTRRMRVRQRHAHRS"
FT   gene            258618..258950
FT                   /locus_tag="BMA10229_A0242"
FT   CDS_pept        258618..258950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0242"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02374"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2S5"
FT                   /protein_id="ABN02374.1"
FT                   /translation="MRICIENIQPGVTREELQAFLFKYTGKTFTDIQFIGQSGPRPGAL
FT                   IDIDGANWSALAEIRRRLHGMYWKRRRIGVWLFSFWDRSDAAEARRQREARTRQTRSTP
FT                   MTTLRR"
FT   gene            259111..260571
FT                   /gene="arcD"
FT                   /locus_tag="BMA10229_A0243"
FT   CDS_pept        259111..260571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcD"
FT                   /locus_tag="BMA10229_A0243"
FT                   /product="arginine/ornithine antiporter"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM TIGR00905; match to protein
FT                   family HMM TIGR03810"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02762"
FT                   /db_xref="GOA:A2S2S6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR022461"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2S6"
FT                   /protein_id="ABN02762.1"
FT                   /translation="MAEVTQEQGVAAKSAANKLRLGALTALVVGSMIGGGIFSLPQNMA
FT                   ATAEAGAILIGWAITAIGMLTLAFVFQTLANRKPQLDGGVYAYAQAGFGDYMGFSSAWG
FT                   YWISAWLGNVGYFVLLFSTLGYFFPVFGEGNTPAAIAGASVLLWAVHFLVLRGIREAAF
FT                   VNLVTTVAKIVPLVVFILIGFFAFKLDVFRTDIWGRANPSLGSVMNQVRNMMLVTVWVF
FT                   IGIEGASIFSARAEKRSDVGRATVIGFVGVLLALVLVNVLSLGIMTQPQLAKLQNPSMA
FT                   AVLEHVVGHWGAVLISVGLVVSLAGALLSWVLLCAEIMFSAAKDRTMPAFLRKENANHV
FT                   PANALWLTNAMVQVFLLITLFSQSTYLSLIYLATSMILIPYFWSAAYALLIAVRGETYE
FT                   GDARARRKDLFVAALAVLYAVWLLYAGGLKYLLLSALLYAPGALFFAKAKRELGKPVFT
FT                   AAEKLIFAAAAAAALAAAYALHSGLITL"
FT   gene            260589..261845
FT                   /gene="arcA"
FT                   /locus_tag="BMA10229_A0244"
FT   CDS_pept        260589..261845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="BMA10229_A0244"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="identified by match to protein family HMM PF02274;
FT                   match to protein family HMM TIGR01078"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03884"
FT                   /db_xref="GOA:A2S2S7"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2S7"
FT                   /protein_id="ABN03884.1"
FT                   /translation="MSQAIPQVGVHSEVGKLRKVLVCSPGLAHQRLTPSNCDELLFDDV
FT                   MWVNQAKRDHFDFVSKMRERGVEVLEMHNLLTETVQNPAALKWILDRKITPDNVGIGLV
FT                   DEVRAWLEGLEPRALAEFLIGGVAASDIAGAERSKVLTLFRDYLGKSSFVLPPLPNMMF
FT                   TRDTSCWIYGGVTLNPMHWPARRQETLLVAAVYKFHPAFTDAKFDVWYGDPDRDHGMAT
FT                   LEGGDVMPIGRGVVLVGMGERTSRQAVGQLAQALFAKGAAERVIVAGLPNSRASMHLDT
FT                   VFSFCDRDLVTVFPEVVNRIVPFTLRPGGDARYGIDIEREDKPFVDVVAQALGLKSLRV
FT                   VETGGNDFAAEREQWDDGNNMVCIEPGVVVGYDRNTYTNTLLRKAGVEVITIGSSELGR
FT                   GRGGGHCMTCPVLRDPVDY"
FT   gene            261910..262920
FT                   /gene="arcB"
FT                   /locus_tag="BMA10229_A0245"
FT   CDS_pept        261910..262920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="BMA10229_A0245"
FT                   /product="ornithine carbamoyltransferase, catabolic"
FT                   /EC_number="2.1.3.3"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00658"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01073"
FT                   /db_xref="GOA:A2S2S8"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2S8"
FT                   /protein_id="ABN01073.1"
FT                   /translation="MSFNLHNRNLLSLIHHNARELRYLLDLARDLKRAKYSGTEQPRLL
FT                   RKNIALIFEKTSTRTRCAFEVAAYDQGANVTYIDPASSQIGHKESMRDTARVLGRMYDA
FT                   IEYRGFSQEIVEELAHHAGVPVFNGLTDEYHPTQMLADVMTMREHSDKPLHDIRYAYLG
FT                   DARNNMGNSLLLIGAKLGMDVRIGAPKSLWPAADFIAQCEAFAAESGARLTLTEDPYEA
FT                   VKGVDFIHTDVWVSMGEPVEAWDERINALLPYQVNRKLIESTGNPRTRFMHCLPSFHNC
FT                   ETKVGKQIAERYPHLQDGIEVTDEVFESPRCIAFEQAENRMHTIKAVLVSTLGGI"
FT   gene            263006..263947
FT                   /gene="arcC"
FT                   /locus_tag="BMA10229_A0246"
FT   CDS_pept        263006..263947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="BMA10229_A0246"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00746"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02021"
FT                   /db_xref="GOA:A2S2S9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2S9"
FT                   /protein_id="ABN02021.1"
FT                   /translation="MMRIVIALGGNALLQRNQPMTEVQQRENVKIAVAQIAQIAPGNEL
FT                   VIAHGNGPQVGLLALQGAAYPAVAPYPLDVLGAQTEGMIGYLIEQEMGNLLPPDAPFAT
FT                   LLTQVEVDPADPAFEHPTKPIGPVYSRDEAERLALEKGWHIAPDGDKFRRVVPSPRPRR
FT                   IFEIRPVKWLLEKGTIVICAGGGGIPTRYDANGKLSGVEAVIDKDLCASLLARELSADL
FT                   LVIATDVDGAYLDWGKPTQALIEAAHPDELERLGFAAGSMGPKVQAAIEFARQTGHDAV
FT                   IGSLADIVAIAEGRAGTRVSVKVDGIRYRRPR"
FT   gene            complement(264080..264193)
FT                   /locus_tag="BMA10229_A0247"
FT   CDS_pept        complement(264080..264193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0247"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01708"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2T0"
FT                   /protein_id="ABN01708.1"
FT                   /translation="MSSRRAAIATSRAARAEAGCAAPLVATDAEAAWPRRR"
FT   gene            complement(264190..264984)
FT                   /locus_tag="BMA10229_A0248"
FT   CDS_pept        complement(264190..264984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0248"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02260"
FT                   /db_xref="GOA:A2S2T1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2T1"
FT                   /protein_id="ABN02260.1"
FT                   /translation="MTGKRILVTGAGSGFGREVALRLAAKGHCVIAGVQIAPQITELSA
FT                   EAARRGLALDAVKLDVTCARERAQAARWDVDVLLNNAGAGEAGALVDLPVDIVRELFET
FT                   NVFGPLELTQQVARGMIARGRGRIVFVSSIAGLITGAYTGAYCASKHALEAIAEAMHLE
FT                   LAAHGVQIAVVNPGPYRTGFNDRMMETPRRWLDPARDAVTPETLTFPLEQFDPQEMIEK
FT                   MVDVTEADGGLFRNLLPAAAEQIVRDEQAHAWTRRQNERRGA"
FT   gene            complement(264981..265430)
FT                   /locus_tag="BMA10229_A0249"
FT   CDS_pept        complement(264981..265430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03928"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03214"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2T2"
FT                   /protein_id="ABN03214.1"
FT                   /translation="MSPELTLERALRIVEAGVAHAARLSAAGAAVAIAVVDAGAHLAAF
FT                   ARMDDAFIGAIDLATRKAGTAARFRMPSASLGALSGAGGPVRSIEHSNGGLVTFGGGLP
FT                   LVDAHGRCVGAVGVSGGTVDDDAAIAQVCVDAFITLLNAVQGART"
FT   gene            265528..266448
FT                   /locus_tag="BMA10229_A0250"
FT   CDS_pept        265528..266448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0250"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02268"
FT                   /db_xref="GOA:A2S2T3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2T3"
FT                   /protein_id="ABN02268.1"
FT                   /translation="MTMKRDPLGGLHVFMSVVTHGNFTRAAAALGLTPAAVSLAIGQLE
FT                   SELKVKLFSRSTRGVSLTEAGQRYYDATAQPYRQVVDARDALNDARDEPEGLLRISALH
FT                   LAKSVVTADVLAEFFRRYPKVSVEIRYEDHLVDIVKERLDAGIRLADRLQPGMVGVKIA
FT                   PALTCALVATPGYLAQHGVPAKLADLARHMCIRFRFPKSGRLHKWPLRDGRRDVELDVA
FT                   GRFVSTDTGAVIDAARAGAGIAFVFMRERIEDDLRRGTLREVLPGACRTLPPMWLYYAN
FT                   RKHVPPKLRAFIAVLREHAAADARR"
FT   gene            266733..267437
FT                   /locus_tag="BMA10229_A0251"
FT   CDS_pept        266733..267437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0251"
FT                   /product="putative glutathione S-transferase"
FT                   /note="identified by match to protein family HMM PF00043;
FT                   match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02060"
FT                   /db_xref="GOA:A2S2T4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2T4"
FT                   /protein_id="ABN02060.1"
FT                   /translation="MSDLSEFPITKKWPAQHPEHIQLYSLPTPNGVKVSILLEETELPY
FT                   EAHVVRFDTNDQMSPEFLSLNPNNKIPAIIDPHGPGGKPLALFESGAILLYLAEKTGRF
FT                   IPADPARRYETIQWLMFQMGGIGPMFGQLGFFHKFAGREYEDKRPRERYVGEAKRLLGV
FT                   LDGRLAHRRWIMDDAYTIADIATFPWVRNLIGFYEARELVEFDRYPNVARALDAFVARP
FT                   AVARGLNIPARP"
FT   gene            267990..268529
FT                   /locus_tag="BMA10229_A0252"
FT   CDS_pept        267990..268529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0252"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01077"
FT                   /db_xref="GOA:A2S2T5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2T5"
FT                   /protein_id="ABN01077.1"
FT                   /translation="MKLIGKQSGAALPLDETLPAPDAAPLRLDEWLPYQLFLPAQHVAR
FT                   VLAEFYGPRYGIGQPAWRILATIVDRPGTNARQIGAALGMDAVSVSRGIAQLVGAGFAR
FT                   RDAARNDRRYACVMATPAGRAAFDDIAAVCIAVERRLLDVLTPEERATLAAALPKIGRE
FT                   SERIAIVGWQRLLDGV"
FT   gene            268749..269864
FT                   /locus_tag="BMA10229_A0253"
FT   CDS_pept        268749..269864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0253"
FT                   /product="putative amino acid ABC transporter, periplasmic
FT                   amino acid-binding protein"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03790"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2T6"
FT                   /protein_id="ABN03790.1"
FT                   /translation="MNVRMGCLSLLAAVAFDAHAQSSVVRIGVAMPLTGPVAHLGKDVQ
FT                   NGAQLAVDELNRAPPTIEGKSVKFVLVVEDDQGDPRQAVQVAQRLVDARVAGVVGDLNS
FT                   GPTIVAAKVYAAAGIAQIAPAATHPAYTQLGYKTAFRLMATDNQQGASLAGLAAKLAKG
FT                   RPIALIDDRGAYGQGLIDQTEKTLRASGVTRIIRDYTTDTAVNFASILTRVKGAHAAVI
FT                   VYGGADAQAGPMVRQMKALGIDAAFVGSDGVCTGQWTALSSGANEGQFCTQAGDPRARM
FT                   AGYAAFERRFEARYGKVIVFAPYGYDAVMLLADAMRRANSTEPAALLGALATTRYDGVI
FT                   GRIRFSPQGDNLNGAVTVYRVQRGALVPVSD"
FT   gene            269871..270017
FT                   /locus_tag="BMA10229_A0254"
FT   CDS_pept        269871..270017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0254"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03230"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2T7"
FT                   /protein_id="ABN03230.1"
FT                   /translation="MRRPRKARAPLCRGRRSRLGKTGLPDARPFAAACAAALRRSRPAG
FT                   VRI"
FT   gene            complement(270159..270653)
FT                   /locus_tag="BMA10229_A0255"
FT   CDS_pept        complement(270159..270653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0255"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02327"
FT                   /db_xref="GOA:A2S2T8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2T8"
FT                   /protein_id="ABN02327.1"
FT                   /translation="MDRAAHAVEQWRRERPDLDPSPMIVLGRLQEAALVIARDRLNPLF
FT                   ARYGLQPGEFDVLATLRRSGAPYALTPTALYDAAMISSGSMTNRIDRLEKAGWVERRPN
FT                   PADGRGTLVALTPAGLALIDDAVVAHVGNQQRALSALSDAEQRQLAKLLGKLLQGQADE
FT                   R"
FT   gene            270777..271775
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0256"
FT                   /note="MFS transporter; this gene contains a premature stop
FT                   which may be the result of a sequencing error; identified
FT                   by match to protein family HMM PF07690"
FT   gene            271821..271961
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0257"
FT                   /note="MFS transporter; this gene contains a premature stop
FT                   which may be the result of a sequencing error"
FT   gene            272081..273646
FT                   /locus_tag="BMA10229_A0258"
FT   CDS_pept        272081..273646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0258"
FT                   /product="fenI protein"
FT                   /note="identified by match to protein family HMM PF02638"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01724"
FT                   /db_xref="GOA:A2S2U1"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2U1"
FT                   /protein_id="ABN01724.1"
FT                   /translation="MLSTRLRHLAAAALVLSASACASSPQAVPEVACRPDETMPKRQFR
FT                   GTWIASVINLDWPSRPGLPAAAQQAELSAWLDDAVRMNRNAVILQVRPTADAFWPSPFE
FT                   PWSKYLTGAQGGDPGYDPLAFAVAEAHRRNLELHAWFNPYRVAMDDRLDALVATHPARA
FT                   HPDWVVRYGGKLYYNPGVPAARAFVVDAIMDAVARYDIDAVHLDDYFYPYPVAGATFDD
FT                   ASAYAQYGAGFATLADWRRDNVDRLVESLARRIKAAKPWVKFGISPFAVWRNAATDPQG
FT                   SRTSASVQTYDDLYADTRRWVRERWIDYVVPQAYWARGFAPADYDEVVAWWANEVRGRD
FT                   AHLYIGQAAYKVGTSNQSPGWSDPDELSRHLAFNLTAPEVKGDVYFSAKDVRADRLGAT
FT                   TRLNRTWYSRPALVPTMPALGGNAPPSAKALRAQRTPDGVRLQWQAGSAAAASYAVYRH
FT                   ALGRQDMCADSDARHLLAMVRGTQYVDVTARADRDYRYVVTALDRLWHESEPAYVAMPA
FT                   AKPR"
FT   gene            complement(273725..274450)
FT                   /gene="cobM"
FT                   /locus_tag="BMA10229_A0259"
FT   CDS_pept        complement(273725..274450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /locus_tag="BMA10229_A0259"
FT                   /product="precorrin-4 C(11)-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR01465"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00817"
FT                   /db_xref="GOA:A2S2U2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2U2"
FT                   /protein_id="ABN00817.1"
FT                   /translation="MTVYFIGAGPGDPELITVKGQRLVRRCPVILYAGSLVPAAVLDGH
FT                   RAELVVNTAELDLDEIVALLARAHGKGQDVARVHSGDPPLYGAIGEQIRRLAALGIPYE
FT                   IVPGVTATAACAAALGVELTLPGVAQTVILTHYAGKTTMPAGESLASLAAHRATLAIHL
FT                   GVRHLARIVADVLPHYGADCPIAVIYRASWPDEARVTGTLADIVDKVSGRSIERTALIL
FT                   IGRVLSAEGFDESTLYAKA"
FT   gene            complement(274789..275523)
FT                   /gene="cobK"
FT                   /locus_tag="BMA10229_A0260"
FT   CDS_pept        complement(274789..275523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobK"
FT                   /locus_tag="BMA10229_A0260"
FT                   /product="precorrin-6x reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="identified by match to protein family HMM PF02571;
FT                   match to protein family HMM TIGR00715"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03647"
FT                   /db_xref="GOA:A2S2U3"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2U3"
FT                   /protein_id="ABN03647.1"
FT                   /translation="MSVRRVLLLGGTGDALRTARALAPHDVYSLAGLGRVPDDLACVVR
FT                   VGGFGGADGLARYLREHAVALVVDATHPFAARISANAAAACRAAGVPYWALRRAPWRPR
FT                   PGDDWRGVADWAGVLAAIAPFARPLFTLGREPLAHLDEIAPHQHWLVRCLDAHAGNARA
FT                   HVLAARGPFSLEGERALFAAAAIDVVVSKNSGGAATEAKLDVARERRVPVVMVERPALP
FT                   DADREFGATAALVDALRAWRAP"
FT   gene            complement(275520..276479)
FT                   /pseudo
FT                   /gene="cbiD"
FT                   /locus_tag="BMA10229_A0261"
FT                   /note="cobalamin biosynthesis protein CbiD; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF01888"
FT   gene            complement(276609..277835)
FT                   /gene="cobL"
FT                   /locus_tag="BMA10229_A0262"
FT   CDS_pept        complement(276609..277835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobL"
FT                   /locus_tag="BMA10229_A0262"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating)"
FT                   /EC_number="2.1.1.132"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR02467; match to protein
FT                   family HMM TIGR02469"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03228"
FT                   /db_xref="GOA:A2S2U5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2U5"
FT                   /protein_id="ABN03228.1"
FT                   /translation="MTAWLTVVGIGDDGYAGLGKPARRALADAAVVMGGERHLAMLPAR
FT                   HRAQRAPWPKPFDLAPLFARRPARVCVLASGDPMLFGVGALLARALAPNEWRVLPAPSS
FT                   LSLAAARTGWPLQDVDAVSLVGRPLASLHRHLYPGRRLFVLSADGATPAAIAGALVARG
FT                   FGPSAMSVFEHLGGPLERRLDARADAWRDARAAALNVVAIECRACADAPRLALTPGLPD
FT                   DAYRHDGQITKRDLRALALARLAPAPGELLWDVGAGCGSIGIEWMRAHPSCRTIAIEAH
FT                   PDRQRFIEHNRDALGVPALELVAGRAPDALAGLRAPDAVFVGGGVSREGVLDACWAGLK
FT                   PGGRFVAHAVTLQGEAALVAWRERHGGTLTRVSVAHAQPLGGFDAWRQALPVTLYDARK
FT                   PRGVQPEHA"
FT   gene            277851..278009
FT                   /locus_tag="BMA10229_A0263"
FT   CDS_pept        277851..278009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0263"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03048"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2U6"
FT                   /protein_id="ABN03048.1"
FT                   /translation="MFPSILKATPALRIPRSGVAKKGIIQRPSTGAPRGPRGNAGRAAP
FT                   LRPPPQL"
FT   gene            278233..279681
FT                   /gene="cobG"
FT                   /locus_tag="BMA10229_A0264"
FT   CDS_pept        278233..279681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobG"
FT                   /locus_tag="BMA10229_A0264"
FT                   /product="precorrin-3B synthase"
FT                   /EC_number="1.14.13.83"
FT                   /note="identified by match to protein family HMM PF01077;
FT                   match to protein family HMM PF03460; match to protein
FT                   family HMM TIGR02435"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01738"
FT                   /db_xref="GOA:A2S2U7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2U7"
FT                   /protein_id="ABN01738.1"
FT                   /translation="MNPSAAVFSSAAARAASACPGLVRIVAARDGGLCRIKLPGGALTA
FT                   AQARAVAAVARAFGSGVIEATNRANLQVRGVKAGREASASRALIDAGLGPLMDGASAAS
FT                   LEACAAARDDVRNVMLSPTAGRDPDALVDSAALAARLLAMLQTEPRCAALSPKFSVLLD
FT                   GGERLAALDHPHDIWLSALRDAHGAPADTQFAIGLAGCPPVDGGQAAPGAPCAGALAAV
FT                   APEHAVECVRALVTSFVELAPAGATRMRELLATCPPDAFLSHVESKLSESKQPFALRRD
FT                   AHLAGWRRARVDAALRLGILPERDPARCAVGAQPPLGRLDAAALAALAALADTHGDGTL
FT                   RITPWQGVMLPAVARAAAPEALARLAALGFVCDAAAPLAHIVACAGSRGCARSPADTKA
FT                   HALALAARLAASVDVHVTGCARSCALPHAAAHTLVASAASRYDLYRRDGATGFGRAVAR
FT                   QLTIDQAADALARGARPSQDDLDA"
FT   gene            279674..280300
FT                   /gene="cobH"
FT                   /locus_tag="BMA10229_A0265"
FT   CDS_pept        279674..280300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /locus_tag="BMA10229_A0265"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="identified by match to protein family HMM PF02570"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00658"
FT                   /db_xref="GOA:A2S2U8"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2U8"
FT                   /protein_id="ABN00658.1"
FT                   /translation="MLDYLRDGRAIYRESFATIRAQADLTGVPPDLEKLAVRVIHACGM
FT                   VDIVRDLRFSAGAGEAGRAALAAGAPILCDARMVAEGITRARLPASNPVICTLGAPEVP
FT                   HLARELGNTRSAAALELWRAHLAGSVVAIGNAPTALFHLLDMIDAGAPRPALILGFPVG
FT                   FVGAAESKALLAADSRGVPFVAIAGRRGGSAMAAAAVNALASEAE"
FT   gene            280297..281031
FT                   /gene="cobI"
FT                   /locus_tag="BMA10229_A0266"
FT   CDS_pept        280297..281031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobI"
FT                   /locus_tag="BMA10229_A0266"
FT                   /product="precorrin-2 C(20)-methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR01467"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00826"
FT                   /db_xref="GOA:A2S2U9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2U9"
FT                   /protein_id="ABN00826.1"
FT                   /translation="MTRKTGRLFGLGVGPGDPELLTLKALRMLQAAPVVAYFVAKGKKG
FT                   NAFGIVEAHLSDAQTHLPLVYPVTTETLPPPLCYETVIADFYDTAAALVAAHLDAGRDV
FT                   AVICEGDPFFYGSYMYLHDRLAPRYDAEVVPGVCSMLGGAAVLGVPLVYRNQSLAVLSG
FT                   VLPEDELRQRLASADAAVVMKLGRNFDKVRRVLDALGLARRALYVERATIAAQRIVPLA
FT                   DVDPMASPYFSLLVVPGEKWQG"
FT   gene            281028..282878
FT                   /gene="cbiG/cobJ"
FT                   /locus_tag="BMA10229_A0267"
FT   CDS_pept        281028..282878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiG/cobJ"
FT                   /locus_tag="BMA10229_A0267"
FT                   /product="cbiG protein/precorrin-3B C17-methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM PF01890; match to protein
FT                   family HMM TIGR01466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03439"
FT                   /db_xref="GOA:A2S2V0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2V0"
FT                   /protein_id="ABN03439.1"
FT                   /translation="MTAAPAIVILGPGALETARRIQARFDGARVHALAGRAEADLAFAE
FT                   LGPHLRELYARGAPIVALFAAGIAIRCVAPCLADKGAEPPVLAVAEDGSAVVPLLGGLA
FT                   GANALAREIADALGVAAAITTSGELRFGACMLNPPEGYALADLDAGKRFVSDLLAGEST
FT                   RVEGDARWLDDVALPRDAHAARVIRVTPHASRGDAHALLIHPRSVVVALGDGDGDIDGE
FT                   GLRDDARSVSAPDATGRARANAAAPARAASPDLPPLAARIAAALAAHDLAPLALAAVVA
FT                   PARRIAEHALTDAARALRAPLRFVETNARDAAGVLDAALPAALAPRVDASRAAAGSPRT
FT                   TPPEPRDVAIAVARAPVDADALGIARGRLTVLGLGPGRADLMTPAARAALADATDIVGY
FT                   ATYVNMAGPLRADQQLHVSDNREELQRARYAFELAARGRRVAVVSSGDPGVFAMAAAVL
FT                   EALDGADDARWAAVELDVVPGVSAALATAAEAGAPLGHDFCLISLSDNLKPWAIIEKRI
FT                   DHAAAADFALAFYNPVSRARPVQFDRALDIVRRHRAPETVVVLGRDIGRPGATLATTTL
FT                   AALSAQQVDMRTMVIVGSSTTRRVARDGARDWVYTPRWYR"
FT   gene            283222..284583
FT                   /locus_tag="BMA10229_A0268"
FT   CDS_pept        283222..284583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0268"
FT                   /product="glycosyl hydrolase, family 18"
FT                   /note="identified by match to protein family HMM PF02839"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01841"
FT                   /db_xref="GOA:A2S2V1"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2V1"
FT                   /protein_id="ABN01841.1"
FT                   /translation="MNFSMLSRIVPRALAAGCLFAAAGASQAAGVYAPYVDVTLYPTPL
FT                   VDQIGVQQGIQQFMLAFVVSGGNQCTPSWGGVQPIGNGATGDLLDKIATSVTAYRAKGG
FT                   DVAVSFGGAAGQPLMQACSSVAALKGAYQTVIDTYSLTHVDFDIEGASQQDSAAVARNF
FT                   QAVAQLQADYAAKGKPLHVTLTLPAMPTGLVQDGLNVLNAALANNVTLDAVNIMTMDYG
FT                   PSGIDMGAAAISAAQGLYSQLDTAYKSAGKPQTDAQLKQLVGVTPMIGVNDVAGEIFTL
FT                   ANAQSVQTTAANNNYGFVGIWSITRDKACDGSSQYASPICSGVAQQPYAFSSVFKQLGG
FT                   HWGAGVTQDPNYGGGSDGGGKPQPGAPWSATQVYTAGATVTYQGTTYQAQWWTQGDIPG
FT                   QASVWKPVGGNVPAWSSTTAYPGGACVTYQGAKYCAKWWTQGDVPSAGGPWTRA"
FT   gene            284764..284949
FT                   /locus_tag="BMA10229_A0269"
FT   CDS_pept        284764..284949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0269"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01199"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2V2"
FT                   /protein_id="ABN01199.1"
FT                   /translation="MGEPVADGRRRWSARAAPELSVDKITTVQARAKRRAARAARRNAD
FT                   ARRCGAVFIRRRTATL"
FT   gene            285018..285272
FT                   /locus_tag="BMA10229_A0270"
FT   CDS_pept        285018..285272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01233"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2V3"
FT                   /protein_id="ABN01233.1"
FT                   /translation="MKRFLSCVALVCFALPAAHAQTQTYHFEEGGTTPTGVTSQPASAA
FT                   AQARTQRAKPHRHPVRRNKHHRTHRRARSAQNDRFYSQP"
FT   gene            285269..285538
FT                   /locus_tag="BMA10229_A0271"
FT   CDS_pept        285269..285538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03700"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2V4"
FT                   /protein_id="ABN03700.1"
FT                   /translation="MTLAARSRAASGAIHRQPFGRRRQAAASDSRRMTRMTRETRRAAC
FT                   EPRFAALAIRGARRRASRPRVEQRASDARRYSTAHHFAKRKPLA"
FT   gene            complement(285616..286302)
FT                   /locus_tag="BMA10229_A0272"
FT   CDS_pept        complement(285616..286302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0272"
FT                   /product="putative carboxylesterase"
FT                   /note="identified by match to protein family HMM PF02230"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02299"
FT                   /db_xref="GOA:A2S2V5"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2V5"
FT                   /protein_id="ABN02299.1"
FT                   /translation="MLDETPTIEIETGPNPAFAVILMHGLGADANDFVPLVPELRIANG
FT                   PAVRFVFPNAPEIAVTANNGYVMRAWYDILSFEGVNRQVDEAGIDASCASVRGLIAEQN
FT                   RRGIPTSRIFVAGFSQGGAMAYSAGLTHPDALAGLIVLSGYVPSPGFIDARLADANRTT
FT                   PIFAAHGTDDDILPIRLGEAARDFARDKGASVDWHAYPMPHSVCIEEIDALRRWLHARI
FT                   AALQAA"
FT   gene            286431..286664
FT                   /locus_tag="BMA10229_A0274"
FT   CDS_pept        286431..286664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0274"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02061"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2V6"
FT                   /protein_id="ABN02061.1"
FT                   /translation="MGAFRYLGGLAARLAAPAAHDRASGPREQPAHGERAFAAVSRSMR
FT                   PARPARRIAAHAAAAHATVGAFTRPRARAPAA"
FT   gene            complement(286630..287253)
FT                   /locus_tag="BMA10229_A0273"
FT   CDS_pept        complement(286630..287253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0273"
FT                   /product="putative magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01755"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2V7"
FT                   /protein_id="ABN01755.2"
FT                   /translation="MRHMRHDDARGRPGTRIAWRATLAAKRGEAWRADHLRYRPQAGSP
FT                   GALHCFVLDCSASMLTAERLARAKGLVVALFDSLARERADAALVCFGGNAADVRFGPVV
FT                   PRWWNERWLAPVGAGGGTPLTRGIGAATRLLARAARRHPGQQRWLWLLSDGRTTESPAR
FT                   PALAERIVIVDFDDAPVRLGRCERLAHAWGAALVTPQALERGGG"
FT   gene            complement(287325..288608)
FT                   /locus_tag="BMA10229_A0275"
FT   CDS_pept        complement(287325..288608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0275"
FT                   /product="putative magnesium-chelatase subunit"
FT                   /note="identified by match to protein family HMM PF01078;
FT                   match to protein family HMM PF07726; match to protein
FT                   family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03204"
FT                   /db_xref="GOA:A2S2V8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2V8"
FT                   /protein_id="ABN03204.1"
FT                   /translation="MNPTNEAGAATAAASDDRALPAAYPFSALIGQAALQQALLLVAVD
FT                   PGLGGVLVSGPRGTAKSTAARALAELLPEGRFVTLPLSASDEQVTGSLDLASALADNTV
FT                   RFSPGLVARAHLGVLYVDEINLLPDALVDALLDAAASGVNTVERDGVSHSHAARFALVG
FT                   TMNPEEGELRPQLLDRFGLMVELANCYDAATRQRIVKARLAFDLDPHGFRAQYRDAQAA
FT                   LVAQIRAARAALPALAFDDAAHARVAELCIGAAVDGLRGDLVMLRAARALAALDGAARV
FT                   AAAHVERVAADVLRHRRTRFEPQPEFQPGFQPGSQAGPQPMGRREPPPASRSAGGDAPG
FT                   GRADPGEAEATRAPTPRDALPGGASGPAHPAARAPSDAQRRAADERAAARDGGRGPAAD
FT                   DSDWGYLPPEPAGIAPVKGVIPLPLKKR"
FT   gene            complement(288605..289216)
FT                   /locus_tag="BMA10229_A0276"
FT   CDS_pept        complement(288605..289216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0276"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03684"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2V9"
FT                   /protein_id="ABN03684.1"
FT                   /translation="MSGAAIEGARAACRASGMRGVASAARSMRDACDVCDGGDPGPAHD
FT                   ATTMSVVPARRRRGSRAAYAMMSETRTIGGGAKRAGDSPRARCARRTAVAPARCASHAR
FT                   RRSPGNRCHARRGSHSPDAGAASHRTGAAAAGERDAIDRGRAGGAAGPTHAGRAPPRLR
FT                   ARVARAVPASIMTRYARTPRALCRARQAHPMQPPSPRELN"
FT   gene            complement(289213..292875)
FT                   /locus_tag="BMA10229_A0277"
FT   CDS_pept        complement(289213..292875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0277"
FT                   /product="CobN/magnesium chelatase family protein"
FT                   /note="identified by match to protein family HMM PF02514;
FT                   match to protein family HMM TIGR02257"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02767"
FT                   /db_xref="GOA:A2S2W0"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2W0"
FT                   /protein_id="ABN02767.1"
FT                   /translation="MHLLRTTPGGFVDDTAGVVRIDQRPADIVILSSADTTLSLLASAV
FT                   PTLGEGFPSVRLANVTFLRQPASVDFYVDDVLRHARVVVIDHLGGEAYWPYGIEQAVAL
FT                   AARAGQKLAMFSGDLQEDPNLIAKSTVAPELCRQWWRYLREGGPANAQALLRSIAHHAL
FT                   AAALEREGLNPLPIAVTSLKDAMSRAVVDALCADANVSLVLNTTAFAAGALDAAEPEVL
FT                   AGDAPVLQVILSGGNRDAWLADPHGLNARDIAMHVALPEVDGRIVTRAVSFKGLAYRCP
FT                   HTEVDVVRYQPDDERIAFVAELSRRWCRLRTLENAHKRVALVLANYPASEGRIGNGVGL
FT                   DTPASALAVLAMLRDEGYRVGELPDDGDALLARITAGVTNDPATRALRPALQSYPLDDY
FT                   LRRFAQLPQAARDALNARWGPPEADPALRQRRFPIAGWRAGHVFVGVQPSRSRGDDDYA
FT                   NYHDADLVPPHAYLAFYFWLRDAFRIDALVHVGKHGNLEWLPGKSVALSDACWPDLILG
FT                   PMPHLYPFIVNDPGEGSQAKRRAQAVIVDHLMPPLTRAENYGPLQDLERQVDEYYDALM
FT                   VDARRAKVLRETILATIVEHKLHEELSIAPPAGRDAEDALLTRVDAWLCELKEAQIRDG
FT                   LHTFGSSPRGRQRRDTLAALARFPSGDGRGERAGLIGALARDLALGEAFDPLASDWAAP
FT                   WTGPRPAALGAMSDEPWRHAGDTRERLEALASRLIERRCGDGSHAGEGGGAPSGASRFA
FT                   APEYAAAHWPHAHAVLERIVRDVLPCLDACGDEELRQLRRGLEGRFVPPGPSGSPSRGR
FT                   PDVLPTGRNFYSVDTRAVPTQAAWTIGLKSAQQLVERHLQEHGDYPRAVGLSVWGTATM
FT                   RTGGDDVAQALALLGVRPKWAHGSHRVTDFEILPIEIFDRPRIDVTLRVSGFFRDAFAN
FT                   VMHLFDAAVQAVAELDEPEHLNPVRARVRREADALVARGMPADEARRRAGWRVFGARPG
FT                   GYGAGLQALIDGRRWQTDADLAHAYRNWGGYAYAQNSAGEAAHDAFGARLATIDAVVQN
FT                   QDNREHDLLDSNDYYQFQGGMAAAVRHASGRQPGLYHGDHSNPAAPRIGTLREEIARVI
FT                   RSRVVNPKWIDGVKRHGYKGAAEIAATVDYLYGYDATARVVSDHQYALVADAYLHDADT
FT                   RAFLERHNPHALHGICERLVEAMQRGLWQAPGAHRDAIEGYLLASEQRLEGGRR"
FT   gene            complement(292942..294015)
FT                   /gene="cobW"
FT                   /locus_tag="BMA10229_A0278"
FT   CDS_pept        complement(292942..294015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobW"
FT                   /locus_tag="BMA10229_A0278"
FT                   /product="cobalamin biosynthesis protein CobW"
FT                   /note="identified by match to protein family HMM PF02492;
FT                   match to protein family HMM PF07683; match to protein
FT                   family HMM TIGR02475"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01726"
FT                   /db_xref="GOA:A2S2W1"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR012824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2W1"
FT                   /protein_id="ABN01726.1"
FT                   /translation="MQMRKIPVTIVTGFLGSGKTTLLRHILQHAGGRRIVVIVNEFGEL
FT                   GIDGEILKGCGVGCDEAGREVDGRLYELANGCLCCTVQEEFYPVMEQLVERRAHIDHVL
FT                   IETSGLALPKPLVQAFNWPSIKNGFTVDAVLTVVDAPATARGQFAENPTAVDAQRRADP
FT                   NLDHESPLHELFADQLSSADLVIVNKTDLLDDAALAAVEATIRDEVPPQVKLVRARRGE
FT                   LDLATLLGLNAASEETIHLRHDHHGSADDADHHHDEFDSVVVEARVSSREAALGALGAL
FT                   VEAHAIYRVKGFAALPGVPMRLVVQGVGRRFDSYFDRRWRDGEAPASRFVLIGEDLDAA
FT                   ALQRAFDAALAAHGQAA"
FT   gene            complement(294111..295415)
FT                   /gene="hoxN"
FT                   /locus_tag="BMA10229_A0279"
FT   CDS_pept        complement(294111..295415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxN"
FT                   /locus_tag="BMA10229_A0279"
FT                   /product="high-affinity nickel transport protein"
FT                   /note="identified by similarity to SP:P23516; match to
FT                   protein family HMM PF03824; match to protein family HMM
FT                   TIGR00802"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01149"
FT                   /db_xref="GOA:A2S2W2"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2W2"
FT                   /protein_id="ABN01149.1"
FT                   /translation="MPASPPSDAARFGARRERACRIHRERARRERRAAADACRRERSTG
FT                   AAGEHVHCTRCRACWHSSRLSTVRKGSAMLESFLRLFNDSPAELRSKIVGIYAMLIAFN
FT                   VGAWAWAFAAFHGQPVLLGTALLAYTFGLRHAVDADHIAAIDNVTRKLMHEKKNPLGAG
FT                   LFFSLGHSSVVILMTVAVALTAATLAERFEGMKAWGGAIGTSVSAFFLLVLAFANLLIL
FT                   ISVYRTFRAVRRGEPLVEQDLDILLNQRGFFARIFRPLFAIVSRSWHLYPIGFLFGLGF
FT                   DTATEIALFGISATQAHGGLSFWSVMALPVLFTAGMTLVDTTDGIMMMGAYRWAFVRPI
FT                   RKIYYNMTITFVSVLVAIVIGGIEALALIGGKLALKGGVGFRRDGGRTLRRARLLRDRP
FT                   VRRELDRLRAHLPDQALRRHRRDALRVRPARGASP"
FT   gene            295784..296737
FT                   /locus_tag="BMA10229_A0280"
FT   CDS_pept        295784..296737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0280"
FT                   /product="cobalamin biosynthesis protein CbiG"
FT                   /note="identified by match to protein family HMM PF01890"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03263"
FT                   /db_xref="GOA:A2S2W3"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2W3"
FT                   /protein_id="ABN03263.2"
FT                   /translation="MRARCVKADKSHRGARGPPSPVPGTRAAGGGTRCAIVCARSVPGR
FT                   AFARPAQRETGSGAPAQPVLPPATVSRLRRARRASRPRATVPADGKAAGRHAASPDTGR
FT                   RTGRAALAERPVFRGGRKRARNPRNPCHPTPGRQAGRRTPRPHDSIRSTPPTPARARRA
FT                   RGRPMMRVALGIGCRAGRPAEAIEAAIRAALARLPQASLADVGVVATLDAKAREPGLVA
FT                   CCARHGWPLVAFSRDEIAAHLARLAGLARAGSDSGSGSGVGASPAPGAPSCAAARARFG
FT                   VDGVCEPCACLAAPNGALIVRKLALDGVTAALAGPL"
FT   gene            296796..297398
FT                   /gene="cobO"
FT                   /locus_tag="BMA10229_A0281"
FT   CDS_pept        296796..297398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /locus_tag="BMA10229_A0281"
FT                   /product="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="identified by match to protein family HMM PF02572;
FT                   match to protein family HMM TIGR00708"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01536"
FT                   /db_xref="GOA:A2S2W4"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2W4"
FT                   /protein_id="ABN01536.1"
FT                   /translation="MKTDSESHQRMAERRRAGHEKKQAAATVEKGLLIVHTGNGKGKST
FT                   AAFGMAVRMLGHGMRTGVVQFIKGALHTSERDFLGANAQCDFVTMGDGYTWNTQNRDAD
FT                   IATARRGWDEARRMIESGDYRMVILDELNTVLKYEYLPLDEVLATLAARDPALHVVVTG
FT                   RHAPDALVDAADLVTEMRLVKHPYKEQGVKAQRGVEF"
FT   gene            297403..299019
FT                   /gene="cobB"
FT                   /locus_tag="BMA10229_A0282"
FT   CDS_pept        297403..299019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobB"
FT                   /locus_tag="BMA10229_A0282"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="identified by match to protein family HMM PF01656;
FT                   match to protein family HMM PF07685"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03450"
FT                   /db_xref="GOA:A2S2W5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2W5"
FT                   /protein_id="ABN03450.1"
FT                   /translation="MPACPALFVAAAASGQGKTSVTAALARHHRRLGRRVRVFKTGPDF
FT                   LDPMLLARASGARVYSLDLGMVGERGCRALLARAAAEADVILIEGAMGLFDGTPSSADL
FT                   AQAFGVPVAAVIAAQSMAQTFGALAFGLAHFRPGLPFHGVLANRVGSERHAQLLRGALP
FT                   GSIRWLGHLPRDARIALPERHLGLHQPDDVADLDARLDRAADAIAHTALAALPPVVEFV
FT                   CGDAANAEADAGDGGATIPAQDASRTAHRTATAARVAAGRGALAGATMRAAHGERAARS
FT                   ADAAAHETVDDALLDAAKRAGTGDGALSPSPDAGGAIGAIGTIRSTETTETTEAVPSLV
FT                   GRRIAIARDAAFSFIYPANLDQLEALGAELAFFSPLADEPVPDGSHALYLPGGYPELHA
FT                   ARLAANATAARSIAAHVAAGRRVVAECGGMLYLSDALTDADGVTTPMLGLVPGHATMQR
FT                   RFAALGMQTLATRFGAMTGHTFHYSRLATPLAPVAAATRPDDGAAGEPVYRHGPIVATY
FT                   LHAYWPSNPRAAAALFAGDAP"
FT   gene            complement(299036..299329)
FT                   /locus_tag="BMA10229_A0283"
FT   CDS_pept        complement(299036..299329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0283"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00855"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2W6"
FT                   /protein_id="ABN00855.1"
FT                   /translation="MSGAAHDTHDTRGPCAAAWRSGRRRARVARRLARFAAVPRAARPR
FT                   ASARAMTACAVARRASAVRFAGGLRYTWIAKLRRLPPPSSPKRAASGAARLR"
FT   gene            complement(299326..300165)
FT                   /locus_tag="BMA10229_A0284"
FT   CDS_pept        complement(299326..300165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0284"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02834"
FT                   /db_xref="GOA:A2S2W7"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2W7"
FT                   /protein_id="ABN02834.1"
FT                   /translation="MAKKKLVYIWSLRNAAADKAGQQVDYKGGTRYMKSVLESLVDALN
FT                   DTELGDAYSLERVIYDDDAGSPLDREKLAEYGFAYEPGKRWFYPPALRVQGRLVNDLLL
FT                   AIPSEYRREPLASPARPAGKRAFEARLRETLDALGADLVVLDGLLVILDELVRPGAPYC
FT                   RRIVNIHPGITRADSPYERRGAYATLDALFGARGQKVVDWKTGRTMPVEPLRMTGASFH
FT                   YVDNGVDSGEVIHDVLNTEIDPDDTILELRWNNFNRSLFPALHEGLAIMAGLDARVA"
FT   gene            complement(300230..302488)
FT                   /locus_tag="BMA10229_A0285"
FT   CDS_pept        complement(300230..302488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0285"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03557"
FT                   /db_xref="GOA:A2S2W8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2W8"
FT                   /protein_id="ABN03557.1"
FT                   /translation="MKVRPSRPLCNLEQRKMEWATSTRVRAIAAGVAFYAAAAGHAQAQ
FT                   AAQPGADARQPGGEAKADTAAGGTLPAISVSGAAERDASVGLVARRSMTGTKTDTPIIE
FT                   IPQTINVVTAQQIEATGATDINQAFRYIPGFSSYGSDNRSDWYAALRGFTPTVFVDGLQ
FT                   VPNTINLSSWRVDPYMIDSIAVLRGPTSVLYGQGDPGAIVDVQSKLANGERIRELGVQV
FT                   GNYARKQLMFDIGDTIGKDGTLSYRIVGVGRDGNAQTGPLADQRVSFAPSLKWQPNADT
FT                   SLTLAATYLQDWGDTSSNFLPSRGTVLPNPNGTISDDLYTADANFDHYRKKQWSLGYQF
FT                   EHKLNPVWTLRQNVRWMHLSLDDASVYGGGLDDADPTMATMTRYAGLFQFNYSRFDVDN
FT                   QAQAKFTTGPLSHTLLFGFDYNRQTTTDSEWLAKGPSLNLYRPVYTPIPSDIFSGPNAS
FT                   RTDTKTTLNAFGLYVQDQIKWRRWVLTLGGRQDWTRTSQDDIANAASFRQNDHAFSGRV
FT                   GLTYLGDYGLAPYLSYSTSFNPQIGLKLAGGGLATPTKGRQIEAGLRWQPPGKNLMLNA
FT                   AVYQINQTNVAMSNPNDPTSSTFVQVGEVRSRGVELSAVGNLSRELSVIAAYVYQDVKN
FT                   VRANDNTLNKWPVDVPRPRQIASLWADWTWRTGPLTGFGVGAGVRYMSAAAGAVDNSLT
FT                   VPSYTLFDAALHYELRNWRFALNATNLFNRRYVAGCQSDAVCMYGNQRTVIATAKYNW"
FT   gene            complement(302488..304041)
FT                   /gene="pvdA"
FT                   /locus_tag="BMA10229_A0286"
FT   CDS_pept        complement(302488..304041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pvdA"
FT                   /locus_tag="BMA10229_A0286"
FT                   /product="l-ornithine 5-monooxygenase"
FT                   /EC_number="1.13.12.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03865"
FT                   /db_xref="GOA:A2S2W9"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2W9"
FT                   /protein_id="ABN03865.1"
FT                   /translation="MSAARRGRAWRGPSTMAASGASMNGAVRITFSSGRRRPRAGHTVK
FT                   GIRDMQRDTVFDLIGVGFGPSNLALAVRLAEAGERAAFAHCYVERQPAFGWHRGMLLDD
FT                   CRMQISFLKDLVTLRDPKSRFTFINYLYEHGRLSEFVNLKNFYPTRVEFHDYLSWVANA
FT                   FDERVHYGETVTAIEPVAAPGAPGEIDALRVFSKGADGRERQRVARALSVGVGGAPSVP
FT                   DAFAALGPECVVHSSSYLTSIERLVGAPGAHARKRIAVIGAGQSAAEVFVDLARRFPHV
FT                   EASLVIRSGALKPADDSPFVNEIFNPAFTDVVYAQPASGRRSLIERFRDTNYAVVDRPL
FT                   IEQIYEMLYLQRVAGEAPGAPRHRLLANTAVESAARTAHGQVELALRDRLTGDARTERF
FT                   DGLVLATGYRRDTHLPLLEGLAPHLGDALAAGDVARDYRLATPAHFKPRIYLQGCCEDS
FT                   HGLSDTLLSVLARRADEIAASLADAADTTEYEEADPAAGRARPRHENNGVSDGRLAIAL
FT                   "
FT   gene            complement(304038..309236)
FT                   /locus_tag="BMA10229_A0287"
FT   CDS_pept        complement(304038..309236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0287"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01256"
FT                   /db_xref="GOA:A2S2X0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2X0"
FT                   /protein_id="ABN01256.1"
FT                   /translation="MTPPDLLSLAARFARLPDTQRKQFLAKLGDAGIDFRMLPIPPRED
FT                   RAASVPASFAQTRLWLHARLLGESAAYHITERLRLDGGLDANALRLSCDALIARHEALR
FT                   TTFAEGAAGVLQTVHAPMRCPWRFTDLADASAGSREQRAAAIAERDEAEPFDLAHGPLV
FT                   RAHLIRLDAATHWFVLTTHHIVSDGWSADVMLAELSSFYRSYATGDAVSLAPLPVQYAD
FT                   YALWQRRWLDAGEGERQLAYWRATLDASRDALLLPGAATRPAQRGASGARHAFDISAEL
FT                   ARRMRALAQARRATPFAVLLAALATLLARASGETGIRIGVPSANRERGETVGLIGFFVN
FT                   TLTLAASTPATLAFDALVDATQRGLIDAQSHQDVPFDQVVDALGVARSASHHPLFQVMA
FT                   AYGARRVLPSFAEVRATELPSGMPYAKFDLALSFDERDDGGLDARFVYATDLFDADAIE
FT                   RFAARYVELLAHALDTPGAAIGDLQWLPEAERRQLAAWNGQTHDFTGRASPARAGAGAA
FT                   VPRERAGQAGGEPFVPVHDRIAQHARRRPDARGVADIERALTRGEVDARATRLAKRLVA
FT                   AGVGAEMRVGVALSRSVDLLVGLIAALKSGGAFVPLDPSHPRERLAQMLEDAQIAHVIT
FT                   ERGSVDALPLAGATRAWLVDDAIADAEIDGVALPAVSPHQAAYVIYTSGSTGKPKGVVV
FT                   DHGAFARHCEAIAARYGATERDVFMLFQSVNFDGAHEGWFSQYMSGAAVAVTADTLWPP
FT                   ARTCALAAREGVTMTYVPPGCATQLAEWALEHGAPPSLRSITVGGEATSREAFALMRRA
FT                   FPNARVVNGYGPTETVITPMLWMFAPGDDPAKLADAAYLPIGTLVGARTAHVLDARLNP
FT                   LPVGVIGELYLGGEGVGLARGYLGRAALTAERFVPDPYGAPGARLYRTGDLVRRRADGV
FT                   FDFIGRIDHQVKLRGLRIELGEIEAQLAAHDDVREAVAVVFGEGAHARLAAFVELTGDA
FT                   RARARRADAAELDAHLRRTLPDYMVPAHIVVLDALPRNANSKVDRAALPEPAHVARAYE
FT                   APDGELETALAEIWREVLGVERVGRADHFFELGGHSLAAVRVATRVAERLARDVPVRAL
FT                   FEAPILAPYAQRVAAAAPAHAPQRAGSASYAPDADGVLPLSAAQRGLWFLWRAQPDSAA
FT                   YNIPVALRLRGALDVDALADALAHAAVRHPALRTRIVARADGAPGQRIAPARRIELPVV
FT                   DLRADARIADDDARLAAAIALTDADALAPFDLAADAPLWRARVIRLGAHDHVLSLVVHH
FT                   IVSDGQSIDLWLDAVRAAYVARRADEPATAAARAAADRRTDRHAGSRAASLAPARAKEA
FT                   PAQSATIAPIQAPADAPQPAPDAPVLPAAAPHARLAFWREALAGAPSHALPPPRAGRAC
FT                   APRWDAGRLAFEFDAALVRRARAMALDAHATLPMLLHAALNAAFYRATGATDQPVGVLA
FT                   STRELTGDAAERALGLFINAVVVRTRLSGADTPATLVAAVRDAALAAYAHADAPFCDVV
FT                   AALRAPRTVNGNPLFQVMFNYLRLAGAAARDWAGLAVDAFNDVRHRVVFELELDIVEHP
FT                   DGRVTGAFSYAAERVDGAFVAALAADYLDVVRGFVDAPARALGACAARFPLASHEAYVP
FT                   PPPAAADARAAARAARALAELWRASLGHAAPAPEANLFEAGATSFDVVRFVDAARSAGF
FT                   ALAIADVFAAPSLAALGERAAHTAGQPATQARDAD"
FT   gene            complement(309285..319169)
FT                   /locus_tag="BMA10229_A0288"
FT   CDS_pept        complement(309285..319169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0288"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM TIGR01720;
FT                   match to protein family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02075"
FT                   /db_xref="GOA:A2S2X1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2X1"
FT                   /protein_id="ABN02075.1"
FT                   /translation="MTSFPTALHHRIHALARLDPDAPALASFAPDTVRLTRGELDERAA
FT                   RLAAQLRAAGVGAEVPVGVCVARSCDLFVALLAVMKAGGAFVALDPRHPAARLDWVARD
FT                   AGLAHGIVDASADAAMRARFARCFDVGGVAAADPAAPREHGGDVHPRAAAYMIYTSGST
FT                   GTPKAVVVEHGPLAAHGDALAESLPIGPDDRVLHFASVNFDVAIEAWLVPLAVGGSVVI
FT                   SDPPPFTPDAAHALISRERVTNTTLPPAYLREFAAVCAREGVPPSLRVLLFGGEAMSQD
FT                   AFDEIRRVFPAIRLVNGYGPTETVISPMLWPVAPGTTPALDAGNGYASLPIGWPIGRRV
FT                   ARVERADGTVARGEAGELLLGGACLARGYHGRAALTAERFLPDPAGEPGARIYRTGDLA
FT                   RERADGAFDYLGRIDDQVQVRGVRVEPAEIAACLLTHPGVRDAGVLAETAGGRTQLIAC
FT                   VALAAPPRETPSGGDAPPDDDALRAHVAAHLPAAWLPHRFVRFDKLPYTLNGKLDRVAL
FT                   RDAVAARPAEAAADVDAPRTDTERRVAALWQRLLNDPAPIGRVDRFFARGGDSLAAMQL
FT                   QTAIRLDWRVNLRLDTLFDDAPLAELAARIDAAEREARQPAAIGTTARRAIAADAIDAR
FT                   ATGDARATGQMGRTGAAGEATEAAGALERPASFAQQRFWVLARTQDAGAAYHVSFHWDI
FT                   DGALDLGTLQRALDMLIARHEAWRTTLVENDDGVVLQRIHAALPVRIAAVDLRGEAGAS
FT                   RAARLAELTERHAGAPFDLSDGPLVRALLVTLADGAQRFLLTTHHAVSDGWSSRCAFAE
FT                   LTAAYAALAEGRAPELPALPIQYADYAQWQRDALDAHETARELAYWRGALDGAPAPLAL
FT                   PLDRPRAAERDYRGGRLARRLSPAASDAVRAAARRLHASPFTVLLAAFDAWLFRLTGER
FT                   DLVVAAPIAQRARPETAPLVGLFLNTLALRARVSPAQSFESLVASVRDAAFGAFAHQDV
FT                   PFDKVIDAVKPPVRRGDEWLRVKFAQQFDLECRASLPGAAVRMAPGLDTAARFDYALDF
FT                   TDDPRGIEFVAAYARDGIDEATAHAWLDSFAALVEDAVREPRRPIAALAVAQAGAPCAL
FT                   IAGRPLATAPDVLALFAREAAEHPHRVALADADTRLTFAELDDASNRVALALRRDAARD
FT                   EAPGAETPVAICIERSARFVVAFLGVLKSGAYAVPLDPASPRERIAAALAACGACRMLA
FT                   AGALDALGEFDGVAVQDIDACGHDASLANAAAPRVPPQPEQAAYLIFTSGSTGAPKGVV
FT                   VPHRALADYVAGMLDELAFAPHASMAMVSTVAADLGHTTLFGALCSGRTLHLLPAQAAF
FT                   DPDRFAHEMATRKVGVLKIVPSHLHALLDAQRAADVLPAHALVTGGEALPWALVERIAA
FT                   LKPDCRVINHYGPTEASVGALVCDTSAPAQADLRAAAASSPGEAARGVPLGRPLPNAHA
FT                   CVLDAYGSSVPVGAIGELYLGGPGLARGYLGRAAASAERFVPHPHVAGARVYRTGDRVR
FT                   LRADGRLDFLGRLDDQVKIRGYRVEPGEVSAALRALPGVAQAETLALEHEGRLRLAAFA
FT                   TPEAGARIAADALRDALAARLPDYMVPAALVVLDALPVTANGKIDRAALRARAAAPAPA
FT                   TAGDEDAPQGPIEATLAEVWRDVLKAARVGRHDNFFELGGDSILVLQVIARARKRGVKF
FT                   TPKQLFDGPTLAELARVAVAIEAAAPASGAAHGAAIGANAAAARRDEAVLTPAQLRFFA
FT                   LDIPRRGHWNQSIALDVAGAFDFDAFARAFDALLTHHPVFRERFAPTGDGGGWQRSAAP
FT                   RAFDTLPLAAAAARDEADALAQFDALQATLDLTHGPLACAFAAVLPSGATKLYLAIHHA
FT                   IVDGVSWRVLLDDLDAAYRAACERRAVRLGPTGASASEWAARLARAARDPAGPFAGELP
FT                   YWAALAAPHDDLRPDRPDAAATNAHADVVIQTLDAALTREVLTDANAAYRTQAVELLIA
FT                   ALVAALGQHTGAAACRLELEGHGREALFDELDASRTLGWLTSHYPVAFAVEATPAATLA
FT                   GVKDALRAVPNKGLGFGVLRHYGDDATRAALARVARPRVTFNYLGQFDAPRDAALVPRF
FT                   GGAGRERDPAGPLGNALAIHAYVDANGERALKVHWVYGATQFDRATIDALAARFDAALR
FT                   ALAAACRARVAERGAGATPGDYPLARAGGLTQAALDRLPFDARAIDDIYPLSPMQQGIL
FT                   FHSLFAPERATYVNQLVATLVDPDVERLRAAFDAAVPRHDILRTGFAAHEAAPMQIVHR
FT                   HARMPVEIVDWRGAHASPAALDTALDAWLAADRARGFDLAAPPLMRVTLIRTDDADWRL
FT                   VWTRHHLLLDGWSTARLFADVLSDYIEPPRANPFAAPARTRYRDFIAWLARRDAQADRA
FT                   FWLGRLARLDEPTHVAERARGASAAAHEAAGRANWRATLPAADTARIGEAARRMKVTVN
FT                   TIVQGAWALALQRITHRRAVAFGATVAGRPHALPDVDTVLGLFINTLPVITAPLPQLAA
FT                   RDWLASLQRDNAAALEHAHTPLYEIQQWAGLGGALFDTLVVFENYPVDEAWQGRDARAL
FT                   QKRDLRNIEATDFAVTLVIEAGDTLAIDYGYDPARIGPARVEALHRAFAACIAGLVDHP
FT                   DAPLGTISCASADDLALIARANATELDWPAAQRAPLFAQFEAAARARPDAIALECLASS
FT                   DGGDGARAQMRYGELDAKADRVAAALAASGVRPDSVVALCVERSFDMVVALVGTMKARA
FT                   AYLPVDPDYPAERIAYLLGDAKPPVVITQAHLRARVDAALAGADAAVVTVDELLARAAG
FT                   AEPEAERVAAAADVAPGQLAYLIYTSGSTGQPKGAGNTHGALANRIAWMQRAYRLAPDD
FT                   VVLHKTPFGFDVSVWEFVWPLAVGAKLAIAAPGDHRDPARLVAAIDAHRVTTLHFVPSM
FT                   LAAFVAYLDDFGAAARCASVRTIVASGEALAPELVARVAALLPHAQLHNLYGPTEAAID
FT                   VSHWRCTADDAAADAVPIGHPIANLRLHVLDAALHPAPVGATGELYLGGAGLARGYLGR
FT                   AALTAERFVPDPFVPGARLYRTGDLARRRADGALDYLGRLDTQVKLRGQRIELGEIEAL
FT                   LRATDGVRDAVVIVRDERLVGYVACATPAGFDAAAQIERLRARLPAYMVPAQLVALDAL
FT                   PVTPNGKCDRRALPAPVFDARVVDAPRTATERALAAIWQRVLTLPELGRDDDFFALGGH
FT                   SLLAAQANAQANLQWSLTLPLRTIFDERTLARCAAAIDRARDAGRERDAAGAIDALLGE
FT                   LEAQ"
FT   gene            319798..321486
FT                   /locus_tag="BMA10229_A0289"
FT   CDS_pept        319798..321486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0289"
FT                   /product="cyclic peptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01194"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02372"
FT                   /db_xref="GOA:A2S2X2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005898"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2X2"
FT                   /protein_id="ABN02372.1"
FT                   /translation="MKHARRLIVALLKRSRGAFAIALAACVLNGASSVLLVATLSRALS
FT                   EPQAADASLAWRFGLCAVIALVTRIVTGVLFARLSQDTMAQLREHVARRVAAAELQDVE
FT                   RIGAAPVQSVLTDDATNVSMLFFALPNLVMHGSIVFGCLGYLAWLSWPVCLLAVAAILV
FT                   GSLGYHAGDKRAIAWLEDAGRSQDKLFGYLGALFSGAKELKLHQARSRQFVDGQLGAAI
FT                   AEVRDHRRRAFSAYAIGVGWIVFLFYVFLGVAAFWPALGVRGDGPAASGYVVVFLFMLL
FT                   PLDGLLNNVPTLNAARVSLERIEKLMAQFGALRTAPPPDENASHEPFDTLALRGVTHSY
FT                   FHERDERMFRVGPIDLTLKPGELVFLVGGNGSGKTTLAKVLTGLYEPEGGVIELDGKPI
FT                   GLAERAAYRERFSAVFNDFHLFDALLGIVDPNDAARAQADARANALVAKLSLDHKVQVV
FT                   DGAFSTRALSTGQRKRLALVVAYLEDRPLYLFDEWAADQDPAFKAVFYEQLLPELRARG
FT                   KTVIVISHDDRYFPIADRVLKLDNGIIVSETFGARHAALANGTEG"
FT   gene            321781..322548
FT                   /locus_tag="BMA10229_A0290"
FT   CDS_pept        321781..322548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09351"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00989"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2X3"
FT                   /protein_id="ABN00989.1"
FT                   /translation="MRRAERGRPRPPVAALTRRSPSPARTASPRVPSHLVAVQRRSPAH
FT                   AVRRRSLVSFTHDTFRRSLMSPTALLVPTFTHMLQSLSAWLDKAAAHQRALGAEPDDVL
FT                   TKRLAADMFALAAQIRFTAFQAQEPVYRLRGDALPESLLEVRRAGWQADAAPGSLRDAQ
FT                   ACLADARALLAGLAPHALDEGAERPIALELPNGAVFDMTGEQYLRDWALPQFYFHAIAA
FT                   YAILRHHGVALGKPDYVSHMFAYLRPGTMPQDR"
FT   gene            complement(322824..324020)
FT                   /locus_tag="BMA10229_A0291"
FT   CDS_pept        complement(322824..324020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0291"
FT                   /product="iron compound ABC transporter, periplasmic
FT                   iron-compound-binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01876"
FT                   /db_xref="GOA:A2S2X4"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2X4"
FT                   /protein_id="ABN01876.1"
FT                   /translation="MTAWARRAARFARLPIGGRTAVLVRAMRAADAEPATFWTPAAPVT
FT                   RAGRLPSPSRPMRGARAARPLAAVAAFAALVAGTLAFAPAAHAGEPSAVCRPLADDPTV
FT                   SQFSRTLPARPARIVVLEFMFAEDLAALDITPVGMADPAYYPIWIGYDDARFARVSDVG
FT                   TRQEPSLEAIAAAKPDLILGVGLRHAPIFDALSRIAPTVLFKYSPNYIEDGRQVTQYDW
FT                   ACAILRTIGCLTGRARDARAVQARVDAGLARDARRIAAAGRAGERVAWLQELGLPDRYW
FT                   AFTGNSASAGIARALGLEPWPGEPTREGTAYVTSEDLLKQPDLAVLFVSATEPGVPLDA
FT                   KLDSSIWRFVPARRAGRVALVERNIWGFGGPMSALRLADEMTQRVLALPKPAAGAPPR"
FT   gene            complement(324017..324823)
FT                   /gene="fhuF"
FT                   /locus_tag="BMA10229_A0292"
FT   CDS_pept        complement(324017..324823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuF"
FT                   /locus_tag="BMA10229_A0292"
FT                   /product="ferric iron reductase protein FhuF"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01275"
FT                   /db_xref="GOA:A2S2X5"
FT                   /db_xref="InterPro:IPR008090"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2X5"
FT                   /protein_id="ABN01275.1"
FT                   /translation="MSARMRATRFSTFAPAAIAHYLEHVWLGAPDACDEPALAPDGAEP
FT                   ADLISAASLALRRDALVGAMVALYGGDARAHARALVSQWSKYYFNLAASAGFAAALLLG
FT                   RPLDMAPQRMRVALRGGMPVALLFEADALRPAQAEPASRYAALVDHLRATIDTLAVLAK
FT                   LSPRVLWANAGNLLDYLFEQCAHAPRAGADAAWLFGPVDSRGEANPLRLPVRRVKPCSA
FT                   RLPDPFRARRVCCLRNEIPGEDQLCGSCPLLLTMCDDALAKQDAAH"
FT   gene            complement(324820..326940)
FT                   /locus_tag="BMA10229_A0293"
FT   CDS_pept        complement(324820..326940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0293"
FT                   /product="ABC transporter, iron chelate uptake transporter
FT                   (FeCT) family, permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03248"
FT                   /db_xref="GOA:A2S2X6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2X6"
FT                   /protein_id="ABN03248.1"
FT                   /translation="MTALAVRKRLRHGGRAPESSPASRAAAPGRVGAIAGALVALIVVT
FT                   AAMRLAPELRAWLAAPAGGDAAQLAHIMLFDLAAPRVAAALVAGGCLAAAGALLQSLTR
FT                   NPLAAPDLLGITGGAQLGLIAAMLVPALAGHASVPLLFVCGLAAAACVSAAAGGWRATP
FT                   LRLILAGSVCMLLFSAVTTLLLAFFEQTVVGASLWASGSLYQPGAAGLRDALLWLVAPL
FT                   AALPLVIRPLDPLALGDDAAAAAGVRVDATRLAGTVVAVGFASVAVSIAGPLSYIGLIA
FT                   PNLIRQMRGAKASRLGALVPLAALAGGALVLVTDSAVLALGLDATLSTGVAIAFVGTPL
FT                   MLAMIRRGAAWSGAAQQPAHVRAGTRGGARLVRALAVLPWPAVAVLLLAAGAAVLVVGA
FT                   SFGPVWIGPGRWFAALAQRDDLARTVLDLRAPRLLCALLAGALLGASGVLMQSIVRNPL
FT                   AGPEVLGVTQGAGLATLATLVAWPLAAHGTLVAASLAGGGATLVLTLALNRRHRYAPLA
FT                   VALTGIVIGTLWTTLAQWLITQESVQPARFVVWLVGGTYGRSWGEAAALLPWGVLAVPA
FT                   LALLARPLDLLALGDEQAAALGLPIAALRPLVLTIATLAACAAVAAVGPVGFIGLMAPH
FT                   LAAMLGARAHATRLWLAAAWGALVLAAADIAARTLLAPREIPAGVLTALIGAPYLLALL
FT                   IAEARRERRGGR"
FT   gene            complement(326937..327827)
FT                   /locus_tag="BMA10229_A0294"
FT   CDS_pept        complement(326937..327827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0294"
FT                   /product="ABC transporter, iron chelate uptake transporter
FT                   (FeCT) family, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01589"
FT                   /db_xref="GOA:A2S2X7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2X7"
FT                   /protein_id="ABN01589.1"
FT                   /translation="MNNETVAALAARALSVGYRDHRVLDGLDLTIAVGRVTALCGPNGC
FT                   GKSTLLRTLAGLQPALSGTVDVNGAPLGSYRRRALARTLTMLAQFNQIPAGLTVRELVA
FT                   YGRYAHGGWLRGLARADRDAIDEALAATGLEPDAARDVAALSGGERQRAWIAMALAQQA
FT                   PIVLLDEPTTYLDIHHQLDILRELRRLNRARGLTIVWVLHDLNQAAAYSDEIVLMRAGR
FT                   IVAQGTPDAMLEPRHLQAAFGVTMLKTAHPLTGAPMCVPAYEGVLDTDHADPAHAAAPG
FT                   GRGAAVARARRDLAA"
FT   gene            complement(327865..328866)
FT                   /locus_tag="BMA10229_A0295"
FT   CDS_pept        complement(327865..328866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0295"
FT                   /product="putative syringomycin biosynthesis enzyme"
FT                   /note="identified by match to protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00681"
FT                   /db_xref="GOA:A2S2X8"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2X8"
FT                   /protein_id="ABN00681.1"
FT                   /translation="MPAAAACPTLGDLRVEPGLPTVVSPRDGADIALHEAAPLLREIAD
FT                   DVLERAGGVLFTGFRVASIETFQRFAADFGDPLIGYEFASTPRSQVEGAVYTSTEYPPH
FT                   RSIPLHNEQSYTREWPLRIWFHCALAARTGGATPIADSRAVYRALDPALVARFAERELL
FT                   YVRNFGQGLDLPWQQAFGTGDPREVERICAARGIGCEWRDGDDGEPLLRTRERCQAVAR
FT                   HPRTGELVWFNQANLFHLSALDEDMQEALVDAVGIENVPRNVYYGDGAPLEPDALAEIR
FT                   AVLDGQRIVFPWQTGDVLMLDNMLSAHARDPFEGPRKVVVAMARSYREKRGA"
FT   gene            complement(328940..329182)
FT                   /locus_tag="BMA10229_A0296"
FT   CDS_pept        complement(328940..329182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0296"
FT                   /product="mbtH domain protein"
FT                   /note="identified by match to protein family HMM PF03621"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03431"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2X9"
FT                   /protein_id="ABN03431.1"
FT                   /translation="MTQAQQPASAPADADDVVYAVVVNDEEQYSIWPTFRAVPAGWREA
FT                   GVRGPKAECLAHIEAVWTDMRPASLRRHLDAARAS"
FT   gene            complement(329238..329951)
FT                   /gene="mbaS"
FT                   /locus_tag="BMA10229_A0297"
FT   CDS_pept        complement(329238..329951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbaS"
FT                   /locus_tag="BMA10229_A0297"
FT                   /product="malleobactin sigma factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF08281; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03626"
FT                   /db_xref="GOA:A2S2Y0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Y0"
FT                   /protein_id="ABN03626.1"
FT                   /translation="MAEVLARPAPAKPLPILASNGAFAPAAAPVLRAPSRPAARTPGAR
FT                   EHGALVDVLVANRPMLVKLARGFVGCASRAEDVVHDVFVKLVDFPNQDAIRQPVAYVTR
FT                   MVRNASIDACRRQTLENTYHADEDDGLDVPSPELSPEAALVVRDTLRHVYDALAQLPAR
FT                   SRAAFEMVRLREETLQSAARALNVSQTLVHFMVRDAERHCVACVDASERGLACPAFCGA
FT                   RARTVKKCVRDSSIE"
FT   gene            330197..330556
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0298"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(331004..331750)
FT                   /locus_tag="BMA10229_A0299"
FT   CDS_pept        complement(331004..331750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0299"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03411"
FT                   /db_xref="GOA:A2S2Y2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Y2"
FT                   /protein_id="ABN03411.1"
FT                   /translation="MSVAFDFHGRSFLVTGASSGIGRAAAVALRGGGARVVAAARNARE
FT                   LERLAHETGCEPLELDVGCDASVRAALSGERMRDAFDGLINCAGVTSLAAAIDTTADEF
FT                   DRVMAVNARGAMLVARHVARAMIRAGRGGSIVNVSSQAALVALPSHLAYCASKAALDAM
FT                   TRVLCVELGPHGIRVNSVNPTVTLTPMAERAWSDPHASGPMLAAIPLGRFARVADVVAP
FT                   ILFLSSDAAAMVSGVALPVDGGYTAR"
FT   gene            complement(331747..333288)
FT                   /locus_tag="BMA10229_A0300"
FT   CDS_pept        complement(331747..333288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0300"
FT                   /product="carbohydrate kinase, FGGY family"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00634"
FT                   /db_xref="GOA:A2S2Y3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Y3"
FT                   /protein_id="ABN00634.1"
FT                   /translation="MACVIGVDIGTQSTKAVLVGLDGAILAQHAVAYRPDTPKPLWAEQ
FT                   WPHVWFDAVRECIARVSADARAAGIGAESIEALCVSSLYGGSGIPVDREMRPLHPCLIW
FT                   MDRRATDEVDWVRAHVDVARLGEITGNGVDSYYGYTKMLWLREKRPDVWANVRYFVPPN
FT                   AYVAYRLTGELAVDHSAAGNIGGVYDLGRRDWSDEALDMLGIPATMMPERLVDSDAVVG
FT                   GLLREWAHALGLEVGTPVVAGGVDAAVATFAAGATRRGQHVAMIGTSMCWGYLAETADA
FT                   RRGLVSMPHVFDGRRDLYVFGGAITAGASVSWFREQFCHAEIEAARAGGGDAHRLLEAA
FT                   AAEVSAGSDGVLFLPYLMGERSPVWDAKASGAFVGLSLYHTRAHLYRAVLEGLAYALRH
FT                   NIEAGAAGARALDARLVVVGGAAHSDLWMQSIADITGYPVWTIAEEVEAAMGAALLAAL
FT                   GAARVSREAARRGWVTLAERARPDARHAALHDARFALYAGLYPALQPFMHGLQTS"
FT   gene            complement(333319..334611)
FT                   /locus_tag="BMA10229_A0301"
FT   CDS_pept        complement(333319..334611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0301"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03280"
FT                   /db_xref="GOA:A2S2Y4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Y4"
FT                   /protein_id="ABN03280.1"
FT                   /translation="MRRACRLDRARRAHRPRRGGEGRCARPPRRRPPRALDPLHSLHPL
FT                   HPRAGRRIRPAVFSNPASQTETMTNRNDETQQMTAIVCHAPEDYRVERVAKPRANAREL
FT                   VIRIGACGICASDCKCHAGAKMFWGGPSPWVKAPVIPGHEFFGYVEALGEGAAEHFGVA
FT                   LGDRVIAEQIVPCGTCRYCKSGQYWMCEVHHIFGFQREVADGGMAEYMRIPSGAIVHPI
FT                   PLGISLEDAAIIEPLACAIHTVNRGDIQLDDVVVIAGAGPLGLMMTQVAKLKTPRRLVV
FT                   VDPVEARRALARAYGADVTIDPAREDAPAIVRALTGGYGCDVYIETTGVPAGVTQGMAL
FT                   IRKLGRFVEFSVFGKDTALDWSIIGDRKELDVRGAHLGPYCYPVAIDLLARGLVTSKGI
FT                   VTHGFSLDEWDEAIRVANSLDSIKVLMKPRG"
FT   gene            complement(334637..335641)
FT                   /gene="rbsC"
FT                   /locus_tag="BMA10229_A0302"
FT   CDS_pept        complement(334637..335641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="BMA10229_A0302"
FT                   /product="ABC transporter, carbohydrate uptake
FT                   transporter-2 (CUT2) family, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02359"
FT                   /db_xref="GOA:A2S2Y5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Y5"
FT                   /protein_id="ABN02359.1"
FT                   /translation="MHDRTAAPSASCAPAAASPARATGPALAALRRSTTFYPLVGLVAV
FT                   CVAMVFASDSFLSAANLENVLRQVSINAIIGVGMTCVILTGGIDLSVGSVMALSGTLAA
FT                   GLLVAGANGAAALAAGIGVGVALGAANGLFVAFAGMPPIIVTLATMGIARGLALIYTGG
FT                   YPIDGLPDWVRFFGSGKVLGVQMPVLTMLAVYALAWLMLERMPFGRYVYAIGGNEHATR
FT                   LSGVRVSRVKLAVYTFAGLTSALAALVLTGRLMSGQPNAGGGFELDAIAAVVMGGTSIA
FT                   GGRGSIVGTLVGALLLGVLNNGLNMIGVNPYVQNVIKGAIILLAIYIGRERRT"
FT   gene            complement(335634..337241)
FT                   /gene="rbsA"
FT                   /locus_tag="BMA10229_A0303"
FT   CDS_pept        complement(335634..337241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="BMA10229_A0303"
FT                   /product="ABC transporter, carbohydrate uptake
FT                   transporter-2 (CUT2) family, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01788"
FT                   /db_xref="GOA:A2S2Y6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Y6"
FT                   /protein_id="ABN01788.1"
FT                   /translation="MVSGPRDEADDMDEASGAARAPDEASEEAMDTILALTGITKRFPG
FT                   VVALRGIDLRVARGEIHALLGENGAGKSTLMKILCGIHPPDEGVIALDGEPRRFANHHD
FT                   AIAAGVGIVFQEFSLIPELNAVDNLFLGREWRGRLGLRERARMRRAAADIFARLDVAID
FT                   LSAPVRELSVAQQQFVEIGKALSLDARLLILDEPTATLTPAEAAHLFGVMRELKRRGVA
FT                   MIFISHHLDEIFEVCDRITVLRDGQYVGTTEVARTDVGALVEMMVGRRIEQSFPPKPRL
FT                   ARDAAPVLEVDALQVRENGPVNRFALREGEILGFAGLVGSGRTSSALALIGAKPARVRR
FT                   MRVRGRPVRLADPAAALAAGIGLLPESRKTQGLIPAFSIRHNIAINNLGKHRRLRWFVD
FT                   AAAETRTTLELMQRLGVKAPTPHTRVDTLSGGNQQKVVIARWLNHHTRILIFDEPTRGI
FT                   DIGAKAEIYQLMRELSARGYSIVLISSELPEIVGLCDRVAVFRQGRIEAMLEGEAIEPN
FT                   TVMTYATSDVRGANHEHA"
FT   gene            complement(337235..338182)
FT                   /gene="rbsB"
FT                   /locus_tag="BMA10229_A0304"
FT   CDS_pept        complement(337235..338182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="BMA10229_A0304"
FT                   /product="ribose ABC transporter, periplasmic
FT                   ribose-binding protein"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00863"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Y7"
FT                   /protein_id="ABN00863.1"
FT                   /translation="MMHTALSTPASGRRAARALRAAALSLALGAASAAHAAPLKIGMTF
FT                   QELNNPYFVTMQKALDEAAASIGAQVIVTDAHHDVSKQVSDVEDMLQKKIDILLVNPTD
FT                   STGIQSAVVSAKKAGAVVVAVDANANGPVDAFVGSKNFDAGAMSCDYLAKAIGGGGEVA
FT                   ILDGIPVVPILERVRGCRAALAKFPNVRIVDVQNGRQERASALAVTENMIQAHPLLKGI
FT                   FSVNDGGSMGALSAIEASGRDIKLTSVDGAPEAIAAMQKPNSKFIETSAQFPRDQIRLA
FT                   IGIGLAKKWGANVPKAIPVDVKRIDKGNAKTFSW"
FT   gene            complement(338284..339273)
FT                   /locus_tag="BMA10229_A0305"
FT   CDS_pept        complement(338284..339273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0305"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01391"
FT                   /db_xref="GOA:A2S2Y8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Y8"
FT                   /protein_id="ABN01391.1"
FT                   /translation="MQPDLEVVDVRRGESFKAWSHGYPYRTVRWHFHPEFEVHLIVETT
FT                   GQMFVGDYVGGFGPGNLVLMGPNLPHNWVSDVSEGRTIAERNLVVQFGQAFVSRCADSF
FT                   TEWRHVEALLADARRGVQFGPRTSEAIKPLFAELIHARGLRRIVLFLSMLQILIDATDR
FT                   ELLASPAYEADASSFASTRINHVLAYLGKNLANERRETDLARLAGQSVSAFSHDFRRHT
FT                   GLPFVQYVNRMRINLACQLLMDGDASITDICFRSGFNNLSNFNRQFLAVKGMSPSRFRR
FT                   YQALNDASREASEAAALRGAGIAGAPAIVPAARARGEARAPAEALLSG"
FT   gene            339322..339630
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0306"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            340066..340776
FT                   /locus_tag="BMA10229_A0307"
FT   CDS_pept        340066..340776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03317"
FT                   /db_xref="InterPro:IPR032708"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Z0"
FT                   /protein_id="ABN03317.1"
FT                   /translation="MVPARHCHVAVFDQAIVALDIRRSRYFLYDAACARDFADHYLDFK
FT                   PIDAPRALKPLIADRILVAESPAAARSRIADYRGWSFDAFDSGIWGSRVLGKRDAARFE
FT                   WLPFWRIVRSAASLKMRGFHALAALDQLDARGAPARGDDASHTVERLLRASIWSPFRIT
FT                   CVQMSLALATHLRRQNVPAQLVIGVRPMPFVAHAWVEVDGRVCGDEPDLKKSYGEIYRT
FT                   PRCDASAAPFGLAA"
FT   gene            340853..342121
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0308"
FT                   /note="Asparagine synthase family; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF00733"
FT   gene            complement(342166..342999)
FT                   /locus_tag="BMA10229_A0309"
FT   CDS_pept        complement(342166..342999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0309"
FT                   /product="IS1404 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00695"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABN00695.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(343023..343286)
FT                   /locus_tag="BMA10229_A0310"
FT   CDS_pept        complement(343023..343286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0310"
FT                   /product="Transposase subfamily"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03454"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABN03454.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            343389..343694
FT                   /locus_tag="BMA10229_A0311"
FT   CDS_pept        343389..343694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02080"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Z4"
FT                   /protein_id="ABN02080.1"
FT                   /translation="MLREIAAAHTPVDVLWRRTKGSFGIGFVKGIVSHYDAFRELIRDG
FT                   VLMRSGQLDEAELEHALKAVRVGQNAAAISLALVGCVEIFCASWQNFMTNRSAAIC"
FT   gene            343703..343831
FT                   /locus_tag="BMA10229_A0312"
FT   CDS_pept        343703..343831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0312"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03004"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Z5"
FT                   /protein_id="ABN03004.1"
FT                   /translation="MLTNRFAARAPMRARPHPAPPRAGAGLSSCAMPAHRHDREST"
FT   gene            343828..345588
FT                   /locus_tag="BMA10229_A0313"
FT   CDS_pept        343828..345588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0313"
FT                   /product="putative ABC transport system, membrane protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02736"
FT                   /db_xref="GOA:A2S2Z6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Z6"
FT                   /protein_id="ABN02736.1"
FT                   /translation="MKLAALRSLADVIRLMLDKETHARRPIVAGVLVEALTSAFMLLGP
FT                   IALKLAVDEMARPRFDAAKASVDIALFAVLWSASAISSIALLAYTGRIVHAVSNALLRR
FT                   ALHAQLPALASRASSDSGYVQGLLERLPYSLQVIIEGVLWKIVPVAIQLAVALVLIALL
FT                   VPLRYAAILFAVLAAYFVFSHLSAEQYEKSAATTNEAAGALSAALGDVLANAPRVVYNG
FT                   ALAREIDYVGARAGARLDVDWRRSWLLTRAAACQYGIIALGMAAMFVLCVRDIAAGRIT
FT                   LGDFMLLQTYVLQFALPLGAYGFVLRQAGAALANVREALDIAPRPAPAAAIGAAPPPGR
FT                   SGAPIAVRRLAFRRADRFAIEPMSFDLPAGSYTAIVGHNGSGKSTLAKIVAGRLAPDEG
FT                   VVAYGDVDLYRVASDARHRFALYVPQDVALLNRSLRENVRYYPSTLTDDDAARLLERLA
FT                   FHKDGRPIDLDGEVGEGGARLSGGQVQKVELVRLMGVDVPAIVLDETTSGLDPHSDALG
FT                   IAMLRERLGQRTTLVLITHRIANVEAADQVLFLSGGRLVAAGPHRRLVDTCDEYRAFWR
FT                   RQPEPADAKA"
FT   gene            complement(345639..346664)
FT                   /locus_tag="BMA10229_A0314"
FT   CDS_pept        complement(345639..346664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0314"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03891"
FT                   /db_xref="GOA:A2S2Z7"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Z7"
FT                   /protein_id="ABN03891.1"
FT                   /translation="MSALARLLPRRAPGWLAWACAALVVALAQPAWAVRCLTNSGQTSL
FT                   TEPIGNVASYPTDAPDGYVIWISAPRTTDGYCYKDLGGAGNLNIVDNIYFYANPDGKNP
FT                   AAWGLEIGIRYRGVDHFGAGSRPGTGVPTGFAVPPCSQTDFNAKRCPKIPVSITYQVVV
FT                   RKKGAWVQPPGDVYTVFQFDGEKGLNNTNPSFQYKLSGLQNLKPTPCMVDVTVTPEPGI
FT                   VKFGQVQSSGNGFSPAVPRKPFSLALTKKCSIAVRVDGYFETSQAVRDGLLVPQSDSNF
FT                   GIGIEDRNGHAIAFNRQFVLTQMPANVSYQNIVLDAVLKSFGAPKIGPFTGTATIRLFI
FT                   Y"
FT   gene            complement(346661..347410)
FT                   /locus_tag="BMA10229_A0315"
FT   CDS_pept        complement(346661..347410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0315"
FT                   /product="hypothetical fimbrial chaperone yfcS precursor"
FT                   /note="identified by match to protein family HMM PF00345"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01245"
FT                   /db_xref="GOA:A2S2Z8"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Z8"
FT                   /protein_id="ABN01245.1"
FT                   /translation="MTDMTHRFPCAARARRAAAALFIALAGAAHAAIVPDRTRVILNEG
FT                   EQAAIVTLSNKSDAYPYLVQSWLEDERGNRITTPLMVVPPLQRVEPKERNVLRIARMPG
FT                   ATLPADRESVFYLNIREVPPKTDTPNALQIALHTQMKLFYRPAGVQPARDEDPTLPMTL
FT                   RVDAVARKLVFDNPTPYHVTVVALAAGANRAALPLDPVMVNPKSAASVPFSASAAGGLF
FT                   VTHVDDYGGQVTVEYTCDGLACRSVKR"
FT   gene            complement(347490..348452)
FT                   /locus_tag="BMA10229_A0316"
FT   CDS_pept        complement(347490..348452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0316"
FT                   /product="multidrug resistance protein mdtF"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02415"
FT                   /db_xref="GOA:A2S2Z9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A2S2Z9"
FT                   /protein_id="ABN02415.1"
FT                   /translation="MARFFIDRPVFAWVISLFIMLGGIFAIRALPVAQYPDIAPPVVSL
FT                   YATYPGASAQVVEESVTAVIEREMNGVPGLLYTSATSSAGQASLSLTFKQGVSADLAAV
FT                   DVQNRLKIVEARLPEPVRRDGISIEKAADNAQIIVSLTSEDGRLSGVELGEYASANVLQ
FT                   ALRRVEGVGKVQFWGAEYAMRIWPDPVKMAALGLTASDIASAVRAHNARVTIGDVGRSA
FT                   VPDSAPIAATVLADAPLTTPDAPVPFGASVQDAATGKELGIVGEAGAAYLTQVQPRAKL
FT                   VVRAGAKTICTPAALPDTLQLDGTPAPVACEAAAQHASR"
FT   gene            complement(348469..349668)
FT                   /locus_tag="BMA10229_A0317"
FT   CDS_pept        complement(348469..349668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0317"
FT                   /product="acriflavine resistance protein E precursor"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02412"
FT                   /db_xref="GOA:A2S300"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A2S300"
FT                   /protein_id="ABN02412.1"
FT                   /translation="MKYEWARTRRLSAALAVAAFVAAGCGKHESEHDAAAPREASVVTV
FT                   KKTSVPLSVELPGRLDAYRQAEVRAWGAGIVTARTYEEGQEVKRGAVLFRIDPAPFKAA
FT                   RDAAAGALEKARAAHLAALDKRRRYDELVRDRAVSERDHTEALADERQAKAAVASARAE
FT                   LARAQLQLDYATVTAPIDGRARRALVTEGALVGQDQATPLTTVEQLDPIYVNFSQPAAD
FT                   VESLRRAVKSGRAAGIAQQDVEVTLVRPDGSTYARKGKLLFADLAVDPSTDTVAMRALF
FT                   PNPERELLPGAYVRIALDRAVARDAILVPRDALLRTADSATVKVVGQNGKIRDVTVEAA
FT                   QMKGRDWIVTRGLAGGERVVVVDAAQFEAGTTVKALERGAAAQPASGAAAASAPGRRST
FT                   "
FT   gene            349812..350483
FT                   /locus_tag="BMA10229_A0318"
FT   CDS_pept        349812..350483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0318"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM PF08361"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03811"
FT                   /db_xref="GOA:A2S301"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A2S301"
FT                   /protein_id="ABN03811.1"
FT                   /translation="MARKTREESLNTKNRILDAAELVLLEKGVGQTAMADIAEAAGMSR
FT                   GAVYGHFNGKIEVCVAVCDRAFSRAVEGFDLSDERPALATLRLAASHYLHQCGEPGSMQ
FT                   RVLEILYMKCEQSEENAPLMRRRALYELQTLRIAKALLRRAVAAGELDASLDVHLAGVY
FT                   LLSLLEGIFGSMIWTTRLRGDRWRDAEAMLDAGVDTLRASPALRVAEACAARGLPRANV
FT                   H"
FT   gene            complement(350538..350825)
FT                   /locus_tag="BMA10229_A0319"
FT   CDS_pept        complement(350538..350825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0319"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01403"
FT                   /db_xref="UniProtKB/TrEMBL:A2S302"
FT                   /protein_id="ABN01403.1"
FT                   /translation="MAKGVHILEKGGSNGKGGGAAAASEPASGRAGSARALNAAGRDRQ
FT                   RTAPRRVPLGPTTRTISAPNGDSVFEGSNPNEESMPTKVTAPRAQLFLAI"
FT   gene            350691..352220
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0320"
FT                   /note="subfamily M23B unassigned peptidase; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF01551"
FT   gene            complement(352262..353005)
FT                   /locus_tag="BMA10229_A0322"
FT   CDS_pept        complement(352262..353005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0322"
FT                   /product="glutamine ABC transporter"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02031"
FT                   /db_xref="GOA:A2S305"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S305"
FT                   /protein_id="ABN02031.1"
FT                   /translation="MDLSILANNLPYLLVGAFPDGSLGGAALSLVLALASALASAGLGV
FT                   ALGVALALATGALRGALVVVIGFFRAIPVLMLIFWTYFLLPVLLHADVPGLAAVVCALL
FT                   LVGGAYLAHSVHAGIRAAGDGQWQAGLALGLTRWQTVRHVLLPQAVRIMTPSFVNQWVS
FT                   LVKDTSLAYIVGVPELSFVATQVNNRLMVYPAQIFLFVGVIYLILCTALDVAATRLLAH
FT                   RRRRAPRGDDATRASAAQPAAGGPR"
FT   gene            complement(353008..353733)
FT                   /locus_tag="BMA10229_A0323"
FT   CDS_pept        complement(353008..353733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0323"
FT                   /product="general L-amino acid transport system permease
FT                   protein aapQ"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02403"
FT                   /db_xref="GOA:A2S306"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S306"
FT                   /protein_id="ABN02403.1"
FT                   /translation="MDAWLAPKYLMWLWQGFLLTLGLSLAAAVTATLAGFALAIARHAK
FT                   RASPRRAAAAYVVAFRNTPLVVQLLFWYFGVAALLPEPAMAWLNAPHALDVGGLALRWP
FT                   SFEFVAGWLGLSGYTSAFVAEEFQAGLRGVPAGQHHAASALGLSPLQAFRFVVLPQAVR
FT                   IALPPLFGQYMNLIKNSSLTMAIGVAELSYASRQVETETFRTFAAFGVSTVLYVAAVAL
FT                   VEAAAQWTLRRRDRTFAGR"
FT   gene            complement(353735..353938)
FT                   /locus_tag="BMA10229_A0324"
FT   CDS_pept        complement(353735..353938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0324"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03321"
FT                   /db_xref="UniProtKB/TrEMBL:A2S307"
FT                   /protein_id="ABN03321.1"
FT                   /translation="MPCGTLARNAARASARAACASHIHAPRARREGAGGTRANDAIRGA
FT                   QSRDKQSRDKQSAAARAGGPKQ"
FT   gene            complement(353968..354093)
FT                   /locus_tag="BMA10229_A0325"
FT   CDS_pept        complement(353968..354093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0325"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03862"
FT                   /db_xref="UniProtKB/TrEMBL:A2S308"
FT                   /protein_id="ABN03862.1"
FT                   /translation="MKLTVVVNPALNVRGDARGVGRAMPRPTGARAASDACITRA"
FT   gene            complement(354132..354947)
FT                   /locus_tag="BMA10229_A0326"
FT   CDS_pept        complement(354132..354947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0326"
FT                   /product="polar amino acid ABC uptake transporter substrate
FT                   binding protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01427"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A2S309"
FT                   /protein_id="ABN01427.1"
FT                   /translation="MKFKPFATWLLGLSLVAAHAAAHADRLDDIRKAGVLRVATFDSNP
FT                   PFGFVDPRTNRIVGLDVDYAQALADRLGVKLKLQPTNPANRIPFLTSGKVDLVLANFTI
FT                   TDERAKQVDFSVPYFASGQQFLAKKGVLKSADQLNRLRIGADKGTTNEVTLREKYPQAT
FT                   IVAYDDTPFAFAALRAGNVQAITQDGPKLIGLLANVPDKQNYEVPAFSISNDYMGVGAP
FT                   KGEPRLVAFVNETLTDLEASGRAGRIYDAWFGPNTKTPLARIFKIGDKR"
FT   gene            355120..355263
FT                   /locus_tag="BMA10229_A0328"
FT   CDS_pept        355120..355263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0328"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02827"
FT                   /db_xref="UniProtKB/TrEMBL:A2S310"
FT                   /protein_id="ABN02827.1"
FT                   /translation="MPRHDPARHDAVRRGAKHTRGPRVARMRATAAGADVQYARRGATY
FT                   AP"
FT   gene            complement(355227..356258)
FT                   /locus_tag="BMA10229_A0327"
FT   CDS_pept        complement(355227..356258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0327"
FT                   /product="TadE-like protein"
FT                   /note="identified by match to protein family HMM PF07811"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02063"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="InterPro:IPR018705"
FT                   /db_xref="UniProtKB/TrEMBL:A2S311"
FT                   /protein_id="ABN02063.1"
FT                   /translation="MNERRAAFARRRERGAVVLWFVLFLPVLLLFGAFAIDLPRVAAAR
FT                   NELQNAADAAALAGAASLEAGAGAPAWAAAASAAAAALSLNASDGAALSSGDVQTGYWN
FT                   VTGVPAGLEPTTLAPGEYDVPAVQATVTRAPNQNGGPLSLLMGGLLGLVGTPAAATAVA
FT                   VAGAPATVGAGGLFPMVIDQCVLDQYWDARAGAPRVDPTTGAPYEFQVGNGRTYGGTCY
FT                   AGQWTTFLVNANDVPTVRGLMAHGNPTPLSIGDSIWIEPGVKTALYYDVPVGVTVVVPV
FT                   ATQISSKTYVPVVAFAAFYVDASDGANLKAITGHFVGGYKIPASASGIGPAYGAYVAPR
FT                   LAY"
FT   gene            complement(356251..356679)
FT                   /locus_tag="BMA10229_A0329"
FT   CDS_pept        complement(356251..356679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0329"
FT                   /product="TadE-like protein"
FT                   /note="identified by match to protein family HMM PF07811"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02399"
FT                   /db_xref="GOA:A2S312"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:A2S312"
FT                   /protein_id="ABN02399.1"
FT                   /translation="MKRLARLVHDERGVVSLEFVLAFPFMMLVLFGIVDTSLLLCDKAV
FT                   ITNASREAARAGVVVRVPQLAATDITNIALSYAQGSLVSGGTVGAPVVNVDQSAGTSPG
FT                   SPLKVTVSYTYQGLVLGSALSALTGPITLTAVTVMNYE"
FT   gene            complement(356689..357618)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0330"
FT                   /note="putative membrane protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF07719; match to
FT                   protein family HMM PF07721"
FT   gene            complement(357762..358706)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0331"
FT                   /note="Bacterial type II secretion system protein F domain;
FT                   this gene contains a frame shift which may be the result of
FT                   a sequencing error; identified by match to protein family
FT                   HMM PF00482"
FT   gene            complement(358703..359698)
FT                   /locus_tag="BMA10229_A0332"
FT   CDS_pept        complement(358703..359698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0332"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03806"
FT                   /db_xref="GOA:A2S315"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A2S315"
FT                   /protein_id="ABN03806.1"
FT                   /translation="MSAADVVAVGAFFAIVVAGFIVRALRDLARRRPAARVRSRVEALR
FT                   EPRAAARPVAPARASRVGLQLFTRTHGEGEGGALRAWLRARGEHVRTAAGGGGVRAIAF
FT                   ASALAALAGFVGASFAGFAPWLRLALAAALAAGAARAVYRILIGRFKQRFLSVFPDALD
FT                   LIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGADLKDVLEQQAERLQLAD
FT                   FSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALTAEGRIASKIIAAVPFA
FT                   IAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIANLDTSR"
FT   gene            complement(359695..361257)
FT                   /locus_tag="BMA10229_A0333"
FT   CDS_pept        complement(359695..361257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0333"
FT                   /product="CpaF"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01457"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S316"
FT                   /protein_id="ABN01457.1"
FT                   /translation="MFGRRPAASFAPGDAGGAREFVPDAVSAGAGAAPAGGHASAPDAG
FT                   GAARAREPAGASGASAPGGAPQSGVAPSGHRPASRDDRIDRDDGHDRAPAQDHHEALIR
FT                   SETFKTIRAVVFSSMNMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQALIVDEI
FT                   LNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQRIA
FT                   AAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQGNL
FT                   SQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQP
FT                   HVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS
FT                   MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRV
FT                   TEIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSLRPAFAQRAAYYGLEGALLGA
FT                   LQP"
FT   gene            complement(361257..362492)
FT                   /locus_tag="BMA10229_A0334"
FT   CDS_pept        complement(361257..362492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0334"
FT                   /product="putative fimbriae assembly-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03046"
FT                   /db_xref="GOA:A2S317"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S317"
FT                   /protein_id="ABN03046.1"
FT                   /translation="MGAFDRVGGARPVKELRDAAGGARLVAIVADAASDEVIRNLIADQ
FT                   AMTGAQVARGGIDDAIALMRDLSHGPQHLLVDVSGAAMPLSDLARLADVCDPSVNVIVI
FT                   GERNDVGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAARAGKAIGFVGARGGVG
FT                   VTSIAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRLDAQLI
FT                   HQAMVAQSDRLFVLSAELPYDSEAPWRAGAVAGLVGALRHQFHYVLLDLPERAGRLVDE
FT                   ALAACASVYVVADRSVHAAREAARLLHHAQARDGDAHVSLILNNAQQPVRGRVEPADFA
FT                   RAVGRASMLELPYEPQTLAVAENLGAALDAPRGDGFAAGIGALAQGLTGADAAPAARRP
FT                   WYARLAGARGAR"
FT   gene            complement(362503..362916)
FT                   /locus_tag="BMA10229_A0335"
FT   CDS_pept        complement(362503..362916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0335"
FT                   /product="putative liporotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03323"
FT                   /db_xref="InterPro:IPR019027"
FT                   /db_xref="UniProtKB/TrEMBL:A2S318"
FT                   /protein_id="ABN03323.1"
FT                   /translation="MAIRPEHTTRRRASRAVAACAALAALAGCMSGHPPYGMPDASTIG
FT                   YDARTGLARAPDCAALEQRSQMIDAGRARPGVSFGCATYGNLAAMLARPADLVAPLPYA
FT                   GADAALGASAVRRYDEGRATPLNPTSTTTSVTH"
FT   gene            complement(362950..364398)
FT                   /locus_tag="BMA10229_A0336"
FT   CDS_pept        complement(362950..364398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0336"
FT                   /product="putative type II secretion system protein"
FT                   /note="identified by match to protein family HMM PF00263"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00624"
FT                   /db_xref="GOA:A2S319"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:A2S319"
FT                   /protein_id="ABN00624.1"
FT                   /translation="MWSVIDAIGKRRQAASASPRARAFAAGRRAAAAALWWLALALGMA
FT                   VAPRFARAADLGPVLAVPAGGGEMVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKA
FT                   GTTTLFALGANNRTILRETVVVDVDTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPS
FT                   AADADAVVQTLKPYLRQQEALVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGA
FT                   SGNFVGGLFNGRTLFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQEGLITML
FT                   AEPNLTAISGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLK
FT                   VRPEVSEIDPTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELP
FT                   GLARLPVLGKLFSSRNYLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRPSSDIEFVL
FT                   QRSLGIDPLGGDAPRLAGPAGFVY"
FT   gene            complement(364433..365485)
FT                   /locus_tag="BMA10229_A0337"
FT   CDS_pept        complement(364433..365485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0337"
FT                   /product="Flp pilus assembly CpaB"
FT                   /note="identified by match to protein family HMM PF08666;
FT                   match to protein family HMM TIGR03177"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03861"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:A2S320"
FT                   /protein_id="ABN03861.1"
FT                   /translation="MSHFLKLAGLMLVAVVGAFLFRALYVAASQPRPAAPPQQVRVRVA
FT                   AADLPAGLLLRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPKTD
FT                   LKGDLLRHPVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGD
FT                   YVDVLLTQQLAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTV
FT                   TFEVSSRDAQVITVGAHLGALSLALRSFATSDRGAVGTAPAEPPAPPVWAGDVSRALRA
FT                   QAPAEAPAQPRRVGAARAQAERRVIVYRGSKQDDAASAGTPLPGGVPPIPTLPPLPGAA
FT                   APPAGARPAA"
FT   gene            complement(365498..365977)
FT                   /locus_tag="BMA10229_A0338"
FT   CDS_pept        complement(365498..365977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0338"
FT                   /product="putative fimbriae assembly-related protein"
FT                   /note="identified by match to protein family HMM PF01478"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00662"
FT                   /db_xref="GOA:A2S321"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:A2S321"
FT                   /protein_id="ABN00662.1"
FT                   /translation="MILPLKLVASWTLASLALADLRTRRLATFAVALVGALYAALALVG
FT                   APGDGGFASHAALGAAAFALGAAMFRAGWIAGGDVKLAAVVFLWAGPAHAWPVAFAIGV
FT                   GGLAVGAVCIAAGRAPRVLAWFAPARGVPYGVALAAGGLLAVWAPAACRLPGCLG"
FT   gene            complement(366042..366233)
FT                   /locus_tag="BMA10229_A0339"
FT   CDS_pept        complement(366042..366233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0339"
FT                   /product="putative fimbriae assembly-related protein"
FT                   /note="identified by match to protein family HMM PF04964"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01971"
FT                   /db_xref="GOA:A2S322"
FT                   /db_xref="UniProtKB/TrEMBL:A2S322"
FT                   /protein_id="ABN01971.1"
FT                   /translation="MLRFIQSLWRDERGVSALEYSVLAGIVVVAVAAAGAIFGGGSGLP
FT                   ELFQNMITKVTSVQTNGH"
FT   gene            complement(366809..367750)
FT                   /locus_tag="BMA10229_A0340"
FT   CDS_pept        complement(366809..367750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0340"
FT                   /product="permease"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02924"
FT                   /db_xref="GOA:A2S323"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S323"
FT                   /protein_id="ABN02924.1"
FT                   /translation="MRDEYELALAPAASIDAIAPAAGIAAARAGDPAAGAGECGRAAPL
FT                   ARLYARLGVRRLRDAQWLRKTALALALIAAWEIVARVVDDDLLLPSFGATALAFAHGVA
FT                   NGELPAKIAVSLSMLLRGYALGVALAFALTALAATTRLGRDLLTMLTAMFNPLPSIALL
FT                   PLALLWFGLGTGSLLFVLVHAVLWPLALSTFAGFQAVPATLRMVGRNYGLTGVRHVVAI
FT                   LVPAALPSILAGLKVAWAFAWRTLIAAELVFGASAGGGGLGWYIFQNRNELYTDRVFAG
FT                   LAAVIAIGLVVEHGVFDALERVSVKRWGAHTL"
FT   gene            complement(367777..368607)
FT                   /locus_tag="BMA10229_A0341"
FT   CDS_pept        complement(367777..368607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0341"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system ATPase component"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02103"
FT                   /db_xref="GOA:A2S324"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S324"
FT                   /protein_id="ABN02103.1"
FT                   /translation="MAAEPSTLFSNPADAHACATSGKLVRVDRVTLEYRHRERVVRATQ
FT                   QVSFDVYGADRFVLLGPSGCGKSTLLKAIAGFVAPVEGAITLAGEPVRGPGADRIVVFQ
FT                   EFDQLAPWKTVRENVAFALRAARRLSRRDAAERSRAALDKVGLAAFADAYPHTLSGGMK
FT                   QRVAIARALAMEPRVLLMDEPFAALDALTRRRMQHELLRLWDDARFTLLFVTHSIEEAL
FT                   VIGNRVLLLSPHPGRVRAELNSHHFDERSVGRADFQRTAERIQRLLFDESGARA"
FT   gene            complement(368702..369025)
FT                   /locus_tag="BMA10229_A0342"
FT   CDS_pept        complement(368702..369025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0342"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02427"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:A2S325"
FT                   /protein_id="ABN02427.1"
FT                   /translation="MHGMHGIHGIHGIHGIHGIHGIHGIHGIHGIHGIHGIHGIHGMRW
FT                   TRGRRGSSARHDMATRAAAPAVDAATRRDDDVAPMRRQCGAHDIDIENASLCRAATHLN
FT                   LDP"
FT   gene            complement(369077..370123)
FT                   /locus_tag="BMA10229_A0343"
FT   CDS_pept        complement(369077..370123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0343"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03232"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A2S326"
FT                   /protein_id="ABN03232.1"
FT                   /translation="MTRASSLGRRSLSLTAALAVLVAALAAASLVAAPAARAEGRIRVA
FT                   EQFGIVYLLLNVARDRHLIEQAGRAEGIAIDVDWVKLSGGAAINDALLSGSIDIAGAGV
FT                   GPLLTIWDRTRGRQNVKGVASLGNLPYYLVSNDPRVKTIADFTARERIAVPAVTVSVQS
FT                   RLLQFAAAQRWGDRAYDRLDKLTQAVAHPDAAAAIIAGRTELTAHFGNPPFQEQELAAN
FT                   PNAHIVLSSYDVLGGPSSATVLYATERFRRDNPKTYRAFVAALGQAARYVQTNPEGAVD
FT                   AYLRVNGSKADRALLLKIVRNPQVQFRIAPQNTFALAAFMHRVGAIRHEPKTWRDYFFD
FT                   DPATAQGS"
FT   gene            complement(370376..371680)
FT                   /locus_tag="BMA10229_A0344"
FT   CDS_pept        complement(370376..371680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0344"
FT                   /product="alpha-ketoglutarate permease"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00883"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00838"
FT                   /db_xref="GOA:A2S327"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2S327"
FT                   /protein_id="ABN00838.1"
FT                   /translation="MNDQTAVAAAARQDVRRRVLAIVGASSGNLVEWFDFYIYSFCALY
FT                   FAPAFFPSGNTTTQLLNTAGVFAAGFLMRPIGGWLFGRIADKHGRRAAMMISVLMMCGG
FT                   SLVIAVLPTYAQIGALAPLLLLVARLFQGLSVGGEYGTSATYMSEVALQGRRGFFASFQ
FT                   YVTLIGGQLCALLVLVILQQTLSSDALKAWGWRIPFVVGAAAALISLYLRKSLDETSTS
FT                   ESRKAKDAGTIRGVWQHKGAFLTVVGFTAGGSLIFYTFTTYMQKYLVNTAGMHAKTASN
FT                   VMTAALFVYMLMQPVFGALSDKIGRRMSMILFGTGAVIGTVPLMHALGGVTSPLVAFGL
FT                   IVVALAIVSFYTSISGLIKAEMFPPEVRAMGVGLSYAVANAIFGGSAEYVALWFKSVGS
FT                   ESSFYWYVTVLCAISLLVSWRMRDPSREGYLRNEP"
FT   gene            complement(372150..373832)
FT                   /locus_tag="BMA10229_A0345"
FT   CDS_pept        complement(372150..373832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0345"
FT                   /product="stage V sporulation protein R"
FT                   /note="identified by match to protein family HMM PF04293"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03876"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S328"
FT                   /protein_id="ABN03876.1"
FT                   /translation="MTTRHLHNEARGYEPRRRSDEASGAAAHERDASPEAAAQHPEAPA
FT                   SGLKEARMNVADRKPLPCPSDWTFELIEEYDTHISQVAEQYELDIYPIQLELISAEQMM
FT                   DAYASVGMPVNYRHWSFGKHFLSTEKSYRRGQMGLAYEIVINSNPCIAYLMEENTMTMQ
FT                   ALVIAHAAYGHNSFFKGNYLFRLWTDAHAIIDYLVYAKNYVAECEERYGLDRVEELLDS
FT                   CHALMNYGVDRYKRPQKPSLAKESELRREREAYLQSQVNELWRTLPAKKPEFADEEQEE
FT                   RYPPEPQENLLYFAEKNAPFLEPWEREVIRIVRKIGQYFYPQRQTQVMNEGWATFWHYT
FT                   LLNTMYNQGKLADGFMMEFLHSHSNVIYQPPVTKPYYSGINPYALGFSMMSDIRRICEA
FT                   PTEEDHKWFPELAGSPWLPALHYAMRNFKDESFIAQYLSPHLIREMRLFSVLDDDMRDA
FT                   LEVSAIHDDSGYQYVRQALSRQYDIHHREPNIQVWSVNTRGDRSLTLRHFMTDNRHLSN
FT                   DSEEVLKHMARLWQFDVYLESVDETGTVRKRYECRYTAPEIRL"
FT   gene            complement(373832..375097)
FT                   /locus_tag="BMA10229_A0346"
FT   CDS_pept        complement(373832..375097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04285"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01032"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A2S329"
FT                   /protein_id="ABN01032.1"
FT                   /translation="MLHQIIDRRLAGKNKSIANRERFLRRVKNYIRRAVSDAVRDRSIK
FT                   DIQSTQSITIPRKDIAEPTFRHGPGGKRELVHPGNADYVRGDKIPRPPGGAGGGGSQAS
FT                   NEGEGQDDFVFELSREEFMQYFFDDLELPRLVKTHLLTVPSWKNVRAGWAAEGTPNNID
FT                   VVRSLRSALGRRIALGSPFVNELRELEEKLVALKDEPGDHRVEIAQLEDAIHHLKGRIW
FT                   RIPFIDPFDLRYVNRVKMPQPSSQAVMFCLMDVSGSMDEQRKDLAKRFFILLYLFLKRN
FT                   YERIEVVFIRHHTRAEEVDEDTFFHSTESGGTVVSSALELMRKVMEERYSPTEWNIYGA
FT                   QASDGDNWTDDSPKCRKILDEDILTKVRYFAYIQVTPEEQNLWLEYAQLALSQPHLAMK
FT                   KVESAADIYPVFRELFEKHVET"
FT   gene            complement(375221..377143)
FT                   /locus_tag="BMA10229_A0347"
FT   CDS_pept        complement(375221..377143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0347"
FT                   /product="non-specific serine/threonine protein kinase"
FT                   /note="identified by match to protein family HMM PF06798;
FT                   match to protein family HMM PF08298"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01992"
FT                   /db_xref="GOA:A2S330"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S330"
FT                   /protein_id="ABN01992.1"
FT                   /translation="MDIYSSFANRFEKTREEEFSLEEYLALCKNDPSAYAAAGERMLEA
FT                   IGEPEQIDTRNDPRLSRIFANKVIKVYPAFREFYGMEEVIEQVVAYFRHAAQGLEEKKQ
FT                   ILYLLGPVGGGKSSIAERLKQLMERVPFYALKGSPVNESPLGLFDYDEDGPILEEQYGI
FT                   PRRYLKSILSPWAVKRLHEYNGDIRRFRVVRRYPSILRQIGIAKTEPGDENNQDISSLV
FT                   GKVDIRKLEQYAQDDADAYSYSGGLCLANQGLLEFVEMFKAPIKVLHPLLTATQEGNFK
FT                   GTEGFGAIPFDGIILAHSNESEWKAFRNNRNNEALLDRIFVVKVPYCLRVSEEIKIYEK
FT                   LIRNSSLAEAVCAPGTLKMMAQLSVLTRLHEPENSSLFSKMQVYDGENLKDTDPKAKSY
FT                   QEYRDYAGVDEGMTGVSTRFAFKILSRVFNFDSTEVAANPVHLMYVLEQQIEREQFPPE
FT                   TEQKYLSFVKDLLASRYAEFIGKEIQTAYLESYSEYGQNIFDRYVTYADFWIQDQEFRD
FT                   HDTGESFDRAALNAELEKIEKPAGISNPKDFRNEIVNFVLRARAANGGKNPAWVSYEKL
FT                   RVVIEKKMFSNTEELLPVISFNAKGSAEEQRKHEDFVNRMVAKGYTPKQVRLLCDWYLR
FT                   VRKSS"
FT   gene            complement(377348..378181)
FT                   /locus_tag="BMA10229_A0348"
FT   CDS_pept        complement(377348..378181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0348"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02497"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABN02497.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(378205..378468)
FT                   /locus_tag="BMA10229_A0349"
FT   CDS_pept        complement(378205..378468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0349"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03453"
FT                   /db_xref="GOA:A2RW75"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW75"
FT                   /protein_id="ABN03453.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            complement(378905..379831)
FT                   /locus_tag="BMA10229_A0350"
FT   CDS_pept        complement(378905..379831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0350"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00752"
FT                   /db_xref="GOA:A2S333"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037423"
FT                   /db_xref="UniProtKB/TrEMBL:A2S333"
FT                   /protein_id="ABN00752.1"
FT                   /translation="MNFQQLRFVREAVRQNMNLTEVANVLYTSQSGVSKQIKDLEDELG
FT                   VDIFIRRGKRLTGLTEPGKAVHQLIERMLLDAENLRRVARQFADQDSGHLVVATTHTQA
FT                   RYALPKVIRQFTEVYPKVHLALRQGSPQQIAQMILNGEADLGISTEALDRFPDIVTFPC
FT                   YSWHHVVVVPKGHPLVGRENVTLDDIAEYPIITYDQDFTGRSHIDQAFANAGAVPDVVL
FT                   TAIDADVIKTYVELGMGIGVVAAMAYDAQRDTGLVALDTQHLFEASTTRVGLRRGAFLR
FT                   AYAYRLIEMFAPHLSEGEIAGQLREAA"
FT   gene            complement(379901..380956)
FT                   /gene="cysA"
FT                   /locus_tag="BMA10229_A0351"
FT   CDS_pept        complement(379901..380956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="BMA10229_A0351"
FT                   /product="sulfate/thiosulfate ABC transporter, ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.25"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF03459; match to protein
FT                   family HMM PF08402; match to protein family HMM TIGR00968"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03601"
FT                   /db_xref="GOA:A2S334"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S334"
FT                   /protein_id="ABN03601.1"
FT                   /translation="MGITVRNLHKRFGEFAALDDVSLDFPAGELVALLGPSGCGKTTLL
FT                   RVIAGLEHADSGQVVLQGLDVASVGARERQVGFVFQHYALFRHMTVFENVAFGLRVKPR
FT                   RERPSEAAIRAKVHELLSLVQLDWLAQRYPSELSGGQRQRIALARALAVEPKVLLLDEP
FT                   FGALDAKVRKELRGWLRRLHDDLHISTIFVTHDQEEALEVADRIVVLNHGRVEQVGSPQ
FT                   AVYDHPRSAFVYEFLGAANRLDGTVSGNGFVAHGAAQAIAVDADFAGPARAYVRPHDLE
FT                   LAAPHARAQGIAADVRRVVPLGGSVRVELAARSGEVLEAELDRNAWRALALDVGDALTA
FT                   VPRAVRVFPAR"
FT   gene            complement(380970..382016)
FT                   /gene="cysW"
FT                   /locus_tag="BMA10229_A0352"
FT   CDS_pept        complement(380970..382016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="BMA10229_A0352"
FT                   /product="sulfate/thiosulfate ABC transporter, permease
FT                   protein CysW"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00969; match to protein
FT                   family HMM TIGR02140"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01030"
FT                   /db_xref="GOA:A2S335"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S335"
FT                   /protein_id="ABN01030.1"
FT                   /translation="MSRDTARSRAGAARADAGPEFGARFGLESGLESGLESGDDARRAA
FT                   RAPARARRLDPVSEPRAVRWLLTGAALAFLALFLVVPLAAVFFEALRKGVDFYLESLAD
FT                   PDAWSAIKLTLVVAAIAVPLNLVFGVCASWAIAKFEFKGKAVLTTLIDLPFSVSPVISG
FT                   LVYVLLFGAQGWLGPWLQAHDVQIIFAVPGIVLAAIFVTFPFVARELIPLMQAQGADEE
FT                   EAARVLGASGWQIFRRVTLPNVKWGLLYGVILCNARAMGEFGAVSVVSGHIRGQTDTMP
FT                   LHVEILYNEYNFAAAFAVASVLALLALVTLALKLFAERRLSAELAHGRDDASAPAAHPG
FT                   AAVTSSIS"
FT   gene            complement(382013..382906)
FT                   /gene="cysT"
FT                   /locus_tag="BMA10229_A0353"
FT   CDS_pept        complement(382013..382906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="BMA10229_A0353"
FT                   /product="sulfate/thiosulfate ABC transporter, permease
FT                   protein CysT"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00969; match to protein
FT                   family HMM TIGR02139"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03561"
FT                   /db_xref="GOA:A2S336"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S336"
FT                   /protein_id="ABN03561.1"
FT                   /translation="MTTFTFRKPSALPGFGVTLGITLAYLSLVVLIPLAATFLKTATLT
FT                   WDQFVAATTSPRVLASYRLTFSAALGGALVNAVFGFLVAWVLVRYTFPLKRLVDAIVDL
FT                   PFALPTSVAGISLAAVYAQNGWIGRYLAPLGIKVAFTPFGVLVALTFIGLPFVVRTVQP
FT                   VLEDFEREQEEAAACLGASRWLTFRRVVLPAVTPALLTGFALAFARALGEYGSVIFIAG
FT                   NVPMKSEITSLLIITKLEQYDYAGATALAVVMLVVSFVMLLLINTLQWYLQRRTSRGAS
FT                   GPTPAAHAATALGGAQ"
FT   gene            complement(383039..384076)
FT                   /gene="sbp"
FT                   /locus_tag="BMA10229_A0354"
FT   CDS_pept        complement(383039..384076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="BMA10229_A0354"
FT                   /product="sulfate/thiosulfate ABC transporter,
FT                   sulfate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01259"
FT                   /db_xref="GOA:A2S337"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A2S337"
FT                   /protein_id="ABN01259.1"
FT                   /translation="MVKRNTGLAGGARRLIASLALGAAAALGALTPALADTTFLNVSYD
FT                   PTRELYQDVNQAFGKEWKARTGETVNFKQSHGGSGAQARSVLDGLQADVVTLALAYDID
FT                   ALANKGLVSKDWQKRLPDNASPYTSTIVFLVRKGNPKGIKDWDDLVKPGVSIVTPNPKT
FT                   SGGARWNYLAAWAYAQHQPGGTAQTAKDFVTKLYRNAGVLDSDARGATTSFVQRGIGDV
FT                   LIAWENEAFLSIKEFGADKFEIVVPSASILAEPPVAVVDKVVDKKGTRKLADAYLNFLY
FT                   SRQGQEIAARNYYRPRSRDVPAALTKQFPKLKLYTVDDTFGGWTQAQKTHFADGGVFDS
FT                   IYKPQ"
FT   gene            complement(384240..384356)
FT                   /locus_tag="BMA10229_A0355"
FT   CDS_pept        complement(384240..384356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01580"
FT                   /db_xref="UniProtKB/TrEMBL:A2S338"
FT                   /protein_id="ABN01580.1"
FT                   /translation="MICIFIQYRGKFKRYLKFGAIAAIPPRFGCVEATLRTR"
FT   gene            384379..385026
FT                   /gene="lexA"
FT                   /locus_tag="BMA10229_A0356"
FT   CDS_pept        384379..385026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="BMA10229_A0356"
FT                   /product="repressor LexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="identified by similarity to SP:P0A7C2; match to
FT                   protein family HMM PF00717; match to protein family HMM
FT                   PF01726; match to protein family HMM TIGR00498"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02361"
FT                   /db_xref="GOA:A2S339"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S339"
FT                   /protein_id="ABN02361.1"
FT                   /translation="MIKLTARQQQVFDLIRRAIERSGFPPTRAEIAAELGFSSPNAAEE
FT                   HLRALARKGVIELAAGASRGIRLLGIDDAPHQLTLPHAALMQLSLPLVGRVAAGSPILA
FT                   QEHISQHYACDPALFSSKPDYLLKVRGLSMRDAGILDGDLLAVQKRTEAKDGQIIVARL
FT                   GDDVTVKRLKRRPGGVELIAENPDYENIFVKAGSAEFALEGIAVGLIRPGEF"
FT   gene            385089..385415
FT                   /locus_tag="BMA10229_A0357"
FT   CDS_pept        385089..385415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03491"
FT                   /db_xref="UniProtKB/TrEMBL:A2S340"
FT                   /protein_id="ABN03491.1"
FT                   /translation="MERLARLLPFRQFGRLRHLRGRTPCAPLVAAHSRDHADTQPSLLP
FT                   SALPAFARVSLNGSLHHAEPARRAPVRVYHGPSRFIMVGTVDAICRMIDRCIAEERSLT
FT                   QQGL"
FT   gene            385449..386183
FT                   /locus_tag="BMA10229_A0358"
FT   CDS_pept        385449..386183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00911"
FT                   /db_xref="GOA:A2S341"
FT                   /db_xref="InterPro:IPR021330"
FT                   /db_xref="UniProtKB/TrEMBL:A2S341"
FT                   /protein_id="ABN00911.1"
FT                   /translation="MNSIARPRGRFLKPVAIGIALIVVAAVALYAYASPYLALRQMKQA
FT                   IDARDAQAISVHVDFPALRISLKQQLTDELMRRIDAQKRDNPLAILGAMIGSALVDPLV
FT                   DAYATPDGVAALMSGLPPHARPGQRPPELNPPSDPASAAAAGTGAPPSNAGVPGSASGA
FT                   AKQTASAAAASTSGASGTSGTPPGAPSATPGPSPQTSAGYRGFDEFVVTYRSDDGSARY
FT                   AAVFRRSGIFGWKLSAIDLHDD"
FT   gene            complement(386601..387092)
FT                   /locus_tag="BMA10229_A0359"
FT   CDS_pept        complement(386601..387092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0359"
FT                   /product="universal stress family protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01141"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A2S342"
FT                   /protein_id="ABN01141.1"
FT                   /translation="MASYKKILLCYDGTLEGRKALRCGADLALELKAETHLLSVVDMRS
FT                   SIAQSAGLLTDVACSRFEETAREILQEGVNWLTERGVHAQGHFAFGYPIDEIANLATKL
FT                   NVDLVVVGHRCRSGLSRWWMGAGNTQLLDRVSCSILVACASPAEQKAESAKEGAATIGH
FT                   "
FT   gene            387181..388236
FT                   /gene="nodI"
FT                   /locus_tag="BMA10229_A0360"
FT   CDS_pept        387181..388236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodI"
FT                   /locus_tag="BMA10229_A0360"
FT                   /product="nodulation ABC transporter NodI"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01288"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01851"
FT                   /db_xref="GOA:A2S343"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005978"
FT                   /db_xref="InterPro:IPR015851"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S343"
FT                   /protein_id="ABN01851.1"
FT                   /translation="MHRERAMIHHRKQRHQRRDEASALKRCGRCTRMARSCRTIPIESH
FT                   LPMSVAPIDFQQVEKRYDDKLVVDGLSFHVQPGECFGLLGPNGAGKTTTLKMLLGITHP
FT                   DAGSISLCGEPVPSRARHARQRVGVVPQFDNLDPDFTVRENLLVFARYFGLTAHAARAL
FT                   VPPLLEFAKLESKADAKVGELSGGMKRRLTLARALVNDPDVLVLDEPTTGLDPQARHLM
FT                   WERLRSLLARGKTILLTTHFMEEAERLCHRLCVIEEGRKIAEGAPRMLIEAEIGCDVIE
FT                   IYGPDPVQLRDELAPFAERTEISGETLFCYVDNPEPIHARLKGRAGLRYLHRPANLEDV
FT                   FLRLTGREMLD"
FT   gene            388241..389077
FT                   /gene="nodJ"
FT                   /locus_tag="BMA10229_A0361"
FT   CDS_pept        388241..389077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodJ"
FT                   /locus_tag="BMA10229_A0361"
FT                   /product="ABC transporter, permease NodJ"
FT                   /note="identified by match to protein family HMM PF01061;
FT                   match to protein family HMM TIGR01291"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03144"
FT                   /db_xref="GOA:A2S344"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR005981"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A2S344"
FT                   /protein_id="ABN03144.1"
FT                   /translation="MDTRHYTPSPTLAARRRESAFALALPANATNWIAVWRRNYLVWQK
FT                   LAIASMFGNLADPMIYLFGLGLGLGLMVGHVEGVSYIAFLAAGTVGSSVMISASFESMY
FT                   SGFSRMHVQRTWEAIMHTPLSLGDIVLGEIVWAASKAMLSGAAIMLVAGVLGYAKFPSM
FT                   LVALPVIALAGIAFASLAMIVTALAPSYDFFMFYQTLALTPMLLLSGVFFPLAQLPEFA
FT                   QHIAHALPLSNAVDLIRPAMLDRPATDVARHVAILAAYALGGFFVCARLFRRRMMR"
FT   gene            complement(389156..389578)
FT                   /locus_tag="BMA10229_A0362"
FT   CDS_pept        complement(389156..389578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0362"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02445"
FT                   /db_xref="UniProtKB/TrEMBL:A2S345"
FT                   /protein_id="ABN02445.1"
FT                   /translation="MTQHKVHPRLEQALTRGDLAIRQVNSTRATAVLNALGKMIVEASA
FT                   TIGVEASIDIAQGERVYDPVNGVWPQKMLVSFDGPVEDADPEELRTVYLLADDPGTMFR
FT                   VEWHRADGKLGRQEGGPLATVAFLTDVEMPWSDDDE"
FT   gene            complement(389893..390954)
FT                   /locus_tag="BMA10229_A0363"
FT   CDS_pept        complement(389893..390954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0363"
FT                   /product="putative transporter"
FT                   /note="identified by match to protein family HMM PF03773"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01155"
FT                   /db_xref="GOA:A2S346"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A2S346"
FT                   /protein_id="ABN01155.1"
FT                   /translation="MSSSRSYTPHPALGLATFVVLAVAGLFYVKWFPYYHKAFAAAEHH
FT                   SIGQSILMGAAAHAPQPSLQAALDYAWAYGKAIWQAMVLGLLLGSAVQALLPAHWVARA
FT                   LGGTGFGSVAAGGLLALPGMMCTCCAAPVVAGLRERDASPGGALAFWLSNTVLNPAALV
FT                   FMGFVLGWHWSALRLVLGVAMVFGVGYLVNRLAGAQPRVVDDALRAKLVAEQAAVGNAF
FT                   VRWMKIFARMTVRLVPEYLVLVLLLGAARAWLFPHIGPDIGNGVGWIVAFAIAGMLFVI
FT                   PTAGEVPIIQAMLSLGMGVGPAGALLMTLPPVSVPSLAMLARSFKPATLALVAALVVAF
FT                   GVVGGLAAVALGF"
FT   gene            complement(391310..392362)
FT                   /locus_tag="BMA10229_A0364"
FT   CDS_pept        complement(391310..392362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0364"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03740"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A2S347"
FT                   /protein_id="ABN03740.1"
FT                   /translation="MEYRTLGDSGVKVSLIGLGTMTWGEQNTESDAHAQLDYAIDQGVT
FT                   LIDTAEMYPVPPKAQTQGRTETYLGTWLAKHPALREKLTIATKIAGPARQPHNPTHIRG
FT                   AGNQFDRKNLTEALDGSLARLRTDYVDLYQLHWPDRSTTTFGRPAYPWIDDPYTVPIEE
FT                   TLAVLGDFVKAGKVRHVGVSNETPWGVAQFLRAAEKLGLPRIVSIQNPYSLLNRTFENG
FT                   LSEFSHRERIGLLAYSPLAFGSLSGKYEGGARPEGARITRFERFQRYSKPHAVQATSRY
FT                   VALAKRHGLSPAQLALAFVNSRPFVTSNLIGATSLAQLRENVASVDVKLAPEILAEIDA
FT                   LHEQQPNPAP"
FT   gene            complement(392638..393075)
FT                   /locus_tag="BMA10229_A0365"
FT   CDS_pept        complement(392638..393075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00369"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03447"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A2S348"
FT                   /protein_id="ABN03447.1"
FT                   /translation="MNPLSMSGLELLRAAAAGDLPAASIAETIPMRPESVELGYVKMIA
FT                   RADGRHLNPLGGVHGGFAATVLDSVTGCAVHTMLDPGVGYGTVDLHVKMLRPVPRDVDL
FT                   VAEGRVIHLSRNLGVAEGTLKTPDDKVVAHASATCFIQRPA"
FT   gene            393257..393733
FT                   /locus_tag="BMA10229_A0366"
FT   CDS_pept        393257..393733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0366"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01638"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02706"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S349"
FT                   /protein_id="ABN02706.1"
FT                   /translation="MKWDDVGSMPCSVARTLAVLGDRWTMLILRNAFLGHRRFEAFQTQ
FT                   LGLTRHVLAERLARLVDEGIFTKRAYQDRPPRFEYRLSQKGLDLYPVLLALAAWGDRWK
FT                   DDGNGPPVVLRHRRCAHVMHPVMVCSECGEPIDPREVEPMPGPGWTKQQADKVD"
FT   gene            393955..394179
FT                   /locus_tag="BMA10229_A0367"
FT   CDS_pept        393955..394179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0367"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01552"
FT                   /db_xref="UniProtKB/TrEMBL:A2S350"
FT                   /protein_id="ABN01552.1"
FT                   /translation="MPAKALARIRRIALAEPYMRSRQRLMQPDAFGIRMAATSTAPDAR
FT                   RVRHIGCAANSSHERQGGRAAASALLPPA"
FT   gene            complement(394282..394677)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0368"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            394916..396223
FT                   /locus_tag="BMA10229_A0369"
FT   CDS_pept        394916..396223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0369"
FT                   /product="sodium:dicarboxylate symporter family protein"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02092"
FT                   /db_xref="GOA:A2S352"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A2S352"
FT                   /protein_id="ABN02092.1"
FT                   /translation="MKKRRNITSYIVIAMILGIAVGYGCHSAFPDPAIAKEIAGYVSLL
FT                   SDVFLRLIKMIIAPLVFATLTVGIAHMGDTGAVGRVGVKALGWFFIASFTSLLLGLLAA
FT                   TLLQPGSHLSLPLPATDAAVNLKTSAFTLKDFVIHLVPKSIAEAMANNEILQIVVFSIF
FT                   FGTALSALGDAGKRLTGVIEDLAQVMLKVTGAVMWFAPVAVFAALASTITTEGLGILLT
FT                   FAKFMGSFYIALALLWGVLTLAGLVFLGKRTFTLIRLIREPFLLSFATASSEAAYPKLL
FT                   DALDRFGVNRKISSFVLPIGYSFNLDGSMMYCTFAVLFIAQVYGVHLPLGTQITMLLLL
FT                   MLTSKGMAGVPRASLVVIAATLNQFHLPEAGLLLIMGVDMFLDMGRSATNAVGNSIAAA
FT                   VVAKWEGQLDAPRDDADSDSDGGDASRGSPRITQRV"
FT   gene            complement(396464..396598)
FT                   /locus_tag="BMA10229_A0370"
FT   CDS_pept        complement(396464..396598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0370"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01352"
FT                   /db_xref="UniProtKB/TrEMBL:A2S353"
FT                   /protein_id="ABN01352.1"
FT                   /translation="MPRTLPTGRAPSVFTSMRRARSVRRRGVHDSGSRCRRGNAAAAD"
FT   gene            396812..397831
FT                   /gene="dusA"
FT                   /locus_tag="BMA10229_A0371"
FT   CDS_pept        396812..397831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="BMA10229_A0371"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF01207;
FT                   match to protein family HMM TIGR00742"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00939"
FT                   /db_xref="GOA:A2S354"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A2S354"
FT                   /protein_id="ABN00939.1"
FT                   /translation="MSASPALSPRRVSVAPMMDWTDRHCRSFHRTISRHAWLYTEMVTT
FT                   GALIHGDVARHLAFTPDEAPVALQLGGSEPADLAHSAKLGERWGYDEINLNCGCPSERV
FT                   QRGAFGACLMNEPQLVADCVKAMRDAVSIPVTVKHRIGVDAVEDYAFVRDFVGTVAAAG
FT                   CDVFVVHARNAILKGLSPKENREIPPLKYDYAYRLKRDFPQIEIVINGGVTTLDEVEQH
FT                   LRHVDGVMLGREAYHNPYVLAGIDARFYGASAPAPTREEVEAKLVEYCAAELARGTYLG
FT                   AIVRHALGLYRGVAGARGWRRVLSDNKRLGRGDLSIFDEARTHLPRPEEFFEKKALQS"
FT   gene            397904..397979
FT                   /locus_tag="BMA10229_A0372"
FT   tRNA            397904..397979
FT                   /locus_tag="BMA10229_A0372"
FT                   /product="tRNA-His"
FT   gene            398558..399325
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0373"
FT                   /note="ISBma1, transposase, interruption-N; this gene model
FT                   represents a disrupted reading frame with multiple genetic
FT                   anomalies; identified by match to protein family HMM
FT                   PF01610"
FT   gene            complement(399370..400203)
FT                   /locus_tag="BMA10229_A0374"
FT   CDS_pept        complement(399370..400203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0374"
FT                   /product="IS1404 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01886"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABN01886.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(400227..400490)
FT                   /locus_tag="BMA10229_A0375"
FT   CDS_pept        complement(400227..400490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0375"
FT                   /product="Transposase subfamily"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01739"
FT                   /db_xref="GOA:A2RW75"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW75"
FT                   /protein_id="ABN01739.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            400621..401016
FT                   /locus_tag="BMA10229_A0376"
FT   CDS_pept        400621..401016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0376"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03762"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:A2S357"
FT                   /protein_id="ABN03762.1"
FT                   /translation="MLLRNRHNLKPEQAVHLKELLAANQSLLCVYVLRDELKRLWFYRK
FT                   PACAEKAWGQWFEQAQQSGIAALQKFAQRLQGYWHGIVARCRHPLNTSVVEGINNTIKV
FT                   IKRRAYGYRDEQYFFLKIRAAFPGIPR"
FT   gene            complement(401344..401598)
FT                   /locus_tag="BMA10229_A0377"
FT   CDS_pept        complement(401344..401598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0377"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02928"
FT                   /db_xref="UniProtKB/TrEMBL:A2S358"
FT                   /protein_id="ABN02928.1"
FT                   /translation="MEPKGRDISDFGEPYKGYDIEVKTEQVWAGEKAHYRVLQGGAVMI
FT                   DWRLVHIDGLLLSERRVIEQTLAVARSAVDRELLGAGVV"
FT   gene            complement(401672..401869)
FT                   /locus_tag="BMA10229_A0378"
FT   CDS_pept        complement(401672..401869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0378"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03866"
FT                   /db_xref="UniProtKB/TrEMBL:A2S359"
FT                   /protein_id="ABN03866.1"
FT                   /translation="MFPTLSPEAIEALKWIDQFGSGRPLPVGFRLALEELLNDGFVYQS
FT                   GPDRVDITDDGKAYLSEAYD"
FT   gene            complement(401999..402214)
FT                   /locus_tag="BMA10229_A0379"
FT   CDS_pept        complement(401999..402214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0379"
FT                   /product="putative molybdenum-pterin binding protein"
FT                   /note="identified by match to protein family HMM PF03459;
FT                   match to protein family HMM TIGR00638"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02932"
FT                   /db_xref="GOA:A2S360"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:A2S360"
FT                   /protein_id="ABN02932.1"
FT                   /translation="MSITAINVRNQFRGKVKEIIRGPVVSEVDVDTPFGIVTSVITTRS
FT                   VDELELKVGAEVVALVKSTEVSIARL"
FT   gene            complement(402303..403310)
FT                   /gene="ssuB"
FT                   /locus_tag="BMA10229_A0380"
FT   CDS_pept        complement(402303..403310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB"
FT                   /locus_tag="BMA10229_A0380"
FT                   /product="aliphatic sulfonate ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01521"
FT                   /db_xref="GOA:A2S361"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S361"
FT                   /protein_id="ABN01521.1"
FT                   /translation="MTGTTLAATYGPISGADLEAELAQPRIADGDAQDAAVYERDGGAR
FT                   ALPFASGGAPPDGDRADVRRAAGAGDASVRLTRVSKRYGERAVLADVDLSIGRGSFVSI
FT                   VGRSGCGKSTLLRLVAELETPSAGTLVKRGDGGGALDTRIMYQEARLLPWKTVLQNVML
FT                   GLGRRAKDDARAVLDEVGLLARANDWPAQLSGGQRQRVALARALVHRPQLLLLDEPLGA
FT                   LDALTRIEMHALIERLWREHRFTALLVTHDVQEAVALADRVLLIEAGRIAFDQRVPLDR
FT                   PRARASAAFAALEDRVLQRVLTGSDAAPAAPNAAGPEGASRGRAAPASGLRWAV"
FT   gene            complement(403307..404128)
FT                   /gene="ssuC"
FT                   /locus_tag="BMA10229_A0381"
FT   CDS_pept        complement(403307..404128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuC"
FT                   /locus_tag="BMA10229_A0381"
FT                   /product="aliphatic sulfonate ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01320"
FT                   /db_xref="GOA:A2S362"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S362"
FT                   /protein_id="ABN01320.1"
FT                   /translation="MTTTHSRAHFAARRAAGRAARAVAPWLVPLVLVLAWEFAARAGAL
FT                   SSRVLPEPLAVVRAAWALVESGDMWANVKVSTWRALVGFAIGGGVGLALGLATGLSKAA
FT                   EVALDSTIQMIRNIPALAMIPLVILWFGIDEKAKLFLVALGVFFPVYINTYHGIRSVDA
FT                   GLVEMARSYGVRGFALYRDVILPGALPSILVGVRFALGLMWVMLIVAETISAQSGIGYM
FT                   TMNAREFLQTDVVVVGILLYAVLGKLADVLAKWLERATLRWLPAHQPGAHA"
FT   gene            complement(404146..405303)
FT                   /gene="ssuD"
FT                   /locus_tag="BMA10229_A0382"
FT   CDS_pept        complement(404146..405303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuD"
FT                   /locus_tag="BMA10229_A0382"
FT                   /product="alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.-"
FT                   /note="identified by match to protein family HMM PF00296;
FT                   match to protein family HMM TIGR03565"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03141"
FT                   /db_xref="GOA:A2S363"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019911"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A2S363"
FT                   /protein_id="ABN03141.1"
FT                   /translation="MNVFWFIPTHGDSRYLGTAEGARAADYDYFRQVAVAADTLGYDGV
FT                   LLPTGRSCEDAWVVASSLIPATKRLKFLVAIRPGLSSPGLSARMASTFDRLSDGRLLIN
FT                   VVTGGDSAELEGDGLFADHDTRYAITDDFLHIWRGLLAESHENGGIDFDGEHLSAKGGK
FT                   LLYPPVQRPHPPLWFGGSSPAAHAIAADHIDTYLSWGEPPAAVEKKIADIRARAAARGR
FT                   EIKFGIRLHVIVRETQEEAWRDADRLISRLDDDTIARAQQAFAKMDSEGQRRMAALHGG
FT                   KRGSRQELEIYPNLWAGVGLVRGGAGTALVGNPEQIAARMREYAALGIETFILSGYPHL
FT                   EESYRFAELVFPLVKGGGNTRRAGPLSGPFGEVVGNQYLPKASQS"
FT   gene            complement(405330..405473)
FT                   /locus_tag="BMA10229_A0383"
FT   CDS_pept        complement(405330..405473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03936"
FT                   /db_xref="UniProtKB/TrEMBL:A2S364"
FT                   /protein_id="ABN03936.1"
FT                   /translation="MPPPRAARGGACAFPRFPRHAFHPAHRRAARASWRIVARPRIAVA
FT                   HF"
FT   gene            405657..405980
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0385"
FT                   /note="hypothetical protein; this gene contains a premature
FT                   stop which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(405977..406222)
FT                   /locus_tag="BMA10229_A0384"
FT   CDS_pept        complement(405977..406222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0384"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01298"
FT                   /db_xref="UniProtKB/TrEMBL:A2S366"
FT                   /protein_id="ABN01298.1"
FT                   /translation="MAARIGDATRRALAASRDGRPPLLGLTSGARRAHDAHRARYASSL
FT                   PPSSDMNARMNTSAPQPQTAFATKPTTSGGSMLPAG"
FT   gene            406221..406448
FT                   /locus_tag="BMA10229_A0386"
FT   CDS_pept        406221..406448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0386"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03599"
FT                   /db_xref="UniProtKB/TrEMBL:A2S367"
FT                   /protein_id="ABN03599.1"
FT                   /translation="MRPSMSIGAHAGESTLARHAGKSFFRRSLLQRIDRNRSLEAIAPT
FT                   PCSPPLISVSRRSNGAIPPSVRRAAPIRTD"
FT   gene            complement(406560..407735)
FT                   /locus_tag="BMA10229_A0387"
FT   CDS_pept        complement(406560..407735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0387"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01017"
FT                   /db_xref="GOA:A2S368"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:A2S368"
FT                   /protein_id="ABN01017.1"
FT                   /translation="MTGRARPLSIVMNAFHSDSPSADVRAHVANRIGFLELNRPQALNA
FT                   LSTDMIRALHRALDAWRDDADVLAVVIHSPHPRAFCAGGDVRFFHDAHRRGDQASIDTF
FT                   FIEEYALNHAIFTYPKPYIALMHGVVMGGGMGISQAARRTGGLRVVTDSTKMAMPETRI
FT                   GLFPDVGMSWFLARTPGALGRYLAVTGATLDAASALYAGLADAYLPDAALPALLDALRT
FT                   ERLDDGAAVTARVAAEAARHAPTPAPDGSALACARASIDRHFAQPDVAAIAASLDAERD
FT                   DAVRAAWADKARDAMRGGALSPLSMAVSLEVVERARGATMADCLRRDLDLTRSTFARGD
FT                   VIEGVRAVIVDKDHAPKWRYPAIADVTAQAVAAMFESPWRAHEHPLRKLRD"
FT   gene            complement(407732..408070)
FT                   /gene="emrE"
FT                   /locus_tag="BMA10229_A0388"
FT   CDS_pept        complement(407732..408070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrE"
FT                   /locus_tag="BMA10229_A0388"
FT                   /product="multidrug transporter EmrE"
FT                   /note="identified by similarity to SP:P23895; match to
FT                   protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01716"
FT                   /db_xref="GOA:A2S369"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S369"
FT                   /protein_id="ABN01716.1"
FT                   /translation="MQLPGYAWLAIAIVAEVVGTSALRAAEGFTRLWPTLVVALGYGTA
FT                   FYCLSLTLKSMPVGIVYAIWSGAGIVLITLVALVLYRQVPDWPAVVGLALIVAGVVVLN
FT                   LFSKMQAH"
FT   gene            complement(408075..408644)
FT                   /locus_tag="BMA10229_A0389"
FT   CDS_pept        complement(408075..408644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P29953; match to
FT                   protein family HMM PF03928"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02468"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR010371"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S370"
FT                   /protein_id="ABN02468.2"
FT                   /translation="MRAPLRGGARFALPYFRFRSPIRFMDIALDLQSIAVQEKTLVFPQ
FT                   FDAARAWALGSQLREFALARGHAVAIDVRTFGQPLFFALVDGATPDNVDWARRKGNVVA
FT                   HFRRSSYAIGLRLQQAGATLADKHGLPAAEYASHGGAFPIAVAGAGVIGSVTVSGLPQR
FT                   GDHELVVEALCAQLGHAYATLALTGN"
FT   gene            408843..408919
FT                   /locus_tag="BMA10229_A0390"
FT   tRNA            408843..408919
FT                   /locus_tag="BMA10229_A0390"
FT                   /product="tRNA-Met"
FT   gene            409291..409836
FT                   /locus_tag="BMA10229_A0391"
FT   CDS_pept        409291..409836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0391"
FT                   /product="pyrophosphatase, MutT/NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00785"
FT                   /db_xref="GOA:A2S371"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029401"
FT                   /db_xref="UniProtKB/TrEMBL:A2S371"
FT                   /protein_id="ABN00785.1"
FT                   /translation="MKFCSVCGHEVIARIPPGDNRERFVCDQCGTIHYQNPRNVVGTIP
FT                   VWGDQVLLCRRAIEPRYGYWTLPAGFMEMGETTAEAAARETLEEAGARVEVQNLFTLLN
FT                   VPHVHQVHLFYLARLVDPSFEAGEESLEVRLFDEADIPWDEIAFPTVSQTLRFFFADRE
FT                   AGDYGVHTGDIFRSLRNG"
FT   gene            409716..410612
FT                   /gene="aat"
FT                   /locus_tag="BMA10229_A0392"
FT   CDS_pept        409716..410612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aat"
FT                   /locus_tag="BMA10229_A0392"
FT                   /product="leucyltransferase"
FT                   /EC_number="2.3.2.6"
FT                   /note="identified by match to protein family HMM PF03588;
FT                   match to protein family HMM TIGR00667"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01489"
FT                   /db_xref="GOA:A2S372"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/TrEMBL:A2S372"
FT                   /protein_id="ABN01489.1"
FT                   /translation="MGRDRVPDRQPDAAILLRRPRGGRLWRPHGRHLPFAAQRLGARIV
FT                   PWLGPDDPFPSVERALGAASGAPGLLAASADLLPSRLIDAYRRGIFPWYSDGQPVLWWS
FT                   PDPRMILVPAEFRISATFRKTLKRVLREPRWEIRVDYDFAGVMRACAQAPRRGQRGTWI
FT                   TAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRMFFGESMYAHASDASKIALA
FT                   ALVAHLREHRVEMIDCQQNTSHLASLGGREIARKTFVAHVRRAVAEPPIPWRFDKRVVA
FT                   GLLGQAASATAADAFDR"
FT   gene            410646..411476
FT                   /locus_tag="BMA10229_A0393"
FT   CDS_pept        410646..411476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0393"
FT                   /product="putative arginine-tRNA-protein transferase"
FT                   /note="identified by match to protein family HMM PF04376;
FT                   match to protein family HMM PF04377"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02175"
FT                   /db_xref="GOA:A2S373"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S373"
FT                   /protein_id="ABN02175.1"
FT                   /translation="MTHPTELPLSPLSALQFYATAPYPCSYLDGRVARSQVATPSHLIN
FT                   SDIYTELVKAGFRRSGVFTYRPYCDGCRACVPVRVPVDAFAPNRTQRRTWKRHRALVAT
FT                   VAALHYDEEHYALYMRYQSARHAGGGMDRDSRDQYEQFLLQSRINSRLVEFRDLDPAEN
FT                   GASTLRMVSMIDILGDGLSSVYTFFDPDESHASYGTYNILWQIEQAKSLRLPYVYLGYW
FT                   IRESPKMAYKANFHPLEGLVDGRWKVLDPTLADLPPVDAALARAPLPGGHSGTR"
FT   gene            411581..412618
FT                   /gene="pyrD"
FT                   /locus_tag="BMA10229_A0394"
FT   CDS_pept        411581..412618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="BMA10229_A0394"
FT                   /product="dihydroorotate oxidase"
FT                   /EC_number="1.3.98.1"
FT                   /note="identified by match to protein family HMM PF01180;
FT                   match to protein family HMM TIGR01036"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01242"
FT                   /db_xref="GOA:A2S374"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S374"
FT                   /protein_id="ABN01242.1"
FT                   /translation="MFSSLYPLARASLFKMDAEDAHHLTLRMLGAAGRTGLACALSPRV
FT                   PDAPRTVMGLSFRNPVGLAAGLDKDGAAIDGFAALGFGFIEVGTVTPRAQPGNPRPRMF
FT                   RLPEADAIINRMGFNNSGVDQFVKNVQAARYRGVLGLNIGKNADTPIERAADDYLYCLE
FT                   RVYPFASYVTINISSPNTKNLRQLQGAGELDALLAALKDKQRRLADLHGKLVPLALKIA
FT                   PDLDDEQVKEIAATLLRHDIEGVIATNTTLSREAVKGLPHADEAGGLSGRPVFDASNAV
FT                   IRKLRAELGDAVPIIGVGGIFSGEDARAKLAAGAALVQLYTGFIYRGPALVAECVKAIA
FT                   RGEAR"
FT   gene            412729..413523
FT                   /locus_tag="BMA10229_A0395"
FT   CDS_pept        412729..413523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0395"
FT                   /product="cystine ABC transporter, periplasmic
FT                   cystine-binding protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02729"
FT                   /db_xref="GOA:A2S375"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A2S375"
FT                   /protein_id="ABN02729.1"
FT                   /translation="MKIASLKKLLVTGLIGASFAAATAHAADLLDEVKQRGTLRIGLEG
FT                   TFPPFNSKNPQGELVGFDVDIAKAIAAKLGVKPEFVTTEWSGIIAGLQAGKFDVIVNQV
FT                   GITDPRKQTLDFSPAYTFSSAQLIQRKDDARQFKSLEDLKGKKLGVALGTNYMDMAKSV
FT                   PGIDVKTYPGAPEYLRDLAAGRLDAALNDRLMLAYLTKNAQLPLRPGANVGSANPSGIP
FT                   FKKGNPKFAKAIADAMTQLEADGTFTKISDKWFGIDVTKPVK"
FT   gene            413620..414312
FT                   /locus_tag="BMA10229_A0396"
FT   CDS_pept        413620..414312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0396"
FT                   /product="cystine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00945"
FT                   /db_xref="GOA:A2S376"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S376"
FT                   /protein_id="ABN00945.1"
FT                   /translation="MIALSRTPPLHMPITSLLAQSLPVLLQGALLTVKFAVLSMLFGLV
FT                   GAVALALMGIGRSRVLAGLARAYVSVMRGTPLLVQIFVVYYGLPSLGVSLDPTPAGVIA
FT                   LSANVAAYMSESMRGAINGIDKGQWLAAYSLGLSWRQTLRYVIGPQALRIAVPSLSNSL
FT                   ISLIKDTSLVSVITVTELLRSAQEIIASTYQPLPLYLAAAAVYWVLCQILEWVQRWYER
FT                   RLALPSRH"
FT   gene            414509..414772
FT                   /locus_tag="BMA10229_A0397"
FT   CDS_pept        414509..414772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0397"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03335"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABN03335.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            414796..415629
FT                   /locus_tag="BMA10229_A0398"
FT   CDS_pept        414796..415629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0398"
FT                   /product="IS1404 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02333"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABN02333.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(415674..416078)
FT                   /locus_tag="BMA10229_A0399"
FT   CDS_pept        complement(415674..416078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0399"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02293"
FT                   /db_xref="GOA:A2S379"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A2S379"
FT                   /protein_id="ABN02293.1"
FT                   /translation="MRQHHPLSILLNVAGLARSTFYYQQKVLLAGDRYAALKQRIRAIY
FT                   ESHRGRYGYRRITAVIRQAGTPVNHKLVRRLMLQLGLKSLVRAKKYRSWRGMVGCVAPN
FT                   LLNRQFKAERLNQKWVTDVTEFNVKGQKLY"
FT   gene            complement(416664..416789)
FT                   /locus_tag="BMA10229_A0400"
FT   CDS_pept        complement(416664..416789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0400"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02081"
FT                   /db_xref="UniProtKB/TrEMBL:A2S380"
FT                   /protein_id="ABN02081.1"
FT                   /translation="MSVIGRRAEGVARHSRRRPARDAGIETASKRHQNENGRRVN"
FT   gene            complement(416786..418078)
FT                   /gene="aroC"
FT                   /locus_tag="BMA10229_A0401"
FT   CDS_pept        complement(416786..418078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="BMA10229_A0401"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="identified by match to protein family HMM PF01264;
FT                   match to protein family HMM TIGR00033"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01151"
FT                   /db_xref="GOA:A2S381"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S381"
FT                   /protein_id="ABN01151.1"
FT                   /translation="MRPPFRAARAKPARDIGRRAARMLGRARSRGAARSRAISPHCPKR
FT                   AGIMTVSPTDFLLDGPMSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALTEADVQL
FT                   ELDRRKPGTSRHVTQRQEPDQVEILSGVFEGVTTGAPIALLIRNTDQRSKDYGNIAETF
FT                   RPGHADYTYWQKYGVRDYRGGGRSSARLTAPVVGAGAIAKKWLCERFGVEVRGYMSALG
FT                   EIEIPFVDWSHVRENPFFAPNADIVPQLEDYMDALRKDGDSIGARIDVVASGVPVGWGE
FT                   PLFDRLDADIAHAMMGINAVKGVEIGAGFASVAQRGSVHGDELTPDGFVGNHAGGVLGG
FT                   ISTGQDITVSIAIKPTSSIRTPRRSITRAGEPAVVETFGRHDPCVGIRATPIAESMLAL
FT                   VLIDHALRHRAQCGDVSSATPRIAARAPDAQ"
FT   gene            complement(418260..420190)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0402"
FT                   /note="putative acyltransferase; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01553; match to
FT                   protein family HMM PF07690"
FT   gene            complement(420290..420754)
FT                   /locus_tag="BMA10229_A0404"
FT   CDS_pept        complement(420290..420754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0404"
FT                   /product="CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00630"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A2S384"
FT                   /protein_id="ABN00630.1"
FT                   /translation="MRVSDILKVKGNTLFTVTPDTPLRSAVDTMAEHDIGSLVVMEYGD
FT                   LVGILTFREIILRLKANGGSIGEVLVRTVMDEPLTCTPETDIDEVRRMMLERHARYMPV
FT                   LDKKVLMGVISFYDVAKTVVEAQSFENRMLKAYIRDWPEPDSEERKPLAS"
FT   gene            420971..421291
FT                   /locus_tag="BMA10229_A0405"
FT   CDS_pept        420971..421291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0405"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02134"
FT                   /db_xref="GOA:A2S385"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:A2S385"
FT                   /protein_id="ABN02134.1"
FT                   /translation="MAHSAHTEHFASFAEFYPFYLDEHRHLVSRRLHFVGSLGVIGCLA
FT                   MALATGLWWWLPAAVVCGYGFAWIGHFFFEKNRPATFRHPIYSLMGDWVMFKDICTGKI
FT                   SI"
FT   gene            complement(421463..422773)
FT                   /gene="rbn"
FT                   /locus_tag="BMA10229_A0406"
FT   CDS_pept        complement(421463..422773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="BMA10229_A0406"
FT                   /product="ribonuclease BN"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF03631;
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00672"
FT                   /db_xref="GOA:A2S386"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:A2S386"
FT                   /protein_id="ABN00672.1"
FT                   /translation="MPKLSVDLDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPL
FT                   VTVAFALFTAFPMFASFQNSLQGFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIV
FT                   LVFTAVMMMTIESAFNLIWRVRKPRPFAQRVLAYWALITLGPLLFGVSLSMSSYLFTKS
FT                   LAFAGSTSTPPVFEWLLAAASLPLTVLAFTLLYVYLPNCTVAWRDAVVGGVCAALAFEL
FT                   AKRGFGYYVRRIPTYTAVYGAFATVPMFLLWLYLSWFVTLAGAMIASALPAIRVGQFHR
FT                   IHYPGSDLLDSLELLARLADAQQAGKPGHTAARLALMARCDMETAQRLLSTLEEREWVA
FT                   RLQSGNDAAPRYVMLANPERLTVANLFDVLVIDRSELVYQAQRGRTEVDCATLVDAFTS
FT                   EKLDLSLAELIARRRQGASRDAPGAAHSTSALPPRTA"
FT   gene            422879..423487
FT                   /locus_tag="BMA10229_A0407"
FT   CDS_pept        422879..423487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0407"
FT                   /product="flavodoxin"
FT                   /note="identified by match to protein family HMM PF00258;
FT                   match to protein family HMM PF03358; match to protein
FT                   family HMM TIGR01755"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01586"
FT                   /db_xref="GOA:A2S387"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A2S387"
FT                   /protein_id="ABN01586.1"
FT                   /translation="MKDILVLYYSRHGATRELALAIAAGIDSVPGMQARIRTVPPVSTV
FT                   CEATQPDIPDDGPPYAEPRDLDECAGLALGSPTRFGNMAAPLKYFLDGTTPQWLSGALA
FT                   GKPACVFTSTGSLHGGQESTLLSMMLPLLHHGMLIVGIPYTETALSVTQTGGTPYGASH
FT                   FARVADPARERISADEKTLAHALGARLARTASQLGAAAA"
FT   gene            423484..423933
FT                   /locus_tag="BMA10229_A0408"
FT   CDS_pept        423484..423933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02396"
FT                   /db_xref="GOA:A2S388"
FT                   /db_xref="InterPro:IPR018643"
FT                   /db_xref="UniProtKB/TrEMBL:A2S388"
FT                   /protein_id="ABN02396.1"
FT                   /translation="MSAPVAAKPLAAHAAALCLVALIALGVAWEAWLAPLRPGGSALIL
FT                   KAVPLALALPGVWRRSVYTLQWASMLILIYLAEGIVRGMTDGGLSARLGWLEAALALGF
FT                   FGAALAYVAPYKRAAKQAARRAAKRAEQPEKHAPARARASDRTRP"
FT   gene            423968..425389
FT                   /locus_tag="BMA10229_A0409"
FT   CDS_pept        423968..425389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0409"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03455"
FT                   /db_xref="GOA:A2S389"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A2S389"
FT                   /protein_id="ABN03455.1"
FT                   /translation="MTSTSAFVDACRHAIGADHVLTDSHDTAPFLTDWRRRYQGAACAV
FT                   LRPANTEEVAALVKLALEHRVALVPQGGNTGLAGGATPDAGGKQAVLSLARLNRVRALD
FT                   PHNNTITVEAGVILADAQARARDADRLFALSLAAEGSCTIGGNLATNAGGTAVLRYGNA
FT                   RELCLGLEVVTAQGEVWDGLRGLRKDNTGYDLRDLFIGAEGTLGIITAAVMKLHPLPAA
FT                   KVTALAALESPHAALDFLALAQRAAGPLLTGFELMSDFCMKLVGKHYPQLRYPFDAAHP
FT                   QTVLLELSDNESEAHARALFETMMEQAFEAGLVVDAVVAENLAQSRAFWDLREHIPLAQ
FT                   ADEGLNIKHDIAVPISAIAHFIDETDAAIQAAAPGARMVTFGHLGDGNLHYNVQMPEGG
FT                   DPKAFLAEHQAPINRIVYDNVHKHRGTISAEHGIGQLKIDDAQRYKAAVEIRLMRALKA
FT                   ALDPLNLMNPGKVLH"
FT   gene            425421..426404
FT                   /locus_tag="BMA10229_A0410"
FT   CDS_pept        425421..426404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0410"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03724"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A2S390"
FT                   /protein_id="ABN03724.1"
FT                   /translation="MKVRVLSDLHLECNEPEAIAHAQADLVVLAGDIHNHAEGLRWAAQ
FT                   TFDPAVPVVYVPGNHEYYDGEFGALETAMRDAAAALDHVHYLNNDVYVDPAGRFRVLGT
FT                   TLWTDFELFGNDAAALSQSIAACERVMLDFKGLIQVDWPGGADASSGESSGASREALRE
FT                   ALRDAAAECAPNASPEESAPRRAMQTPAGASAPAATADAPAPGPRHFAPRDALALHRTA
FT                   RAWLERELAKPWPGATIVVTHHAPLRASLAPRYADDLASAGFISDLATLVRPPVSLWIH
FT                   GHTHTSFDYTTAQGTRVVCNPHGYIRRRTGERENPSFEWGKVVTLA"
FT   gene            complement(426436..426597)
FT                   /locus_tag="BMA10229_A0411"
FT   CDS_pept        complement(426436..426597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0411"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00743"
FT                   /db_xref="UniProtKB/TrEMBL:A2S391"
FT                   /protein_id="ABN00743.1"
FT                   /translation="MLMGFGALALFGAIGIAASRELLRAIDAQQRRAPVPVRVRTRRPH
FT                   RDGRRTVL"
FT   gene            complement(426748..427689)
FT                   /locus_tag="BMA10229_A0412"
FT   CDS_pept        complement(426748..427689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0412"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01911"
FT                   /db_xref="GOA:A2S392"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S392"
FT                   /protein_id="ABN01911.1"
FT                   /translation="MDTLQNMRVFVRVVDAGSFTAAAQQLNSTTAYASRAVSDLEAHLR
FT                   TRLLNRTTRRIALTEAGERYLQRCEQILAYVEQAEAEASDAHARPSGKLKVHCMTSLGQ
FT                   HYTVPAVSRYRQRYPEVQVDLTLAQRLPDLLDEGFDVSLVVGRELPDSGLVSQRLGETF
FT                   SVVCASRGYIEQHGAPQRPQDLAGHVCLGMVAPGLYWDEWKLVGPQGEQSVTLAPPPFR
FT                   VNVAEALAAGIREGMGIGVLPLYSAIAGLRNGDFVRVMPEYRSHVMNIYALYASRQYLD
FT                   AKIRTWVDFLRDELPSILEADEAALERFTVQT"
FT   gene            427862..429610
FT                   /locus_tag="BMA10229_A0413"
FT   CDS_pept        427862..429610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0413"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02541"
FT                   /db_xref="GOA:A2S393"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A2S393"
FT                   /protein_id="ABN02541.1"
FT                   /translation="MRGTLALAVLAISLIMAGCASMGDVAPQDKQVDPASLDAGAAIAA
FT                   AERDAGWPAADWWRAYRDPQLDSWIVASLAGNPSLAAAQARVREAQSLARIAHAEELPQ
FT                   LNGNLSLMRQHWPDNVYYGPGPLANADTWNNTGTLSLSYHLDLWGKDKHNAERALDAAR
FT                   ARAADARAAQLELEANVVRAYVDFAKNYALLDIAHATYERQNALAELARKRLRAGIGTQ
FT                   LEVSQAEAPLPDYSRQIDSYEEAIQLGRHQLAALAGKGPGAGASLARPKLALDANAALP
FT                   SALPAELLGRRPDIVAARWMVDAQARGIDVAKAAFYPNVDLIASLGGFAVSAPFATFLR
FT                   AMNGGWSAGPALTLPIFEGGRLRAQLGVASAGYDQAVEHYNQTIVGALKDIADNVVRLH
FT                   SLDSQQKDAARAVSLTRRSYDLSHAGFSRGLTDYVNVLIAQSQLLTAQENQTRIEAARL
FT                   AAHASLMVALGGGLETGRDAPHDAPAGDARRTGASGASGASGASGASGASSTAGASATA
FT                   SASAAGHAPAGAAAPASPAGIRAAASARASMPAPAAAATAPAFASPVAGASTPMPAATA
FT                   AARAAR"
FT   gene            429627..431828
FT                   /locus_tag="BMA10229_A0414"
FT   CDS_pept        429627..431828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0414"
FT                   /product="putative fusaric acid resistance protein"
FT                   /note="identified by match to protein family HMM PF04632"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02087"
FT                   /db_xref="GOA:A2S394"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:A2S394"
FT                   /protein_id="ABN02087.1"
FT                   /translation="MSAASPPSAATPQSAGAAFVASMSDWARTDGAAWLYLAKALAAAF
FT                   LALGVSMVLDLPAPKTAMTTVFIVMQPQSGAVFAKSFYRLIGTFVGLTATLALVGLFPQ
FT                   QPVLFLLAVALWVAACTAGAARNRNFRSYGFLLAGYTAALIGLPASQAPNGAFMTAMTR
FT                   VSEISVGILSAGIVSALIFPQYTGEQMRTTVRRRFGAFVDYVAAALAGALDRSKIESVH
FT                   TRFVADVVGFEAARSMAVFENPDTRMRSGRLSRLNSEFMTASSRFHSLHQLMNRLHATS
FT                   AQAVDALEPYFREIAPLLSNDGDHVRTSADAARAAEQLLAYRDALPRRIRATRAEHETQ
FT                   PAFPLLDFDTASELLYRFITDLHAYAATYASLAASTHARERWIERYEPRTNATAALIAG
FT                   IRTASVMLLLSVFWIYSAWPSGVMLVLNAAAVCALASSSPQPTRMAAQMALGTAFAVAT
FT                   GFVLMFGVYPHIDGFVLLCAALAPFLAPGVLMSLKPKYAGCGAGYLIFFCTLAGPENLT
FT                   HYDPIGFMNDALALVLSMIVSAIAFAVLFPPSAPWLKKRLFADLRHQAVAACHARLPGL
FT                   RTRFESGARDLMFQAHGLSADQPDAQRDALRWMFAVLETGNAVIDLRHELAALPRDPRY
FT                   AATMPWRRKIEAARDALAALFDKPAPARFDAALAAAVDAIAATQQALVAFAPPREERHQ
FT                   MQRILSQLHFVRTALLDPESPLAALNGARTPTDRPGVSS"
FT   gene            431825..432028
FT                   /locus_tag="BMA10229_A0415"
FT   CDS_pept        431825..432028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07869"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02944"
FT                   /db_xref="GOA:A2S395"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:A2S395"
FT                   /protein_id="ABN02944.1"
FT                   /translation="MMPRDLAILDAYVPTVVLMFVIGAFATWLIDRLLAYTGLYRVVWH
FT                   PSLFRASLLVCICGGLSLAVYR"
FT   gene            432042..432923
FT                   /locus_tag="BMA10229_A0416"
FT   CDS_pept        432042..432923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03487"
FT                   /db_xref="GOA:A2S396"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A2S396"
FT                   /protein_id="ABN03487.1"
FT                   /translation="MFLRKLFGFVATAVILIVAILIGRTLWVHYMDEPWTRDGRVRAEI
FT                   VNVAPDVSGAVVELPVRDNQFVKQGDLVMQIDPSHFRIAVEQAQAAVAARRAELQMRRA
FT                   DAARRADLDALVVSKESRENSAQTASSAEAQYQQALAALDAAKLNLERTRVVAPVDGYV
FT                   TNLQVFRGDYASAGQAKLAIVDSHSFWVYGYFEETKLPRVKIGAKAEMRLMSGGVLKGH
FT                   VESISRGIYDRDNPQSRDLVADVNPTFNWVRLAQRVPVRIHIDEVPKDLVLSAGTTCTV
FT                   IVEPDGGGKRKS"
FT   gene            433155..433298
FT                   /locus_tag="BMA10229_A0418"
FT   CDS_pept        433155..433298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0418"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00823"
FT                   /db_xref="UniProtKB/TrEMBL:A2S397"
FT                   /protein_id="ABN00823.1"
FT                   /translation="MSGGMHAGDARSSARPLVRRARGACRCGALRHAGRVASAQPAACA
FT                   GK"
FT   gene            complement(433271..434947)
FT                   /locus_tag="BMA10229_A0417"
FT   CDS_pept        complement(433271..434947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0417"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01083"
FT                   /db_xref="GOA:A2S398"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A2S398"
FT                   /protein_id="ABN01083.1"
FT                   /translation="MKGVSLHGKHFLPDDATGNRGRTPKPGKPRRARRAWSVKTTLRAA
FT                   FALLLVGTLAVGLFSLAQISRLNSSIRSVYEQGHVASRAAEEVRASVLRASRAQKMLIT
FT                   ATTAKERDELGADIDKGLAAIGAELATLQRHADGAADDAARLKAFGAAVLAWSAHLRDF
FT                   VKLVREQPLDLSQMSWQVGSQDVSLLVETGKLEKLVDGLVDARGDASKATLDASGAIFR
FT                   ESFAMLAAMTAALVVLAFVIAAWVVRRLGAQLGGEPAYAKEIAVSISRGDLSNVIRLDT
FT                   RDHDSMLHALRDMQEGLAGTVREISASAEAIASAAGEIAMGNLDLSQRTEQQAVALERT
FT                   ATSMGQLTSTVHQNAENARQASTLAANASSVAEAGGTVVGRVVSTMNEIDESAKSIRDI
FT                   IGVIESIAFQTNILALNAAVEAARAGEEGRGFSVVASEVRSLAQRSASAAKEIKALIGA
FT                   SVERVANGAVLAQDAGRTMDEVVRAVKRVTDIMGEISAASSEQSAGIDAIERAVTQMDA
FT                   GTQQNAALVEEAAAAARSLDEQAQMLKEMVGRFHLPAHAAG"
FT   gene            435299..436549
FT                   /locus_tag="BMA10229_A0419"
FT   CDS_pept        435299..436549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0419"
FT                   /product="fosmidomycin resistance protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01728"
FT                   /db_xref="GOA:A2S399"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2S399"
FT                   /protein_id="ABN01728.1"
FT                   /translation="METSLDNRPSVARAAASPAPAAVSRTVYPVLGAISFSHLLNDMIQ
FT                   SLILAIYPMLKSEFSLSFAQIGLITLTYQITASLLQPVIGLYTDKRPQPFSLPVGMGFT
FT                   LTGLLLMAFAPTFPFLLVAAALVGCGSSVFHPESSRVARMASGGRHGLAQSLFQVGGNA
FT                   GSSLGPLLAALIVIPHGQRSIAWFSAAALVAIFVLVQIGRWYRRHPAAKKKAAHAAHPT
FT                   LSRQQVGLALGVLVMLVFSKYFYLASINSYFTFYLIDKFHLSVQAAQIHLFVFLAAVAA
FT                   GTIIGGPVGDRIGRKYVIWTSILGVAPFTLMLPYANLFWTTVLTIVIGVVLASAFAAII
FT                   VYGQELIPGKVGTVAGLFFGLSFGLGGVGAAVLGQLADATSIAFVYKVCSFLPLIGVLT
FT                   VFLPNVEGRTTLDKQRA"
FT   gene            complement(436879..437667)
FT                   /gene="mtnN"
FT                   /locus_tag="BMA10229_A0420"
FT   CDS_pept        complement(436879..437667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="BMA10229_A0420"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="identified by match to protein family HMM PF01048;
FT                   match to protein family HMM TIGR01704"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03917"
FT                   /db_xref="GOA:A2S3A0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3A0"
FT                   /protein_id="ABN03917.1"
FT                   /translation="MNQQTFFDRPLGILAALPEELGDLVAAMRDDGPVDTVTLGRRDYH
FT                   VGVAHGVRCVVTLARVGKVAAAATASALIHRFDVRAIVFTGVAGGVASDVSVGDVVVAD
FT                   ALLQHDLDASPLFPRFEVPLLGLTRFAADAALAAQLKAACARFVDDEGETLNARFRLHG
FT                   ARVHAGLIVSGDRFVSSEREVSALRDALPDALAVEMEGAALAQVCHEYGVPCAIVRTIS
FT                   DTADDHASTSFTTFLTDIAGAYSSGILKRFLAAHARANAA"
FT   gene            complement(437664..440027)
FT                   /gene="uvrD"
FT                   /locus_tag="BMA10229_A0421"
FT   CDS_pept        complement(437664..440027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="BMA10229_A0421"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03171"
FT                   /db_xref="GOA:A2S3A1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3A1"
FT                   /protein_id="ABN03171.1"
FT                   /translation="MPDLLANLNPEQLAAVTLPNEPALILAGAGSGKTRVLITRIAWLI
FT                   RQGYAAPATVLAVTFTNKAAREMMARLAAMMPIDTRGMWIGTFHGLCNRMLRAHYRDAG
FT                   LPQTFQILDTADQLSAIKRLMKAANVDDEKYPPKNVQYFINNAKEQGLRPEKVDATDSF
FT                   NRKFVELYQAYEQQCQREGVVDFPELLLRCYELLAHNPPLRAHYQARFKHILVDEFQDT
FT                   NKLQYAWLKLLAGGHNAIFAVGDDDQSIYAFRGANVGNMRDFEHEFRVRNLIKLEQNYR
FT                   SHGNILDAANHLIANNAHRLGKNLRTDAGHGEPVRVYEAATDAQEAAWIVEEIRSLVNA
FT                   GLARSEVAVLYRSNAQSRSIEHTLMTAGIAYRVYGGLRFFERQEVKHALAYLRLIDNPN
FT                   DDTAFARVVNFPTRGIGARSIEQLADAARLYDCSMAAAIPYVAGKAGSSLASFANLIAK
FT                   MRAETAQMSLPETVEHVVRASGLADFYQGEREGQDRLENLQELVNAATAFVSEEGYGLD
FT                   TPARSIPLHARASAAPELAAGGADPADAVLAPANLADPAQNPDAMTPLAGFLSHASLEA
FT                   GDNQAQAGQDAVQLMTVHAAKGLEFTAVFITGLEEGLFPHENSALESDGLEEERRLMYV
FT                   AITRAKERLYLSFAQSRMLHGQTRYNIRSRFFDELPQHVLKWLTPKVEAGARWGGRSDN
FT                   AGWGRDWFARPGGGARQGVVDAAVSAPLPAFANQQREAQNGLRIGQQVFHTKFGEGTVT
FT                   ALEGSGTDAKAQVKFKRHGEKWLALAVAKLQAVE"
FT   gene            440167..443034
FT                   /gene="valS"
FT                   /locus_tag="BMA10229_A0422"
FT   CDS_pept        440167..443034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="BMA10229_A0422"
FT                   /product="valine--tRNA ligase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02766"
FT                   /db_xref="GOA:A2S3A2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3A2"
FT                   /protein_id="ABN02766.1"
FT                   /translation="MSDTTLAKSFEPQTIESQWGPEWEKRGYATPALDPSRPDFSIQLP
FT                   PPNVTGTLHMGHAFNQTIMDGLVRYHRMLGHNTLWVPGTDHAGIATQIVVERQLDAQGV
FT                   SRHDLGREKFVERVWEWKERSGSTITGQVRRIGASPDWSREYFTMNDKMSEAVREVFVR
FT                   LYEQGLIYRGKRLVNWDPVLLTAVSDLEVVSEEENGHLWHIRYPLADGSGHLSVATTRP
FT                   ETMLGDVAVMVHPEDERYRHLVGRHVKLPLCEREIPIIADDYVDREFGTGVVKVTPAHD
FT                   FNDYQVGLRHALAPIEILTLDAKINDNAPAAYRGLDRFDARKAIVDELDAQGLLESVKP
FT                   HKLMVPRGDRTGVVIEPMLTDQWFVAMTKPAPQGTFHPGKSITEVSLEVVRRGEIKFVP
FT                   ENWTTTYYQWLENIQDWCISRQLWWGHQIPAWYGENGEIFVARNEEDARAQAAAKGYTG
FT                   ALKRDDDVLDTWFSSALVPFSSLGWPNETPEMKHFLPSSVLVTGFDIIFFWVARMVMMT
FT                   THFTGKVPFGTVYVHGLVRDAEGQKMSKSKGNTLDPIDIVDGIGLDALVAKRTTGLMNP
FT                   RQAATIEKKTRKEFPDGIPAFGTDALRFTMASMATLGRNVNFDLARCEGYRNFCNKLWN
FT                   ATRFVLMNCEGHDCGFDKPEVCGAGDCGPGGYLDFSPADRWIVSLMQRVEADIAKGFAD
FT                   YRFDNIANAIYKFVWDEYCDWYLELAKVQIQNGTSEQQRATRRTLLRVLETVLRLAHPI
FT                   IPFITEALWQKVAPLAGRYPAGKAEGEASLMVQAYPVAEPKKLDEACEQWAAELKAVVD
FT                   ACRNLRGEMNLSPATKVPLLAAGDAAQLQAFAPYVQALARLSEVRVLPDEAALDADAHG
FT                   APIAIVGGNKLVLKVEIDVAAERERLSKEIARLEGEIVKCNAKLGNEAFVAKAPPAVVA
FT                   QEQKRLAEFQSTLTKLGAQLARLPA"
FT   gene            443121..444002
FT                   /gene="galU-1"
FT                   /locus_tag="BMA10229_A0423"
FT   CDS_pept        443121..444002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU-1"
FT                   /locus_tag="BMA10229_A0423"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01099"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00866"
FT                   /db_xref="GOA:A2S3A3"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3A3"
FT                   /protein_id="ABN00866.1"
FT                   /translation="MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEA
FT                   IAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLDLVRSIKPSHVDCFYVR
FT                   QPEALGLGHAVLCAEKLVADNPFAVILADDLLDGDPPVMKQMVDVFDHYHSSVIGVEEI
FT                   PPEDTKSYGIVDGKEWEDSIIKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALK
FT                   PGAGGELQLTDAIQALLADEQVLAYKYRGTRFDCGSKLGYLKATVEFALRHPEVKTEFE
FT                   TYLRSRSETQHG"
FT   gene            complement(444063..444680)
FT                   /locus_tag="BMA10229_A0424"
FT   CDS_pept        complement(444063..444680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0424"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03600"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3A4"
FT                   /protein_id="ABN03600.1"
FT                   /translation="MKVLWTGAALAAALLSGCASVTTGVSASAAPGALAGARTYDFART
FT                   ATQAGNADYRRVETLVRGELAQRGFEEAAGTQARYRVTIAYATQPASVALTMPGCGGAQ
FT                   QPACVAVDGPAPFGLPFAGTVYRHVLTLRFIERSSGGDAYRVSAAVQDRHPDALLAAPV
FT                   LVRSALARVPFADGGGWLVETKKRDADDAMPGVVSVKPARSN"
FT   gene            complement(444769..447162)
FT                   /locus_tag="BMA10229_A0425"
FT   CDS_pept        complement(444769..447162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0425"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF05226"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02881"
FT                   /db_xref="GOA:A2S3A5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR017181"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3A5"
FT                   /protein_id="ABN02881.1"
FT                   /translation="MRFDRTQRRRLLGRRFLVEWIAIGCLGVAVILAGVAGRMTASVDR
FT                   IIYDRLLTLRKLPIESNIVIVEIDNRSLDTLGRWPWQRSVHAEFLGALAKTHPAAVVYD
FT                   VLFTEPSADDRALAKVLDLVPTFLPVLLSPEEPDGTRTVNPPVPVLAQHVAGAGHINLE
FT                   VDPDGIVRSVALFESDGLHRWPQLMVPVFHALENGQFKLAQPAPIARRAHDIAQDDNGE
FT                   SRYFVPFSRASQNYPAISFVDVLAGRVNADELRGKIVIVGATASGLYDRFATPISGEFG
FT                   PLPGVYIHASVLDTLMTGRAISPVSGWLVFSASLLPLVVLLAGFLMLSPWRSLLLTLSL
FT                   AALAVASSAALLYEARLWLSPAPAIFGLIAAYPIWNWRRLEMTMSYLRYELQRLADEPH
FT                   LLPEAPRERNEFGGDVLERQMALMAQAAQRVQDMKRFVWDSLDSMPEPVVVTDLAGTVL
FT                   IANHAAKRYCARLDAPAPEGRPLRVAFGELSFVKTVDGNAEQDVAIRTHWPAALDPTRD
FT                   YENDVMERGIEVRDRSGLDHLLRYAPCTNAQGNVTGWIAGLVDVTALHAAERQREEALH
FT                   LLSHDMRSPQSSILALVEIERQRAESEHTRGLLARIERYAQRALMLADEFVQLARAESQ
FT                   TYQLEAVSFADLLIDASDEVWPQAQAKRIRIDTSFGDEPCWIGADRSLMTRALVNLLNN
FT                   AVKYSPTDTVITCTLSVEPGAKRMHCTIRDQGYGISLEDQRHLFERFKRFHANERPEVA
FT                   GSGLGMAFVKTVVVRHGGCIGVDSTPGIGTAITVSLPLLDEPAA"
FT   gene            complement(447173..448519)
FT                   /locus_tag="BMA10229_A0426"
FT   CDS_pept        complement(447173..448519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0426"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02791"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016930"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3A6"
FT                   /protein_id="ABN02791.1"
FT                   /translation="MTKYVLTACCAAATALAAQHAAAQSAKNRSVATVDYTTRSGDTLY
FT                   DVSARYLQGTDDWPLVAQLNDVPVPKHLQPGVVLKLPAARLRKERLSARVIAAHGTVES
FT                   AGRGSAQFAPVAVDATLTEGDRLRTGSNAFVTLELSDGTHLSLPPDSQIDLATLRRTVL
FT                   TGTLERVIDLRRGSVDSEVTHLKKKDDRFQIRSPSVVAGVRGTRFRVNYDKDGRASTTV
FT                   EVLDGTVGVAPSAKRSADTLVHANFGNVTSASGVVGSPIALLDAPQLANPAKIQDDPQV
FT                   AFDLVPLGGAQSYHVQIARDAGLYDLFKEVQVSAPRATFADVPDGTYFVRIAAIDSHGL
FT                   EGQPRIYAFERRRFGVDASAAPADGGYAFRWSTTQDGAAAGATRFRFVLSRSKDLSNPI
FT                   VDQVDAQGGRIAVSNLTPGDYYWSVIAERYEGGRFHEKASAVNAFTIAR"
FT   gene            complement(448534..449238)
FT                   /locus_tag="BMA10229_A0427"
FT   CDS_pept        complement(448534..449238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0427"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02044"
FT                   /db_xref="GOA:A2S3A7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3A7"
FT                   /protein_id="ABN02044.1"
FT                   /translation="MRIAVLDDDQAQTDFVSQTLTAAGHTCYAFKEGKALKKRLQRETF
FT                   DLLVLDWNVPDMSGEEVLKWVRANQVEHRLPIIFMTSRDDEAGITQILNAGADDYVVKP
FT                   VSGPILRARIGSLLRRAYPVNAESSIREFDNYKFDANLKQAYVGDKPVSLTQKEFELAL
FT                   LLFQHLDRPLSRAHILDLVWKQATDIPSRTMDTHISMLRTKLGLRPENGYRLAPIYGYG
FT                   YRLERVMQGDAE"
FT   gene            complement(449566..449952)
FT                   /locus_tag="BMA10229_A0428"
FT   CDS_pept        complement(449566..449952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03176"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3A8"
FT                   /protein_id="ABN03176.1"
FT                   /translation="MLFRSGTIRIPFEPNDKARERERPIQRVELDPEHDRHARAALEAY
FT                   ADSSAHEMPWLAEWMREALGSPQPELTRCAQTVERVFDLAHAWAAGQPDYAGAAWEHVR
FT                   GRLLEALQHAPRAIAPDALETDPA"
FT   gene            complement(450228..450458)
FT                   /locus_tag="BMA10229_A0429"
FT   CDS_pept        complement(450228..450458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01206"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02464"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3A9"
FT                   /protein_id="ABN02464.1"
FT                   /translation="MLIHKEVDARGLNCPLPILRAKKALADMESGQILKVLATDPGSQR
FT                   DFAAFAKQTGNEIVESSTTQDKTFVFLMRRR"
FT   gene            complement(450623..451660)
FT                   /locus_tag="BMA10229_A0430"
FT   CDS_pept        complement(450623..451660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0430"
FT                   /product="myo-inositol dehydrogenase"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894; match to protein
FT                   family HMM PF03447"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00937"
FT                   /db_xref="GOA:A2S3B0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3B0"
FT                   /protein_id="ABN00937.1"
FT                   /translation="MIVSHSAAAVRIGIAGLGRLGRRHAENLARRVAGARLAAACSPLA
FT                   DECAWARETLAVPRVYEDFDALAADPELDALWLVTPSALHADQIVAALRAGKHVFCEKP
FT                   LSLDLGECERVLAEARARPHLVATIGFMRRFDPSYRDAYARVAAGEIGRPFLVRSQTCD
FT                   RNDPEGFFVRFVPSSGGIFLDCTVHDIDVARWLLGAPRATRVYAAGAVALHEGLRACGD
FT                   VDNGVAICEFEGGRLAMFYASRTMAHGNDTHSEVIGTAGALAIGRNPRANRVEIYDAAG
FT                   IRNTCTPTFFDRFEDAFLIEAQAFVAAVRGEGAAGGATLADALEATRIGHALRESLQTG
FT                   RAIEL"
FT   gene            complement(451673..452692)
FT                   /locus_tag="BMA10229_A0431"
FT   CDS_pept        complement(451673..452692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0431"
FT                   /product="myo-inositol dehydrogenase"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03589"
FT                   /db_xref="GOA:A2S3B1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3B1"
FT                   /protein_id="ABN03589.1"
FT                   /translation="MTNAAPTIDVAVFGAGRIGRIHAGNLARRPGVRLKYVVDVNRDAA
FT                   AALAAQYGAQAADVDGALGDASIGASVICSSTDTHAELIVGAARAGKHVFCEKPVDLTL
FT                   ERARACEAAVARAGVVCMIGFQRRFDPTFEALKRRIDAGEIGTPEMLVVTSRDPGAPPV
FT                   DYIKHSGGIFKDMLIHDFDIFRWILDDDADTLHATGSCLTDPAIAGAGDIDSAAVTIRT
FT                   KRGRLCQINTSRRAAYGYDQRFEVLGSAGMLQAGNVRPTEVTGYSARAVSTDLPEAFFL
FT                   ERYRAAYAREIAHFFAAVTSGEPVRTTVADGVKALELAEAATLSWREARAVTLGERAA"
FT   gene            complement(452685..453566)
FT                   /locus_tag="BMA10229_A0432"
FT   CDS_pept        complement(452685..453566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0432"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02864"
FT                   /db_xref="GOA:A2S3B2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3B2"
FT                   /protein_id="ABN02864.1"
FT                   /translation="MDDTTPPETPAVDDLLQRIAGAYDTLPRQLKRIASYIDEHRSSVM
FT                   MDRTSDIAQRCGVHPSAVVRFAQRFGFSGFSDLQAVFKDAYTGQNPTVQSYQQRIRSLI
FT                   DGEAGPMTGGAVARQFIDASRAGLDELAAGLDDDQFDAAVTMLERAENIYVVGVRRSFP
FT                   VASYIVYALQHTAKRVHLVSGLGGMYREQIRSVKKGDVVIAISFAPYGKETQYCLRAAR
FT                   HNHAQTLVVTDSRLSPLARDASAHLLVKEGSAFAFRSLTSTICLCQALFIALAYRLELN
FT                   VEEVKDIGGYDD"
FT   gene            453811..454860
FT                   /locus_tag="BMA10229_A0433"
FT   CDS_pept        453811..454860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0433"
FT                   /product="ABC transporter, carbohydrate uptake
FT                   transporter-2 (CUT2) family, periplasmic sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01811"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3B3"
FT                   /protein_id="ABN01811.1"
FT                   /translation="MRLCTGKAVLRACVAAIAVAAGVGGAAPAAQAAGARFALVSHAPD
FT                   SDSWWNTIKNAIKQADEDFDVTTDYRNPPNGDIADMARLIEQSAARDYDGVITTIADYD
FT                   VLKNSLKKVTAKKIPLVTINSGTEEQSAQLGAIMHVGQPEYVAGHAAGEKAKAAGVKRF
FT                   LCVNHIATNSVSFDRCRGFADAIGADYKSSTIDSGQDPTEIQSKVSAYLRNHPNTQAIL
FT                   TLGPVPAAASLKAVQQMGLANKLFFATFDFSDDIAKAIQSGAIKFAIDQQPYLQGYIPV
FT                   AVLAIAKQNKTTDPAKIRQILEANPKFQARLSTYGLQPSYGPKNIRSGPGFITKENLEK
FT                   VIKYAGQYR"
FT   gene            454961..456106
FT                   /locus_tag="BMA10229_A0434"
FT   CDS_pept        454961..456106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0434"
FT                   /product="ABC transporter, carbohydrate uptake
FT                   transporter-2 (CUT2) family, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03478"
FT                   /db_xref="GOA:A2S3B4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3B4"
FT                   /protein_id="ABN03478.1"
FT                   /translation="MGVVGKHMSAHAHEKPQPGAASDERLRGEAWFQRFLNRPEFAAIS
FT                   GAVLVFAVFAFGAGGSGMFNLDGIMNWSQVAAYLGILAVGACLLMVAGEFDLSIGSMIG
FT                   FAGMMVAIPTVYFHWPIWLAVLFAFAGSMALGALNGYLVMRTKLPSFIVTLAFLFILRG
FT                   LTLALSIMFADRTIVSGLGDYAHADPVVHFLFQGVAFHELFRSLAHAGVGRLLDNGEPL
FT                   VPGVPKVLLWWLAVTAVGAFVLAKTRYGNWILAAGGDAHAAKNVGVPVRRVKISLFVLT
FT                   AFCACLFAVLQVADIGSAAADRGLQKEFEAIIAAVIGGTLLTGGYGSVIGAAFGALIFG
FT                   VVQIGITYTNISSDWFRVFLGVMLLVAVLFNHYVRRRVSQS"
FT   gene            456119..456919
FT                   /locus_tag="BMA10229_A0435"
FT   CDS_pept        456119..456919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0435"
FT                   /product="ABC transporter, carbohydrate uptake
FT                   transporter-2 (CUT2) family, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02536"
FT                   /db_xref="GOA:A2S3B5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3B5"
FT                   /protein_id="ABN02536.1"
FT                   /translation="MSTPASHDTILALENVSKYFGKVIALSGVTLRVKRGEVHCLLGDN
FT                   GAGKSTLIKTLAGVHPPSDGQYLVDGKPVLFDSPKDALDLGIATVYQDLALVPLLSVAR
FT                   NFFMGREPQKKLFGLFNVMDLDSSARIARAKLAEMGINVRDAHQPIGTMSGGERQCLAI
FT                   ARAIHFGARVLILDEPTAALGVKQSLNVLKLIHAARAKGISVIFITHNVHHAYPIGDSF
FT                   TLLNRGRSLGTFTKDTISKNEVLDMMAGGAEMQKMIAELDGATI"
FT   gene            456933..458933
FT                   /locus_tag="BMA10229_A0436"
FT   CDS_pept        456933..458933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0436"
FT                   /product="iolC protein"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01582"
FT                   /db_xref="GOA:A2S3B6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018659"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3B6"
FT                   /protein_id="ABN01582.1"
FT                   /translation="MTSPTLSFAQNRPLDVICVGRVAVDLYAQQIGARLEDASSFAKYL
FT                   GGSSGNIAFGCARLGLKSAMLSRVGHDHMGRFVRETLAREGCDTSRLRTDTERLTALVL
FT                   LGLKDRDTFPLIFHRENCADMALDEDDFDEAFIASSKALLITGTHFSTEQVMRASRRAL
FT                   DYARRNQVRTVLDIDYRPVLWGLTGKADGETRFIANEGVTAHLQRILPLFDVVIGTEEE
FT                   FRIAGGKDALLDALAMVRAVTSAALVVKRGPLGCSIVDGDVPATLDALPVIRGVEVDVM
FT                   NVLGAGDAFASGFLSQWLRGRPFADAARAANACGALVVSRHGCSPAMPTPAELAYFLAE
FT                   AKRDPARMRRPDLDATLARLHRVTPARTPRDEVLGFAFDHRNQFFELARQTGASVARID
FT                   ALKRLFVEAVAQTEAQLGLAGRIGVLIDDRYGQDALNDATGRGWWVGRPVELPGSLPLE
FT                   FDHGRSIGTTLASWPLEHVAKCLVQYHPDEAAEPRIEQETQLRALYDAVQASGHELLLE
FT                   VIPPRRADLPQAADTVYRALKRLYNLGIHPEWWKLAPLDAAQWQAIDALIAERDPYCRG
FT                   VVLLGLSAGVDELVGGFGAAAASATCRGFTVGRTIFHEPSRAWLAGEIDDAELIARVRR
FT                   TFETLIGAWRAARTDARARGRHAGAAPRVAA"
FT   gene            458989..460929
FT                   /locus_tag="BMA10229_A0437"
FT   CDS_pept        458989..460929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0437"
FT                   /product="iolD protein"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00668"
FT                   /db_xref="GOA:A2S3B7"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3B7"
FT                   /protein_id="ABN00668.1"
FT                   /translation="MNDFIDDPAASVQRTVRLTAAQALVRYLAAQRVATGDGDAPLFGG
FT                   VFAIFGHGNVAGLGEALHQYRDALPTYRAHNEQAMAHSAIAYAKAHLRRRMMAVTTSIG
FT                   PGATNLVTAAALAHVNRLPVLLLPGDVFVSRAPDPVLQQIEDFHDGAISANDAFKAVSR
FT                   YFDRIVHPAQLLTALPRALRVLTDAALCGPVTLALPQDVQTMAYDYPAEFFAPRAVTFH
FT                   APAPVEAELDAALAPLRASARPFIVAGGGALYSEGGAAALAAFAERHGIPVGETQAGKS
FT                   ALPWDHPLNAGAIGVTGSPAANALAHDADCVIAVGTRLQDFTTGSNTLFARARVIGINA
FT                   NAFDALKHRATIVQADARLALEALGARLEGWRADAAWTARAHARANAWRDAVAAVTHAP
FT                   PRARALPYDADVIGAVQRSAPDSAARDIAVCAAGTLPAELHKLWRAAAPGGYHVEYGYS
FT                   CMGYEIAGGLGAKLAKPEREVIVMVGDGSYLMMNSEIATSVMLGAKLIVVVLDNRGYGC
FT                   INRLQQACGGAPFNNLFDDCVQGPLGAPRIDFAAHARALGARAEHVADIAALEAAMARA
FT                   RASDRTYVICIDTDPARTTPDGGWWWEVAVPEVSPRDAVRDARADYERHLAARAGAPAS
FT                   RSTPSTPESST"
FT   gene            460926..461846
FT                   /locus_tag="BMA10229_A0438"
FT   CDS_pept        460926..461846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0438"
FT                   /product="iolE protein"
FT                   /note="identified by match to protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00930"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR030823"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3B8"
FT                   /protein_id="ABN00930.1"
FT                   /translation="MSAPDIRIGINPLSWMNDDLPSLGGETPLAVALTEGREIGYEGFE
FT                   LGNKFPREPQALKALLAQYDLSLVSGWYSGRLAERGVQEEIDAVGPHLELLAKNGATVM
FT                   VYGEVAGTIQGSPAPLYQRPRFVDDAQWDAYAERVDAFARYTRAQGVRLGYHHHMGAYV
FT                   ESPADVDRLMASTSDAVGLLFDAGHMTFGGGDPVAELAKHIGRVCHVHCKDVRPAVIRL
FT                   ARNRNWSFLDAVIAGAFTVPGDGSIDFPTIVDMLKRHGYRGWLVVEAEQDPAVAPSYAY
FT                   AQKGYRTLRALVDAPLPPVGHKEAA"
FT   gene            461846..462649
FT                   /locus_tag="BMA10229_A0439"
FT   CDS_pept        461846..462649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0439"
FT                   /product="iolB protein"
FT                   /note="identified by match to protein family HMM PF06845"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01871"
FT                   /db_xref="GOA:A2S3B9"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3B9"
FT                   /protein_id="ABN01871.1"
FT                   /translation="MSLLVKGAGDGMSIARVTPESAHWKHVGFAAYRLKAGEAIALAEA
FT                   AREMCIVVLTGTVDIEAGDGTCWTALGSRDSVFDGVAPYALYLPPKLSVIVRASRDAEL
FT                   GVASAPAAGRYPARLIKPSQMRRSVRGSGANTRYVCDILPQTEPAEALLVVEVRTPSGH
FT                   SSSYPPHKHDTDNVPVESSLEETYYHRVHPPQGFVFQRVYTDSRDLDESMAAGDHDVVL
FT                   VPRGYHPVVVPYGYESYYLNVMAGPTRVWHFKNDPAHEWMLNGGR"
FT   gene            complement(462766..463470)
FT                   /locus_tag="BMA10229_A0440"
FT   CDS_pept        complement(462766..463470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0440"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02795"
FT                   /db_xref="GOA:A2S3C0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3C0"
FT                   /protein_id="ABN02795.1"
FT                   /translation="MSALLELRGVRAGYGALPVLDGVDLRIAAGEAVALVGRNGSGRST
FT                   LAKAIMGMVRVEGTVRIGGVDVAGAPTFAIARHRVGYVDEHRDVFALLSVEDNLRLGLR
FT                   GASGAAARAALADARERYPMLAERWRTKAGVLSGGEQQMLALACALIGAPRVLIVDEPA
FT                   EGLAPLAVEQVRACLAGAKAQGVALLLIEQRMQLAPALTSRVAVMGRGRIVYDGAAKAL
FT                   DAGIVERWLSVG"
FT   gene            complement(463467..465716)
FT                   /locus_tag="BMA10229_A0441"
FT   CDS_pept        complement(463467..465716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0441"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, permease/ATP binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03729"
FT                   /db_xref="GOA:A2S3C1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3C1"
FT                   /protein_id="ABN03729.1"
FT                   /translation="MPEALAWLAFVALLVVPALAWPRGWMLGYLAQTAAMIVLALSYNL
FT                   LLGTTGLLSFGHAAFAGLGAFVAAHSFNRYGLPLPLVPLAGGAAGAAFGALFGFVATRR
FT                   AGTAFAMITLGIGELVAAAAWSVPEWFGGAGGVSIDRAAGPALAGWEFGKPMHAYALIA
FT                   AWCVVAAVAMRVLVRTRLARLANAVRDNPARVAALGTDPCRVRFAMAIAAAFFAGVAGA
FT                   LTLIDVEVATAESVGMLRSGAVLFATVIGGTTAFFGPVVGAVLLTFFSVFVASVSRAWL
FT                   LYLGLLFVAVVLAAPGGASGRWRAWRDARRHGGARFDARRALPGAGAALAGGVAIVFAA
FT                   ELAYALQFAQNDARRAVIGPWRFDAGAPLGWGIAALAAALGMGLAHAARRWGRGAPRTN
FT                   GPAFADAIDTCGAACGSAELKARDAGDVDGSTNAASAANETNAVSIASTTSTTSMTSMT
FT                   SATSATSATSARRAARVSDNAPSPVFEVAAEPVGGGVHAASAPPALRMADVSKSFGATP
FT                   VLVGIDLTIRPGERHALIGPNGAGKSTLFNLIAGALAPTRGRIALNGIELGRRRPHAVA
FT                   RLGLARSFQQTSVFARMSVYDNLRCAALHAPRARRRWRREPAAAAAIDRAADAALASIG
FT                   LAAHRDALAGSLSYAQQRALDVGLALASGASVFLFDEPTAGMSREQARRTIELIRRATA
FT                   GKTVLMIEHDMDAVFGFADRVSVLVRGELVATGSPAAIRANAAVRAAYFGEAFER"
FT   gene            complement(465745..466680)
FT                   /locus_tag="BMA10229_A0442"
FT   CDS_pept        complement(465745..466680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0442"
FT                   /product="putative branched-chain amino acid ABC
FT                   transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03726"
FT                   /db_xref="GOA:A2S3C2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3C2"
FT                   /protein_id="ABN03726.1"
FT                   /translation="MQSVVLDLLNGLSYGLLLFMLCAGLTLIFGMLGVLNFAHASFYML
FT                   GAYAGYAIAARTSFWVALVAAPLAVGALGALCERTLLRRVRASGHLDELLLTFGLAYLI
FT                   AEGVKLVWGLAPLAAPVPAALDGAAFTVYGAVFSRYRAFMMLVSIAMLGALWAVLRASR
FT                   TGLVVRAALTRRAAVEALGHDVPRVMTLVFAAGTALAALAGVIGAPLAVIEPAMAQTLG
FT                   SVVFAVIVIGGLGSLAGALVASLVLGCAQTFAAASRASLSDAAQLAGIALPDAWRALTL
FT                   AQFAPLIPYLLLIVVLACRARGLFGERADV"
FT   gene            complement(466685..467134)
FT                   /locus_tag="BMA10229_A0443"
FT   CDS_pept        complement(466685..467134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0443"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02646"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3C3"
FT                   /protein_id="ABN02646.1"
FT                   /translation="MSSTKPVPLPRSAYRHFLPITTRWMDNDVYGHVNNVVYYSYFDTV
FT                   VNEYLIRRGALDVERGATIGLVVETQCNYFAPLVFPQRVEAGLRVARLGSSSVRYEIGL
FT                   FAHGEASAAAQGHFVHVYVDRATRRPVPLPEPLRAALAPLVAPAA"
FT   gene            complement(467035..467379)
FT                   /locus_tag="BMA10229_A0444"
FT   CDS_pept        complement(467035..467379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0444"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01067"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3C4"
FT                   /protein_id="ABN01067.1"
FT                   /translation="MTAARISSRMLAPMPARPLPRAFSRASARAMTPRAASPRGERAAI
FT                   AVIAACAPSAPSAACAAQPTGRSRRLTQPPFSRLAPTCPRPNPFRCRAAPIATSCRSRR
FT                   AGWTTTSTAT"
FT   gene            complement(467376..468524)
FT                   /locus_tag="BMA10229_A0445"
FT   CDS_pept        complement(467376..468524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0445"
FT                   /product="alcohol dehydrogenase, iron-containing family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03697"
FT                   /db_xref="GOA:A2S3C5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3C5"
FT                   /protein_id="ABN03697.1"
FT                   /translation="MAYIYYLTHIHLGDDALAMLGAECARSGIARPLVVTDKGVAAAGL
FT                   VDRALEALGLGALPVFDDTPSNPTEAAVLAAAQRYRDEGCDGLVAVGGGSAIDLAKGVA
FT                   IAATHPAPLTRYATIEGGSERITAAAAPLIAVPTTSGTGSEVARGAILILADGRKLGFH
FT                   SWHLLPKAAICDPSLTLGLPPGLTAATGMDAIAHCIETFLAPAFNPPADGIALDGLERA
FT                   WAHIERATHDGGDRAARLAMMSASMQGAMAFQKGLGCVHSLSHPLGGVKVDGKTSLHHG
FT                   TLNAVVLPAVLRFNESAPSVVAERRYARMRRVMNLPERADLSQALHDMTARLGLPTGLR
FT                   QMGVDEQAFDHVIEGALADHCHKTNPRIASADDYRRMLVESL"
FT   gene            468740..469075
FT                   /locus_tag="BMA10229_A0446"
FT   CDS_pept        468740..469075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01906"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03828"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S3C6"
FT                   /protein_id="ABN03828.1"
FT                   /translation="MADPQLITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQT
FT                   LFGGNISLYTSLCERARQDAYERMIDEARRMGGNAIVGMRYDATEIASGVTEVLCYGTA
FT                   VQAVRAG"
FT   gene            complement(469175..469804)
FT                   /locus_tag="BMA10229_A0447"
FT   CDS_pept        complement(469175..469804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0447"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03065"
FT                   /db_xref="GOA:A2S3C7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3C7"
FT                   /protein_id="ABN03065.1"
FT                   /translation="MRDHDPPNGRPAVAGAFGGSPYSPSTMTTADYRFCPRCARALAER
FT                   ADPVDEGGRLRRACPDATCGYVHWNNPVPVVAAIVEYEGRILLARNAAWPEGMFALITG
FT                   FLEHGETPEAGIAREVREETSLEAESVTLVGVYEFIRKNELIIAYHVRASGTIRLSPEL
FT                   LEYRLIEAPKLRPWRAGTGQAVADWMRARGLEFEFVDFPGAVANPG"
FT   gene            470018..470695
FT                   /locus_tag="BMA10229_A0448"
FT   CDS_pept        470018..470695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0448"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01725"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3C8"
FT                   /protein_id="ABN01725.1"
FT                   /translation="MTDRRSHHDDDLLSLIDELEAESRAIDARMSHLDALVSWHDSLIF
FT                   EAENLAKLQRSLADIREQSGQIPHAPHDVRRFRLGLLWMGAVAAYEGAMHELFVNTLRV
FT                   ESLRAKALDRLRQLIRDGASPHRDIKTADAQSVTRWFTLTTIADPLVAAKRFDTLYGIA
FT                   TITPDPAWCRRVLGIRNAFAHRNGIGVDIREEALHELIDRLDDLASEFHSAFLHEAGKL
FT                   TET"
FT   gene            complement(470768..472408)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0449"
FT                   /note="MucD; this gene contains a frame shift which may be
FT                   the result of a sequencing error; identified by match to
FT                   protein family HMM PF00089"
FT   gene            complement(472772..473329)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0450"
FT                   /note="putative membrane protein, truncation; comparison of
FT                   this gene to its homologs suggests this gene has been
FT                   truncated"
FT   gene            complement(473401..474234)
FT                   /locus_tag="BMA10229_A0451"
FT   CDS_pept        complement(473401..474234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0451"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03419"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABN03419.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(474258..474521)
FT                   /locus_tag="BMA10229_A0452"
FT   CDS_pept        complement(474258..474521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0452"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02283"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABN02283.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            complement(474552..475268)
FT                   /locus_tag="BMA10229_A0453"
FT   CDS_pept        complement(474552..475268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0453"
FT                   /product="conserved hypothetical protein, truncation"
FT                   /note="identified by match to protein family HMM PF06779"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02109"
FT                   /db_xref="GOA:A2S3D2"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3D2"
FT                   /protein_id="ABN02109.1"
FT                   /translation="MSSLPSFLAAASGSRGPSHDQRAACRAALAGAVALAVALGVGRFA
FT                   FTPLLPLMLAGGELDIRHGGWLASANYAGYFVGAMTCARIAVDPARMVRAGLAATVLLT
FT                   FAMGLASPFWVWALVRFVGGAVSAWTFVFASQWGLRRVVEHGAPAWGGVIYTGPGIGIV
FT                   ATGLIGFALAGRHAALGWIGFAAASAVLTAFVWRAFGAAGAGTDGGQSRGGAKRAGDGV
FT                   GVADVTCPLQTGPAGV"
FT   gene            475355..476380
FT                   /locus_tag="BMA10229_A0454"
FT   CDS_pept        475355..476380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0454"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00883"
FT                   /db_xref="GOA:A2S3D3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3D3"
FT                   /protein_id="ABN00883.1"
FT                   /translation="MTDHSRKMNNSDSIHPTERIMDLAALAIFRAVVRENGVTRAAAKL
FT                   NRVQSNVTTRIKQLEEQLGAPLFVRDGRRLVLTPAGETLLPYAERLLALADEARHAVTE
FT                   NRPHGRLRLGAMESTAASRLPALLARYHQAWPDVTLELVTGTTGKLIGLVRDFELDAAL
FT                   VATPAGSEALGEPFETASAFTEELVLLTPRGHPRVRTPRDVRLPTLVAFERGCAYRGCV
FT                   ERWYAAEGLKPERVLELGSYHAIVACVAAGAGVAVAPRSVLAVQREPDSLGVHPIDGMP
FT                   PIDTMLVWRQGHFSAALAALRDALRDAAAAANATDVAAHEAAKVAPRRTRRGAARETLP
FT                   A"
FT   gene            complement(476884..479508)
FT                   /gene="alaS"
FT                   /locus_tag="BMA10229_A0455"
FT   CDS_pept        complement(476884..479508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="BMA10229_A0455"
FT                   /product="alanine--tRNA ligase"
FT                   /EC_number="6.1.1.7"
FT                   /note="identified by match to protein family HMM PF01411;
FT                   match to protein family HMM PF02272; match to protein
FT                   family HMM PF07973; match to protein family HMM TIGR00344"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03711"
FT                   /db_xref="GOA:A2S3D4"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S3D4"
FT                   /protein_id="ABN03711.1"
FT                   /translation="MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQF
FT                   KDVFLGAETRPYSRATTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRD
FT                   AIHYAWELLTSVYKLPADKLWVTVYHDDDEAYDIWAKEVGVPAERIIRIGDNKGARYAS
FT                   DNFWQMGDTGPCGPCSEIFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGN
FT                   MTRLPKPCVDTGMGLERIAAVLQHVHSNYEIDLFQQLIKASARETGVADLANNSLKVIA
FT                   DHIRACSFLIVDGVIPGNEGRGYVLRRIVRRAIRHGYKLGRKAPFFHKLVADLVAEMGA
FT                   AYPELKEAEPRVTDVLRQEEERFFETIEHGMSILEAALAELDAAGGKTLDGELAFKLHD
FT                   TYGFPLDLTADVCRERGVTVDEPAFDDAMARQREQARAAGKFKATQGLEYTGAKTTFHG
FT                   YEEIAFDDAKVVALYVEGASVGEVKAGESAVVVLDHTPFYAESGGQVGDQGVLANAATR
FT                   FAVGDTLKVQADVIGHHGELEQGTLKVGDVVRAEIDAARRARTARNHSATHLMHKALRD
FT                   VLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEAIVNEQVLANAPGIVRVMPYDD
FT                   AVKGGAMALFGEKYGDEVRVLDLGFSRELCGGTHVHRTGDIGLFKIVAEGGVAAGIRRV
FT                   EAITGDNAVRYVQALDARVNAAAAALKAQPSELLQRIGQVQDQVKSLEKELGALKSKLA
FT                   SSQGDELAQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIVLAAVDGGKVS
FT                   LIAGVTADASKKVKAGELVNFVAQQVGGKGGGRPDMAQAGGTEPAKLPAALAGVKGWVE
FT                   ARL"
FT   gene            480176..481396
FT                   /locus_tag="BMA10229_A0456"
FT   CDS_pept        480176..481396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0456"
FT                   /product="CAIB/BAIF family protein"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02295"
FT                   /db_xref="GOA:A2S3D5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3D5"
FT                   /protein_id="ABN02295.1"
FT                   /translation="MGALSHIRVLDLSRVLAGPWCAQTLADLGADVIKVERPECGDDTR
FT                   HWGPPYLKTPDGADTREAAYYLAANRNKRSVTVDIATPEGQRIIRELAAQCDVVLENYK
FT                   VGQLAKYGLDYASLAAVKPGLVYCSVTGFGQTGPYAHRAGYDFIIQGMGGFMSITGERD
FT                   GLPGGGPQKAGVAIADLATGLYSTIAILAALAHRDRTGEGQHIDMALLDVQVALLANMN
FT                   TNFLASGKPPVRWGNAHPNIVPYQTFETSDGWIIVAVGNDGQFRKFVEAGGRPELADDE
FT                   RFATNPARVRHRDTLVPIVAAMTKTRTKREWLDALEALGVPCGPINDLAEVFDDEQVRA
FT                   RGMQVDLPHPSGASAKLVRNPIRMSATPPDARSAPPLLGEHTDAVLRDLLGYGDAAIAA
FT                   LRDKRVV"
FT   gene            complement(481526..481639)
FT                   /locus_tag="BMA10229_A0457"
FT   CDS_pept        complement(481526..481639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01737"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3D6"
FT                   /protein_id="ABN01737.1"
FT                   /translation="MSERRAGRSRAGDVSVTFFDASTYAGSRADSARRSAR"
FT   gene            complement(481720..481959)
FT                   /locus_tag="BMA10229_A0458"
FT   CDS_pept        complement(481720..481959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0458"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02225"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3D7"
FT                   /protein_id="ABN02225.1"
FT                   /translation="MRGNALEDSIMMKKTHFLVRATVIAVVLASLGACAMNRTQRNAGI
FT                   GAAAGGALGYLITGGPIGTVAGAAAGGLVGAGVR"
FT   gene            482207..483916
FT                   /gene="glnS"
FT                   /locus_tag="BMA10229_A0459"
FT   CDS_pept        482207..483916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="BMA10229_A0459"
FT                   /product="glutamine--tRNA ligase"
FT                   /EC_number="6.1.1.18"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM PF03950; match to protein
FT                   family HMM TIGR00440"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03217"
FT                   /db_xref="GOA:A2S3D8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3D8"
FT                   /protein_id="ABN03217.1"
FT                   /translation="MSTERNDATAPSNFIRNIIDDDNRTGKWSGRVETRFPPEPNGYLH
FT                   IGHAKSICLNFSVARDYGGVCHLRFDDTNPEKESVEYVNSIVDAVRWLGFDWQKAGVDH
FT                   QYFASDYYDKLYEFAELLIQRGCAYVDSQSADEMRTNRGSLTEPGTPSPFRDRSPDENL
FT                   ALFRRMKAGEFAEGEHVLRAKIDMSSPNMNMRDPVIYRIRYAHHYRTGDKWCVYPMYDY
FT                   THCISDALEGITHSLCTLEFEDHRPLYDWVLNQLADAGVFARPLPQQIEFSRLNLTYAI
FT                   TSKRKLLQLVTEGHVDDWDDPRMPTIVGVRRRGFTPESIQLFCERIGVTKVDSWIDMSV
FT                   FEGALRDDLDDKAPRTVAVLDPLKLVIDNYPQGQSEECTAPVHPHHPERGQRTFPISRE
FT                   LWIEREDFSEHPPKGYFRLFPGNKVRLRYGYVIECTGADKDEHGNVTAVHCNYYPDSKS
FT                   GTEGANNYKVKGNIHWVSAAHACPAEVRIYDRLFKEPHPDAGGRNFLEALNPDSKKIVQ
FT                   AYLEPGARDALPEARYQFERHGYFVADRVDSKPGQPVFNRIVGLRDSWGKPA"
FT   gene            complement(484248..484730)
FT                   /locus_tag="BMA10229_A0460"
FT   CDS_pept        complement(484248..484730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0460"
FT                   /product="NUDIX domain protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03698"
FT                   /db_xref="GOA:A2S3D9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3D9"
FT                   /protein_id="ABN03698.1"
FT                   /translation="MSAMKPPGRTRARTVSCGVVLLDSGGCVLLAHATDTTHWDIPKGQ
FT                   GEPGETAQQAALRELAEETGIVLDPARLVDLGLFAYRRDKDLHLFAARAAAGETDLSRC
FT                   TCTSMFPSRRDGTMIPEMDAFRWTAPADVDAYASRSLARLFGTTLSLAALHRTLAG"
FT   gene            complement(484749..485135)
FT                   /locus_tag="BMA10229_A0461"
FT   CDS_pept        complement(484749..485135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0461"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02777"
FT                   /db_xref="InterPro:IPR032635"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3E0"
FT                   /protein_id="ABN02777.1"
FT                   /translation="MTTRARVSILPRVLVGAACAAAALGAHAQNNLNFLNDTPISYFSK
FT                   ADTASLAKAVQKVRDEGKDGETVDWVNDGRGTKLAAKLTPSTTEQEGRTCREIKTEIEA
FT                   KGQSMTLRPLYCKTAAGKWQLQKR"
FT   gene            complement(485423..486826)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0462"
FT                   /note="putative beta-N-acetylglucosaminidase; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00933; match to protein family HMM PF01915"
FT   gene            487437..487616
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0463"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            487613..488473
FT                   /locus_tag="BMA10229_A0464"
FT   CDS_pept        487613..488473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01280"
FT                   /db_xref="GOA:A2S3E3"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3E3"
FT                   /protein_id="ABN01280.1"
FT                   /translation="MINMRFLPRTFTPIRQCAQHSTVLFMLLSIFGAAGAQAEIRRITA
FT                   AQCAAMHAESVISDDSPVQCERLRNVSFDYVNFDGRIQPGEIVVLDALAERVQTIFRTL
FT                   YDMRFPLSKAAPIERYHGDDDASMRDDNTSAFNARRMTGRAEWSMHAYGVAIDVNPVQN
FT                   PYVSFGEDGEARVLPASAAKTSMNRLDERPGKPARPGMAERVVDVFADNGLLRWGGYWD
FT                   DPIDYQHFEVGSPALVARMVDAPPDDARRMFEQYIASYADCLARAPHASHAAARAACVA
FT                   DALRE"
FT   gene            complement(488517..489932)
FT                   /locus_tag="BMA10229_A0465"
FT   CDS_pept        complement(488517..489932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0465"
FT                   /product="di-heme cytochrome c peroxidase family protein"
FT                   /note="identified by match to protein family HMM PF03150"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02167"
FT                   /db_xref="GOA:A2S3E4"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3E4"
FT                   /protein_id="ABN02167.1"
FT                   /translation="MMRRLPRYARQHRSFFVAPRAFAAAAALAAGVAACDANGPGASAA
FT                   AAVAPAVPAASAASAASAASAARPAPLAQPAAPAVVDSQPQTRAQVYEAVKQMTALGRQ
FT                   LFFDPSLSGSGKLACASCHSPQHAFGPPNALPAQFGGDDLRQQGFRAVPTLKYLQKVPA
FT                   FSEHYHESDDEGDESVDAGPTGGLTWDGRVDSGAEQARVPLTSPFEMNGTPEKVARAVR
FT                   AAPYAPAFRAAFGARVLDDDRATFEAVLQALGTFEQAPDVFYPYTSKYDAYLAGRARLT
FT                   RAELHGLQVFNDEKKGNCASCHVSRRGLDGSPPQFSDFGLIALGVPRNRALAVNRNPNF
FT                   YDLGACGPERRDLKGRDEFCGLFRTPTLRNVALKKTFFHNGVYHSLDDVLRFYAERDTH
FT                   PEKFYPVKRGVVQKFDDLPKRYWKNLNDEPPFERKRGDPPAMTDAEIRDVIAFLGTLTD
FT                   GYDPRAKPAGGAR"
FT   gene            490166..491749
FT                   /locus_tag="BMA10229_A0466"
FT   CDS_pept        490166..491749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0466"
FT                   /product="acid phosphatase"
FT                   /note="identified by similarity to GB:AAF77194.1; match to
FT                   protein family HMM PF04185; match to protein family HMM
FT                   TIGR03397"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01446"
FT                   /db_xref="GOA:A2S3E5"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017768"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3E5"
FT                   /protein_id="ABN01446.1"
FT                   /translation="MNKHWIRVSPIALAAAIGLTACGGDDVTSPGLSAVKNVVVIYAEN
FT                   RSFDNLYGNFPGANGLQNVTAASAAQVDRDGTPLATLPKIWGGLTAAGVTPAVTEAMTA
FT                   NLPNAPFAIDDPNGFNTPMSVTTRDLVHRFYENQMQIDGGKNDKYAAWSDAGGLVMGHY
FT                   TADPSKLPLWKLAQQYTLADNFFMGTFGGSFLNHQYLICACAPFYPNADKSPAASQISV
FT                   VNPDGVTLTTASNSPASALSGPPKFVKSGGLTPDFYAVNTMQPPYQPSANAAPTGGDPN
FT                   LADPANPSTLPPQTQQNIGDLLTSAGVSWAWYAGAWGAALQAAQSGTSGVIYGPNMTSP
FT                   NFQPHHQPFNYYANQAPGSANRAQHLLDAGSNGAALIQAIDAGKLPQVTFYKPQGNLNE
FT                   HPGYTDVASGDQHIADVIAHLQKSPQWNNMVVIVTYDENGGFWDHVAPPKGDRWGPGTR
FT                   IPAFVISPFAKQGFVDHTQYDTASILRFITRRFALPKLAGLKQRDDALVANGFKPMGDL
FT                   TNALTLSTGN"
FT   gene            491947..493140
FT                   /locus_tag="BMA10229_A0467"
FT   CDS_pept        491947..493140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0467"
FT                   /product="alcohol dehydrogenase, short-chain family"
FT                   /note="identified by match to protein family HMM PF07055"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02540"
FT                   /db_xref="GOA:A2S3E6"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S3E6"
FT                   /protein_id="ABN02540.1"
FT                   /translation="MIIKPRVRGFICVTTHPAGCAASVREQIAYVARRGPIERGPKKVL
FT                   VIGASTGYGLAARIAAAFGVGAATLGVFFERAPADAKPGTAGWYNSAAFHDEAAARGLQ
FT                   ATSVNGDAFSDEIKHKTIDAIRRDLGQVDLVVYSVAAPRRTHPKTGVTHQSTLKPIGHA
FT                   VRLRGIDTDNEAIKETLLQPATPDEIADTVAVMGGEDWRMWIDALDAAGVLADGAKTTA
FT                   FTYLGEQVTHDIYWNGSIGEAKKDLDRTVLALRGKLAARGGDARVSVLKAVVTQASSAI
FT                   PMMPLYLSLLFKVMKARSTHEGCIEQVDGLLRDSLYSAQPHVDAEGRLRADRLELDPAV
FT                   QARVLELWDQVTDDNLYTLTDFAGYKAEFLRLFGFGIDGVDYDAPVEPNVRIPNLIE"
FT   gene            493759..494946
FT                   /locus_tag="BMA10229_A0468"
FT   CDS_pept        493759..494946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0468"
FT                   /product="putative multidrug resistance protein"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03462"
FT                   /db_xref="GOA:A2S3E7"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3E7"
FT                   /protein_id="ABN03462.1"
FT                   /translation="MPDPNDAAERGNDERSEHDEPGRERARERREEADAHARDARPGDA
FT                   PSGERKRPGKKPLVVLAIIVVLLLVGAFVWWFATRNQVSTDDAYTDGNAITIAPKVSGY
FT                   VVALAIDDNVYVHRGDLLLVIDQRDYQAQVDAARAQLGLAQAQLDAAQVQLDIAHVQFP
FT                   AQYRQAQAQIEAAQASFRQALAAYERQHAVDARATSQQAIDVADAQRLTADANVATARA
FT                   QARTASLVPQQIRQAQTAVEQRRQQVLQAQAQLEAAQLALSYCEVRAPSDGWITRRNVQ
FT                   LGSFLQAGAALFAIVTPQLWVTANFKESQLERMRAGDRVSVSVDAYPNLELHGHVDSIQ
FT                   LGSGSRFSAFPPENATGNFVKIVQRVPVKIAIDGGLPRDPPLGIGLSVVPKVYLK"
FT   gene            494943..495122
FT                   /locus_tag="BMA10229_A0469"
FT   CDS_pept        494943..495122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0469"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01110"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3E8"
FT                   /protein_id="ABN01110.1"
FT                   /translation="MTMTSITATAKTRDHAPTEPGAARDARHRIHPVRRAAAPERARLA
FT                   AVGGAASSLLAPCR"
FT   gene            495119..496738
FT                   /locus_tag="BMA10229_A0470"
FT   CDS_pept        495119..496738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0470"
FT                   /product="drug:H+ antiporter-2 (DHA2) family protein"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01914"
FT                   /db_xref="GOA:A2S3E9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3E9"
FT                   /protein_id="ABN01914.1"
FT                   /translation="MNGSTPTPPAAPRRDRNGNGDGTWRPAANPWLIAVVVTLAAFMEV
FT                   LDTTIVNVALPHIAGTMSASYDEATWTLTSYLVANGIVLPISGFLGRLLGRKRYFVLCI
FT                   VAFTICSFLCGIATDLGQLIVFRVLQGLFGGGLQPNQQSIILDTFPPEQRNRAFSISAV
FT                   AIVVAPVLGPTLGGWITDNFSWRWVFLLNVPIGVLTSLAVIQLVEDPPWKRGRARGLSI
FT                   DYIGITLIAIGLGCLQVMLDRGEDEDWFASTFIRTFAGLTAAGLVGATFWLLYAKKPVV
FT                   DLSCLKDRNFTLGCVTIATFAVVLYGSAVLVPQLAQQRLGYTAMLAGLVLSPGALLITL
FT                   EIPIVSKLMPYVQTRFLVCFGFLLLAASLVYSHTLVPDIDYPNLLKIRSAQSLAIGFLF
FT                   VPITTLAYLTVPRRLNDDASALFTMFRNVAGSIGISLSTALIRERAQARMAHLSTHLSP
FT                   LSQNFDDTLRQNAQTIASLSGMPPPAALQTASGQLYETFVSQATILAYLDVFAMLAIFC
FT                   FVCTPLTLLFSPVKAAGGPGGH"
FT   gene            496740..498284
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0471"
FT                   /note="efflux system protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF02321; match to
FT                   protein family HMM TIGR01845"
FT   gene            498263..498424
FT                   /locus_tag="BMA10229_A0472"
FT   CDS_pept        498263..498424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0472"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02369"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3F1"
FT                   /protein_id="ABN02369.1"
FT                   /translation="MQGSLQLTTDLVSLYKALGGGWQPVPAAQTPAPAALDAPTQDTPL
FT                   GATAPARR"
FT   gene            complement(498728..499360)
FT                   /locus_tag="BMA10229_A0473"
FT   CDS_pept        complement(498728..499360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0473"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196; match to protein
FT                   family HMM PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01616"
FT                   /db_xref="GOA:A2S3F2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3F2"
FT                   /protein_id="ABN01616.1"
FT                   /translation="MSVQVLIADDHPLVLLGVRHMLAGMGDVSIVGEAHDPAGLLALLA
FT                   ATPCDIVITDFAMPEQPAADGLAMLTAIRDGYPSVRVIVLTMLDNPVLMHTMRQAGALA
FT                   VLSKRGDLDELPRALAAVYQGRPFVGTHAGAAGGGAMRGTDAPRQLSPREIEVVRLCAT
FT                   GMTMTDIANRYGRSIKTVSTHKHNAMGKLGLKSDVDLFMYATENGLV"
FT   gene            complement(499361..501280)
FT                   /locus_tag="BMA10229_A0474"
FT   CDS_pept        complement(499361..501280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0474"
FT                   /product="sensor histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02315"
FT                   /db_xref="GOA:A2S3F3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3F3"
FT                   /protein_id="ABN02315.1"
FT                   /translation="MLWGSHVLVALLSYGWAHRDLKRLQAALRASRGSLATASHELRAP
FT                   VNGMLALVELVRQGLLAPEQQRLLGLVQDSGQSLARVLNDILDHASIEAGQFAIEKTRV
FT                   DVRELVDSVSAMLAVHAHRKGLRLRLHVDANVPAAVLTDGNRLRQILVNLIGNGIKYTE
FT                   RGSVSVRVRAADDVDGMVELVATIVDTGIGIAADELRRLFTPFARATRGARRMESGTGL
FT                   GLAIARKLARLLGGDVTLTSDEGRGTTATARIRCAVAARGYANDALAGRVVSIDVGDAA
FT                   LAATLAAYARAAGVRVAARGAPDVEAVLCDDARVDASRTQLGWVGVTDAPALAGWTDSG
FT                   THVRLSSNPLGWRAFIDGLRAALDARDARDAACAHTAARAEPGAYRVLVVDDQEMNRIV
FT                   LRYQLDALGHHARLCASGDEALRALGTAAYDVVLTDCRMPGMDGIALTAAIRAHPDARV
FT                   RATPIVGVTALVSDAEHARCVDAGMTLCIGKPTTLDALERALVEAIEPVPALRFDPSRI
FT                   DAARLFAGFGASSAPGAARDAILRACGRALERDRDTLTRHLRDGLSERELRAWCHTARG
FT                   TYSLFGQAHVDALLDEFHHLLTAGDARAIRGATRDILAMVNHLLRCVAHSAQSRDRGDP
FT                   KGGR"
FT   gene            501290..501856
FT                   /locus_tag="BMA10229_A0476"
FT   CDS_pept        501290..501856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0476"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01153"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3F4"
FT                   /protein_id="ABN01153.1"
FT                   /translation="MRPLAGLSRDQHALLHPVGQLRQRQERERRCAETYEYASTEFASA
FT                   KAVAFHTFIPYGTSPEYASLPFPEKTRTSFFCGVPLMGTVVYPIVRALSPIPRFDGAQS
FT                   RAAASALEPPRVRAGRPASESRRSTHAHRDILAPDLAISGFAPRQIYASSENEKTDSAF
FT                   PFTSVSPVRFGSHARNDCRIAPIFG"
FT   gene            complement(501853..502818)
FT                   /locus_tag="BMA10229_A0475"
FT   CDS_pept        complement(501853..502818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05229"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03763"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3F5"
FT                   /protein_id="ABN03763.1"
FT                   /translation="MTPFRLFFVRIAATLALGLFSALHAHATCSVVSAAAASFGTVTSF
FT                   AVARQPQSTSTTSSGLSCSGALLGLFVIGDQINASITSANGGKLVGPTGDAVPYTVFAD
FT                   QNYSIKLDLGVTYNWASGQLLNLLGIFGGPAQTLPMYFRTVQGSNVAAGTYTDTLTIAW
FT                   NWDYCSGIGVLGICLGRDRGSGTAVVPVTITVTNDCMIAAPDVNFGAAPTVASFAPVTG
FT                   SVSLTCTKGMVYTVGLSSGANPHASGRRQMANGANRLQYDIFGPGAAAVWGQSANRAGS
FT                   GAAADGRSAQQFPYTARLYPDQPTPAVGTYTDSVVVDVRY"
FT   gene            complement(502834..505245)
FT                   /locus_tag="BMA10229_A0477"
FT   CDS_pept        complement(502834..505245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0477"
FT                   /product="fimbrial usher family protein"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02003"
FT                   /db_xref="GOA:A2S3F6"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3F6"
FT                   /protein_id="ABN02003.1"
FT                   /translation="MKRYNDDRTSGLPRRRAAAWAVGIAFAAAGHARAGETATLADSFG
FT                   RALPPVGGTAAHGTLYLELVVNALSTGRIVPVRYRDGIYYARAGDLAQASVRTGAQPDA
FT                   LVDLSRLDGVQVEYESAEQRLKLTVPPDWLPRQTLGSPRLYDRTPAAVSFGLLFNYDVY
FT                   ANSPTLGTSYTSAWTEQRLFDRWGTVTNTGVYRRDYGGGAGGVGSNRYLRYDTFWRYSD
FT                   QDRLRTYTAGDVITGALSWSSAVRLGGVSVERDFKVRPDIVTYPLPQFSGQAAVPTAVD
FT                   LFINGSKTTTGQVNPGPFTMNNVPFINGAGEATVVTTDALGRQVATTIPFYVANTLLQK
FT                   GLSDYSLSAGAMRRDYGIRSFSYGKFAASGTARHGLTDYLTLEGHVEGGERFALGGLGF
FT                   DLGIGMFGVLGVAATQSRLAGASGRQYAFGYSYASQRFSVSLQRIQRTNGFRDLSVYDL
FT                   PANVAYRLVRSSTQATGALNLGALGGTLGAGYFDVRGADGARTRIANLSYTRPLWRRAT
FT                   LYASVNKTVGEHGVAAQLQLIVPLGEPGVVTGALARDANNSFSERVQYSRSVPSDGGLG
FT                   WNLAYAGGGSHYQQADATWRNRYFQAQGGVYGYGAGRGYARWGEVQGSVVVMDGAVLPA
FT                   NRVDDAFVLIDTQGRGGVPVRYENQLVGKTDGGGHLLVPWAPSYYAGKYEIDPLDLPSN
FT                   VRAPIVERRVAVRDHGGALVTFPIRRIVCAQIALVDAAGRPVAIGSRVLHEESGETALV
FT                   GWQGETYLEGLSALNHLRVRTPDGRTCRATFAADVDAAQMSRVGPLACGE"
FT   gene            complement(505290..506132)
FT                   /locus_tag="BMA10229_A0478"
FT   CDS_pept        complement(505290..506132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0478"
FT                   /product="putative fimbrial assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03346"
FT                   /db_xref="GOA:A2S3F7"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3F7"
FT                   /protein_id="ABN03346.1"
FT                   /translation="MMKVSRSPGAPARAARALRCALLGAAAAAPFVAQHAHAAASVMIW
FT                   PIDPVIESGDRAAALWLENRDRRPVTLQVRVLGWREANGEDVYDEDQPRVAGSPPMATV
FT                   EPGKRQLIRLTRLADTAPGTEQAYRVLIDEIPQPDDDAQPAASGTSLGVKFQMHYSVPL
FT                   FVYGDGLWTKEHPDRRRDSATAGRPALRWRVEHDGGKRWLVVSNRGPVHARITHAAFEA
FT                   SGARADFARGLLGYVLPGARMRWALPETLKLHSNSKLIATVNGVADLAIDVDGAASNR"
FT   gene            complement(506147..506653)
FT                   /locus_tag="BMA10229_A0479"
FT   CDS_pept        complement(506147..506653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05229"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00932"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3F8"
FT                   /protein_id="ABN00932.1"
FT                   /translation="MLFLLGVAAWPAAGRADTLLPRTQAFTVSAQIVAGCGVAGGGPAS
FT                   GLNFGTLDFGAHPAVATGQVSAAVGGGALQIECSPGSTLKMTIDGGANASAGNTQRNLA
FT                   SGGARVAYRLYSDPARTQAIAVGQAVSLPVSGTITLPIYGALTLPGGGAPAGTYTDTAQ
FT                   VTLSY"
FT   gene            complement(506748..507308)
FT                   /locus_tag="BMA10229_A0480"
FT   CDS_pept        complement(506748..507308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05229"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01412"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3F9"
FT                   /protein_id="ABN01412.1"
FT                   /translation="MKAHWKVWAALACVSACAGVQAQTSPLTGTVNSQLVLTTGCAVDT
FT                   GGGSVNSANFGTLDFGTQPSGFTGRLTSAAKGGGSTSTQVTCSPDVTSIQVTIDGGQNA
FT                   SKGAAVGTGTRALANGASFVPYEVYADAGHSQQYVSGTAQSVAVPTPGAAFELPLYGVV
FT                   NKTNASALAAGTYTDVLNVTLGW"
FT   gene            complement(507361..507864)
FT                   /locus_tag="BMA10229_A0481"
FT   CDS_pept        complement(507361..507864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05229"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02998"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3G0"
FT                   /protein_id="ABN02998.1"
FT                   /translation="MLFFAAASAGQLTGTMQVNLQVSRGCEVAGVAASGDLGRLDFGAQ
FT                   GPLWSDYLTADGRATSSGAVRVVCSPDVNGFLVSIDGGRNGDQSTRYLVKRGANGRVAG
FT                   RIPYNVYRDAARSVPYVPLMPQSFLVDGGRDDVTLPVYGVVNGMTRAVPSGTYEDFLGI
FT                   TLDW"
FT   gene            508046..508210
FT                   /locus_tag="BMA10229_A0483"
FT   CDS_pept        508046..508210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0483"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03639"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3G1"
FT                   /protein_id="ABN03639.1"
FT                   /translation="MGERQRIARRHRGRQSRNSDSVDPVFNWLKSTRLVYSIATISESR
FT                   PDYIENIIE"
FT   gene            complement(508164..508385)
FT                   /locus_tag="BMA10229_A0482"
FT   CDS_pept        complement(508164..508385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0482"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03767"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3G2"
FT                   /protein_id="ABN03767.1"
FT                   /translation="MPFGLARRCVRAARMADLVTPFAHGARVRARFPKTFKHCQIFRNS
FT                   DYSDSNNYVGHSSSIQLYFRCNRGAILK"
FT   gene            508415..508585
FT                   /locus_tag="BMA10229_A0485"
FT   CDS_pept        508415..508585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0485"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02144"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3G3"
FT                   /protein_id="ABN02144.1"
FT                   /translation="MKFRHFCRVTGRQWRLNEDRRFRRAPRVKRPIDSHCTSDISFIAF
FT                   YTLAHIASNTE"
FT   gene            complement(508539..508658)
FT                   /locus_tag="BMA10229_A0484"
FT   CDS_pept        complement(508539..508658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0484"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01635"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3G4"
FT                   /protein_id="ABN01635.1"
FT                   /translation="MRRCRHAARPDAERAALRSAARRMIIRYSKQYAQACKKR"
FT   gene            complement(508723..509622)
FT                   /locus_tag="BMA10229_A0486"
FT   CDS_pept        complement(508723..509622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0486"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02871"
FT                   /db_xref="GOA:A2S3G5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3G5"
FT                   /protein_id="ABN02871.1"
FT                   /translation="MMMESKHLRYFLAIADTGSLTHAAIRLGVAQPALSHALTKMEREL
FT                   GVKLFDRSRRGATLTTAGEAIVDDIRLSLARMDAAARRASEIGAQRAGRLSIGFVSAAL
FT                   FDTLPSAVCALRAASPRVDLVMREMSNAEQVVALERGEIDIGILHTPVAIGGPVHEKLI
FT                   RRDPLIAVIPKSFPRQPDGSITLRELSRAGLIWFPHEQLPSIRAAILSAFRLAGHPIEV
FT                   VQDANRTLTVIACVAAGCGVSLLPSSIRTLTFEGVDFSPVSDGHALPEFPLTAIWPKRS
FT                   RRTLADRFAELLPRFQPN"
FT   gene            510123..511319
FT                   /locus_tag="BMA10229_A0487"
FT   CDS_pept        510123..511319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0487"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03128"
FT                   /db_xref="GOA:A2S3G6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3G6"
FT                   /protein_id="ABN03128.1"
FT                   /translation="MFSLVIPALLTAWGIGKGQAGLIGGATLAAGAIGGLLAGMIADRF
FT                   GRVRALQITVCWFSLFTFLSAFAQNFEQLLVLKTLQGLGFGGEWTAGAVLLSETIRARH
FT                   RGKAMGIVQSAWGFGWGGAVLLYTLVFSWLPPEWAWRVLFAIGVLPALLVLYIRRAIPE
FT                   PPRDDARVAVSTSAAAAQTAPARASAKSIFDPSVLRMTIVGGLIGVGAHGGYHAITTWL
FT                   PTYLKTERHLSVLGTGAYLAVIIVAFIIGCMTSAYLQDRIGRRRNLMLFSACCVVTVNL
FT                   YVMLPLDNVAMLLLGFPLGFFAAGIPATLGALFNELYPRNVRGRGVGFCYNFGRVASAI
FT                   FPVLVGHMGTSMPLGVALGIDAGIAYGLVFVAVWFLPETRARDIQPSQPEARIREAAL"
FT   gene            511364..512356
FT                   /locus_tag="BMA10229_A0488"
FT   CDS_pept        511364..512356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0488"
FT                   /product="hydrolase"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01346"
FT                   /db_xref="GOA:A2S3G7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3G7"
FT                   /protein_id="ABN01346.1"
FT                   /translation="MDQASNDPAVETTGRPFATRTHEARKAHEAREAREAHDKRAPLVD
FT                   AWYGSGAEPIEAVDSHAHVFLRSLPRIPSARHSPEYDATLESYVAHLSACGITHAVLVQ
FT                   PSFLGTDNHFFVDALARYPQRFRGIAVVNPCTAEDEFARLEATDVVGIRLNLVGLPIPD
FT                   FTAPRWRALLARANALGWHVEVHRRAADLPAIIPALLDQSCRVVVDHFGRPAPHLGTLD
FT                   PGFRFLLSIAGTGQVWVKLSAAYRNIGSGDGTAFGTRAARALLGAFAPNRLVWGSDWPH
FT                   TQHRDRTDYQTTRSALDDWVPDPSLRRIILCDSARALFRFDRQTPARDT"
FT   gene            512824..513105
FT                   /locus_tag="BMA10229_A0489"
FT   CDS_pept        512824..513105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0489"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01783"
FT                   /db_xref="GOA:A2S3G8"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3G8"
FT                   /protein_id="ABN01783.1"
FT                   /translation="METYLDLLAEREALMIKLDAARMQARSAALSEVKRIVEEFELTTQ
FT                   EVFGRAGVLRRRGKLKPKYRDPKTGATWNGRGRPPSWIAGKDRAAFVA"
FT   gene            complement(513358..513627)
FT                   /locus_tag="BMA10229_A0490"
FT   CDS_pept        complement(513358..513627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0490"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02562"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3G9"
FT                   /protein_id="ABN02562.1"
FT                   /translation="MASALLAALSACSSASDISATEKPNVYTVDSSSRGILLSWAGAHE
FT                   RAVNEATSYCAQRGMQASVKSESVERGSGTQGRAQLAFECHPAF"
FT   gene            complement(514297..514458)
FT                   /locus_tag="BMA10229_A0491"
FT   CDS_pept        complement(514297..514458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02806"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3H0"
FT                   /protein_id="ABN02806.1"
FT                   /translation="MRPSARTLALDRPFAYVRAALSSRFFHGRRALSLVAGVFAWRRER
FT                   GFESPLCA"
FT   gene            complement(514522..515835)
FT                   /locus_tag="BMA10229_A0492"
FT   CDS_pept        complement(514522..515835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0492"
FT                   /product="manganese/iron transporter, NRAMP family"
FT                   /note="identified by match to protein family HMM PF01566;
FT                   match to protein family HMM TIGR01197"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03525"
FT                   /db_xref="GOA:A2S3H1"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3H1"
FT                   /protein_id="ABN03525.1"
FT                   /translation="MPLPTVPTAPFCPAEVKGSIAIDAGVSRLTKLRRFAGPGLLVAIG
FT                   YMDPGNWATDIQAGSQFGYALLWVVVFSSVAAIFLQTLAARLGLVAGRDLAQASYDRYG
FT                   PFGRIVQWITAEVSIIACDIAEVLGCALAFKLLLGVPLAWGIVLTALDTMIVLGLQGKG
FT                   FRQVEAIVFGLIGTMAFCFVAQVAMVPPDWRAVLHGLAPSVPGHDRKDAIVLALGIVGA
FT                   TIMPHNLYLHSSVVQTRRVVGGAGDAIKETLAMVRIDTWISLVVAMLVNAAILVLAGAA
FT                   FHATGQTGVADIEQAYRLITPIVGGAAAWLFGIALLASGQSSTLTGTIAGQVIMDGFLH
FT                   MKMPCYQRRLITRGLALAPALTGVLWLGDGALGQLLVWSQVLLSLQLPFAMWPLIRSVG
FT                   DRSIMREYAIGRGTKVVAWTLFVLVSITNLVLVTGFVG"
FT   gene            515860..516036
FT                   /locus_tag="BMA10229_A0493"
FT   CDS_pept        515860..516036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0493"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00920"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3H2"
FT                   /protein_id="ABN00920.1"
FT                   /translation="MAVILRIRGDRPSWPSTHVGQSDRGFAKVTFPWKVAGWPLAGRRK
FT                   RAWNRRTGMHSRM"
FT   gene            complement(516095..516460)
FT                   /locus_tag="BMA10229_A0494"
FT   CDS_pept        complement(516095..516460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0494"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01621"
FT                   /db_xref="GOA:A2S3H3"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3H3"
FT                   /protein_id="ABN01621.1"
FT                   /translation="MELSVAPTLKNCLISAVGFTNATTPTKRILLSPFIGLFTLVRWLV
FT                   FKTCKEPQFPPEIEAECRVEPNDPNVWPIPASIGEFAATVPGFIERAREKAQRGQAQDN
FT                   ADRQPHPMRKRRRRRAQ"
FT   gene            516582..516845
FT                   /locus_tag="BMA10229_A0495"
FT   CDS_pept        516582..516845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0495"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03015"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABN03015.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            516869..517702
FT                   /locus_tag="BMA10229_A0496"
FT   CDS_pept        516869..517702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0496"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03692"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABN03692.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(517936..518769)
FT                   /locus_tag="BMA10229_A0497"
FT   CDS_pept        complement(517936..518769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03288"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3H6"
FT                   /protein_id="ABN03288.1"
FT                   /translation="MATERFDWIDSYPARTLPRLRQVLDAPLTHGRWYALVDMGFSPTL
FT                   REVLAALNPDGAVIALYEGVYDGDGLLEISPCVTPLPDDAAHRAEVCAGLLRETDGRPM
FT                   LSVLRAAHGLDALVAHLRGQMEARAADDEAFLVRLADTRCVPTWAGVLTPAQRARFFAG
FT                   IDAWWLFDRAASLVELDVAPAGSETATGADDGEPYRLDGEQIAALRHASKIDTLLFHVR
FT                   QRPESFGRLTATPSQAYACVSEAWAKEDVPPSAGARQALDALEAAGWLVPAEVSA"
FT   gene            complement(518772..521579)
FT                   /locus_tag="BMA10229_A0498"
FT   CDS_pept        complement(518772..521579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0498"
FT                   /product="Rhs element Vgr protein"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM TIGR01646; match to protein
FT                   family HMM TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00716"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3H7"
FT                   /protein_id="ABN00716.1"
FT                   /translation="MSVITQFTSLFSAANCLYCLDGPGEIASLQIERWVGRETLSENFQ
FT                   WDVYALATDPGLDLDAMLGQRVTIRTALANGTSAVRSGLVAQAECIGYDAGLARYCLQL
FT                   VPWLAALAHGRDERTFVRQGVADVLGAVFAPYGAIARWRFTADANQRIAELGARDYRVQ
FT                   YRTHTHFDFVRHVLAEAGLGFCFVEEADAPAGHTMLIFDDSTQLPEDETSARMGGVPQR
FT                   LSGTATEPDDVIVGIGQSLSLTADRVTLISSDYRGNQSTSATASLGNPAGSRELYDDVG
FT                   PEAFDSLREADAAARRHADAIVSAARFWTGYGTLRTARAGRALRIAGATWRMSRGGAPA
FT                   PDAFVLTRVDQIGINNLPATVMERVERSLGPLPPANLDARVLAQAKAGGYANRFDAAPR
FT                   DQAWRPTLEDGTGQRLNPVPTALGAQTAIVVGPQGETRPGSTGPVHTDAQGRLRLRYHW
FT                   QADGDAGTYPTRAMQRLASEGHGLQQTPRIGHEVLVQFVNGLVHRPIVLGGLFNGRGEG
FT                   GEAPTPGGEAGQPLDESVYAQASDHAASAQGNLAGGHSPAWHGAGGGAKRHDHAGALSG
FT                   FKSQEFDGQGYNQLVADDTDRMGRMQMATTHAATQLNIGHLRHQADNYLGSFRGQGVEL
FT                   RSDAYGALRGARGVLISSYAPTGPSQPAGDASALQSLLAQQAALAKLLDKSADTHKTLP
FT                   FAAQRGAQRAGQSSMNGDAAPLDALGKSFATTVGADGYAQASADASRRATGNALPHTGD
FT                   AVLGVEAKGGQGLLAGQSLQWAAGETLTIGSGNDTNLAVNRTLRVHSGQGIGWLAGANG
FT                   ANGAQGVGMSVIAGKDDLALQAQHDLMALRARDDLRVASIGADVEIAAKQTVRLAVSGG
FT                   AHLTIEGGNVTFGCPGSLVVHAAQHTFVGPDQLAPALPQFPEKVCVECLKHAMQSGSAL
FT                   AGKAI"
FT   gene            521613..521840
FT                   /locus_tag="BMA10229_A0499"
FT   CDS_pept        521613..521840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03037"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3H8"
FT                   /protein_id="ABN03037.1"
FT                   /translation="MNTARCDENGTTDKTTEQRDHPARTGTIMQRSQTPIARDSIRQAK
FT                   SPGHTPASRLPDDKSPFIAHYFKLRRDARL"
FT   gene            522100..522366
FT                   /locus_tag="BMA10229_A0500"
FT   CDS_pept        522100..522366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03819"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3H9"
FT                   /protein_id="ABN03819.1"
FT                   /translation="MARPFIVLGDKHSHGGTVTTAAAASAIHGKGIARRNDRVSCPIHG
FT                   PNHIVEGDDTMIIDNEGVARDGYRTACGAVLIASQSSTGGDAA"
FT   gene            522390..523805
FT                   /locus_tag="BMA10229_A0501"
FT   CDS_pept        522390..523805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03630"
FT                   /db_xref="GOA:A2S3I0"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3I0"
FT                   /protein_id="ABN03630.1"
FT                   /translation="MKQRAWLSKAAFVAAVFVVVWIATIAYWKATYHPPSATELLTHGI
FT                   ALPALLATGLAWARRAAGRLREASAATAQTAAPSAPQASIAQAADEAAMRTWTLALLDS
FT                   SVRFPTGATTADIDGAARDETVVGLHPALRRADGTGVFASGVASVSIDHFDERLLPPSA
FT                   DAALNDEHARALLLAADVLDELLERHAVLATDGASRPAEPLRLHLLLPERWQPMAGALA
FT                   AWLDTHVARERWMPGVERVQTRMVANPVQAWAVVDELIVSLHREPSNASHVVLACDSSL
FT                   SDATVHALDHAGKLYGHNRPNGRIPGEGACALLLAHPAAADAADAPRVHRLVAARAPTP
FT                   DGAPAKAPADTLAPLLEAARTQTAAAEIAPAGCGLVSDADQRGGSRTEIAAVAERNWPD
FT                   DARERCRHLGVANGESGAALALGAIAVAGWRASEEQMPMLAASIADPVARGVMLVAPAP
FT                   IAPVTASELAAAA"
FT   gene            complement(523833..525683)
FT                   /locus_tag="BMA10229_A0502"
FT   CDS_pept        complement(523833..525683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05947;
FT                   match to protein family HMM TIGR03359"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01223"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3I1"
FT                   /protein_id="ABN01223.1"
FT                   /translation="MDELLSYYERELAFLRRHVRDFAERYPKIASRMQLASGADGSSED
FT                   PQVERLFESFALTGARASRHIDDDYSEFTKAFIEVLYPHYLRVFPSCSIASFDIDASRA
FT                   AQMSAAVLVPRGTQLYSRPVRGAKLFFRTAYDVTLSPLQLTAARFHAMPQAPRSFRLPP
FT                   NASAQLSLSFAIRSPHASVADLKLDSVRLYTRGEPLMSAALRDALSIHALQAYVEPEQG
FT                   GRWVALERVPFAAVGVSREDSLIPCPQGVHPAYPLLTEYFAFAEKFGFFDCDLREAGRL
FT                   GRRHFTLHLLLKGIPADSAKAGVLESLSAEHVLLGCTPVINLFETTGKLGQQPSAASGA
FT                   HMQPLVVDKQNAYAYEVYSVDAVTQVQETPQGERVTTFPSLHSLYHGGQAARASLYWRM
FT                   RRDALVARSEPGHELSLGFVDGALDPVAAPAGLDFKLTCSNRDLPEHLPHGAPGGDLMM
FT                   EGGTLASRIGLLQRPTRPLRLREDRGVLWRLVSQLSSNSLLLAGGAGAVRDLLGLHDVQ
FT                   ESPATVRQIAGIVDVSQKPVTAWVSEKPFASVVRGLEIRITVDEECFAGTGVHTFAQLM
FT                   DCLLSRYVAPNGFTQLVLVSSRTGDVLCTCARRAGGGFLI"
FT   gene            526016..526825
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0503"
FT                   /note="putative outer membrane protein; this gene contains
FT                   a frame shift which may be the result of a sequencing
FT                   error"
FT   gene            complement(526975..527811)
FT                   /locus_tag="BMA10229_A0504"
FT   CDS_pept        complement(526975..527811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02543"
FT                   /db_xref="GOA:A2S3I3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3I3"
FT                   /protein_id="ABN02543.1"
FT                   /translation="MTMERLYRGMDRATLDRAYDNTRAVADFPAVLADFRRRSAQLYAR
FT                   VGGRREVRYGERPRERFDWLSCGRAGAPRFVFIHGGYWQNCAKEDFAFVADGPLAAGFD
FT                   VVLAEYTLAPEASMTQIVGEIARLLDRLSADRDGLGGAGRPLCLSGHSAGGHLSAVHRG
FT                   HACVTSTLAISPLVDLEPISLSWLNDKLRLSEHEIADYSPLFHVGKGAPTIVAVGAHEL
FT                   PELVRHADDYAHACAAAGEPVRRVHVPGRTHFSVLEELAQPDGALTRLLGAFVGGA"
FT   gene            527856..528089
FT                   /locus_tag="BMA10229_A0505"
FT   CDS_pept        527856..528089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0505"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02062"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3I4"
FT                   /protein_id="ABN02062.1"
FT                   /translation="MRAAALVYPKNAPVRHRAIRFRHFSRRREPANDSRVASSIARMTH
FT                   ANSFSNAPRAASNRSRQAIRTRRRARFHSHRA"
FT   gene            528342..530744
FT                   /locus_tag="BMA10229_A0506"
FT   CDS_pept        528342..530744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0506"
FT                   /product="galactose oxidase-related protein"
FT                   /note="identified by match to protein family HMM PF00652;
FT                   match to protein family HMM PF01344; match to protein
FT                   family HMM PF07646; match to protein family HMM PF09118"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01297"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015202"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="InterPro:IPR037293"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3I5"
FT                   /protein_id="ABN01297.1"
FT                   /translation="MASIDARLFIFGLLLFLSGLAHADTPSAAQPSPYGIVSVDIDGTR
FT                   LCMEVGGAAVAPLAGVDVGECRQSADQQWSLVPNGQNFQVVAKHSLQCLTIANAATSPG
FT                   APLVQYPCNGGSNQQWSVSPSRSGYKLVSAHDALCASAAGASPGSRMVQQRCDEHASQT
FT                   LYVSAPPELVGALIGMNGGLCIDGGAAGAQAVQRTCDDAPGQQWRIRPNGSAYKIHLAS
FT                   TNLCLGTRDASRGTGAAIESQRCANVASQLWTIRAASEVDGRNGYANGYWQFVSANSGQ
FT                   CIVVQNASTADGANLIQYPCGQGNAGSNTMWRVNRTSRSSWTGAIALPLVPSAAAHLPD
FT                   GKILMWSADSTISFGGGGVDGNTYTTVFDPIAQRATDAVLTSLGHDMFCPGLNLLADGK
FT                   IFVNGGVSSRKTSVYDPATHAWSPSNLMNIARGYQSSVTLSDGAVFTLGGSWNVATPDF
FT                   RLGDKYGEVWRPDSGWSILSNVPDIIGPDPAGAYRGDNHMWLVAARDRWVFYAGPDATL
FT                   RWIDTTGNGRIVEAGKRGDDAYSISGNAVMYDVGKILTVGGAPAYDNGVASASAYVIDI
FT                   SAGPQVPPVVRKVQPLAYSRGFVNSVVLPNGQIVAIGGQAVTIPFSDDQSVLVPELWDP
FT                   STEAFTRLAPMTVPRNYHSEALLLPDGRVMASGGGLCGSGCNTNHPNVQILTPPYLLNA
FT                   DGTAASRPVIAAAPEQAANGSTIAVSTDAPIRSFALVRMSSSTHSVNTDQRRIPLTFRQ
FT                   SSGGDGGYAYTVAIPADAGVAIPGQYMLFALNAGGVPSVAKTIRIGA"
FT   gene            530771..531259
FT                   /locus_tag="BMA10229_A0507"
FT   CDS_pept        530771..531259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03549"
FT                   /db_xref="GOA:A2S3I6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3I6"
FT                   /protein_id="ABN03549.1"
FT                   /translation="MSIASPVRPPRRRVARALVLAAFVALAALGGTARASPDDAPAARA
FT                   ARGARLFDGSDPMHGRLAGHAQVLPSTASRCANCHQPPAPRAAPALAPPLDASSLLAPQ
FT                   KRRGGPPSAYTADSFCATLRSGIDPAHVTLKAAMPRYDATDAQCADLWAFLIPIPTSR"
FT   gene            531294..531854
FT                   /locus_tag="BMA10229_A0508"
FT   CDS_pept        531294..531854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02798"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3I7"
FT                   /protein_id="ABN02798.1"
FT                   /translation="MLAGAALVSLPACAAESREIAHRPWGAIEPAEAAPDIEVSLADGT
FT                   RGRLVDLLRGKTSAIQFVFTGCSATCSLQGAIFQSLQAQLARHPIGGAQLLSISIDPAN
FT                   DTAVAMTAWLRRFGAQPGWQAAIPASGDLARLARLYRDERNPADSHIDQAFISSRSARF
FT                   VWKTDHLPTPESVHDALRYYASH"
FT   gene            531900..532142
FT                   /locus_tag="BMA10229_A0509"
FT   CDS_pept        531900..532142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0509"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01014"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3I8"
FT                   /protein_id="ABN01014.1"
FT                   /translation="MQLRTLLLALAIVAIAVATTYYIVTVDTDTPFATTEPAASAASAA
FT                   GASEPTARLIAPGDGAPSTPIARDDAQSPLPDAWK"
FT   gene            complement(532565..532909)
FT                   /locus_tag="BMA10229_A0510"
FT   CDS_pept        complement(532565..532909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0510"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03154"
FT                   /db_xref="GOA:A2S3I9"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3I9"
FT                   /protein_id="ABN03154.1"
FT                   /translation="MDHDPQLTERWLEIHAEIEALRRKAKAAAIMQIELLMTQYGISPG
FT                   ELKGVDGAPAHRKPKARYWNPETGQTWSGRGRMPKWLVGRELASHLIDGESALKRMKLL
FT                   NRDAQGADEG"
FT   gene            complement(532926..534455)
FT                   /locus_tag="BMA10229_A0511"
FT   CDS_pept        complement(532926..534455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0511"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02420"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3J0"
FT                   /protein_id="ABN02420.1"
FT                   /translation="MTAELDARVRALTLRAQQLFDDGRPEQGALLAAQALALAPDDALA
FT                   LKLVGVAECMRGDHAAGLVYLERACLSAPGDANLHYNVAVAHECTGSHERAALSYRHCL
FT                   RLQPDHADALWNYGEYLRLNGHFEAAARCFEALQAQACRYPSMHHRMAVVYTHLHRFDD
FT                   ARRHFALAMDENIDTRVTRWERAHLRLGTRDFARGWPDYDTRFDIGHLINVHCHPFPIR
FT                   LWQGEPLAGKTLLVHGEQGLGDEIMFASIVPDIVRQAARVVLACAPSLVSLFQRAFPSA
FT                   IVRAHRAGVAPARVDDLGAIDYQSPIGSLPRWLRASEASFGTGAPYLAADPARVAWFGA
FT                   RLRALAPRADRALKVGLTWGSNPAAAVPSAARRATRKSMPLRLLAPLARVPDVQYVSVQ
FT                   NAELGEQAATVPELDLIDFSSALRDFADTAALVANLDVVVSVDTSVAHLAGALGKTTYT
FT                   LLMRNCDWRYGFEGERCVWYESMTLLRQTTQDDWLPVVDRVIDALARYRKQ"
FT   gene            complement(534457..535167)
FT                   /locus_tag="BMA10229_A0512"
FT   CDS_pept        complement(534457..535167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0512"
FT                   /product="ompA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02086"
FT                   /db_xref="GOA:A2S3J1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3J1"
FT                   /protein_id="ABN02086.1"
FT                   /translation="MFKTIVLAACAAAVLGACTSATGPRFNAYVLSDAAGAKTYKVECH
FT                   GLFEGPGVCRDKAREICADKDVHVLTGVGPLGHDDDVRTLAFQCGEPAQPVAQQPQPAP
FT                   AAAPAAEPIRLNADAMFAFDRADAASMTEQGRQQLSQLAQRLTDRHAQTVSIVGYTDRL
FT                   GSDAYNRQLSQARAKTVGDYLIAAGVPADSVHAEGRGASDPLVQCDQRERAALIACLSP
FT                   NRRVEVVAAGLDGA"
FT   gene            complement(535248..538520)
FT                   /locus_tag="BMA10229_A0513"
FT   CDS_pept        complement(535248..538520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0513"
FT                   /product="hemagglutinin family protein"
FT                   /note="identified by match to protein family HMM PF03895;
FT                   match to protein family HMM PF05658; match to protein
FT                   family HMM PF05662"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00837"
FT                   /db_xref="GOA:A2S3J2"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3J2"
FT                   /protein_id="ABN00837.1"
FT                   /translation="MNKTYRVSWSASRGAWMVAPETARRKGKGHSLTIVCAIASGLLLA
FT                   APAWADTVSPSGTDNVYGVDATDPGVSTNQGNTAYGAQAGAKVTGSYNTAIGYQAGQNV
FT                   NVIDTVSIGKQATASANDAIAIGTNTKASGPADIYMGLNAGAGAGSTTSPDGTVTLGIR
FT                   NMGLGESAGSYVTGQNNTGIGYQSGMNVTGDQNVGLGQQAGQFVTGTGNSAMGHLAGST
FT                   VSGSYNAAFGEYAGTNTSGGANAAFGFYAGRYINGTNNTALGAYDLPVVNGTWYGSYVT
FT                   GSNNLGAGHNSGAYVSGASNVGLGDGAGTFVTGSNNVAIGTAAGSGAYTSGPSGATLNA
FT                   ALVASNTVSIGTRATASQSDAIAIGKGATASGAQSISIGTGNVVSGKGSGAIGDPSTVS
FT                   GAGSYSIGNNNTVANSNTFVLGNGVTTTQDNSVVLGNQSTDRAAVAVSSETINGTTYNY
FT                   AGVASPANGVVSIGGVGTERQLINVAAGQVSATSTDAINGSQLYATNQAVIAEDAKVNS
FT                   LGGGVASALGGNAAYNATTGAITAPSYAVYGTTQNSVGGAIDALQALAPLQYTSGPGVT
FT                   TPNAPGSAPTNTVTLVGAGGPGANTTPVTLTNVAPGKLSATSTDAVNGSQLYATNQQVA
FT                   NLVSSVNNGGVGPVQYSDPSAPTTPNGGKPSQDLTLVGAASGPVALHNVAPGTASTDAV
FT                   NVGQLGAVTTGLGGGAAIDPKTGAVTAPSYTVYNADGTTSNVSNVGAAIDAINSTGIKY
FT                   FHANSTKPDSQALGADSVAIGPNAVANNAGDVALGSGAVTSQAGGTLSETINGVTYSFA
FT                   GTTPIGTVSVGAPGVERTITNVAAGRIGQSSTDAINGSQLYGTNQSIEALTDKMNSLGN
FT                   TVANTLGSGASYNPQTGAVNGPANSGGVVTPTVIQEAANKWVSANPSTYVAPVATGTNG
FT                   MAVGSGAVSTGQNSVALGTNASDGGRSNVVSVGAPGAERQVTNVAAGTQATDAVNLGQM
FT                   NGALAQQTDSFNQRLGAVQQDVDNVARAAYGGIAAATALTMIPEVDKDKTIAVGIGGGT
FT                   YRGYQAVALGATARITENIKVRAGVGMSSGGTTAGIGASMQW"
FT   gene            complement(538652..538807)
FT                   /locus_tag="BMA10229_A0514"
FT   CDS_pept        complement(538652..538807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03719"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3J3"
FT                   /protein_id="ABN03719.1"
FT                   /translation="MWKAARHERACAAERSAMRGGGLRDENARRNARRNARRNARRMAE
FT                   IKSAQI"
FT   gene            complement(538908..539603)
FT                   /locus_tag="BMA10229_A0515"
FT   CDS_pept        complement(538908..539603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0515"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03468"
FT                   /db_xref="GOA:A2S3J4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3J4"
FT                   /protein_id="ABN03468.1"
FT                   /translation="MVLIYLIEDDEVQARCYAAILQHAGYSVRVLPDGERALREIQRAA
FT                   PDLIVLDRRLPDIDGLEIIAWVRERCAPLPILVLTNAVLETDLVEALEAGADDYLIKPP
FT                   REREFVARVNALRRRASISKQFEGTIEIGGYRIATVERAVYLAGERIPLSPKEYEIVEL
FT                   LARHVGQVVPRKTIISRVWGRAAEEEVSRSLDTHIYRIRRKMNLSRRNGAMLRVIYTHG
FT                   FRLDDFSHV"
FT   gene            complement(539969..540160)
FT                   /locus_tag="BMA10229_A0516"
FT   CDS_pept        complement(539969..540160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0516"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02475"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3J5"
FT                   /protein_id="ABN02475.1"
FT                   /translation="MRTGDARARRHMRDMQRPAKSSGMRMAFCEIDDARASPLRFDGGL
FT                   SEYSALFRKVVKFHDMTC"
FT   gene            540210..540545
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0517"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(540597..540968)
FT                   /locus_tag="BMA10229_A0518"
FT   CDS_pept        complement(540597..540968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0518"
FT                   /product="putative prophage protein"
FT                   /note="identified by match to protein family HMM PF05666"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01016"
FT                   /db_xref="InterPro:IPR008617"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3J7"
FT                   /protein_id="ABN01016.1"
FT                   /translation="MKLSVLFVAALPLIAIAASAHAQPRHPAVYSPAAGVLCDRYVCAD
FT                   DQGISRALTERYLGKRVAAKAFSQGDFDPTEFTFANGVFCDVKERLCRDDRYYGADGKR
FT                   SGAVSRRYTELLFGRRSGG"
FT   gene            complement(540979..541194)
FT                   /locus_tag="BMA10229_A0519"
FT   CDS_pept        complement(540979..541194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0519"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01627"
FT                   /db_xref="GOA:A2S3J8"
FT                   /db_xref="InterPro:IPR025016"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3J8"
FT                   /protein_id="ABN01627.1"
FT                   /translation="MKLVFPACLAFVAGIVCFARFAASGSHVDAFGRLHEPFGLLPLGW
FT                   ALTLLGGTGLLIGAAQAVVRRSARRR"
FT   gene            complement(541378..542163)
FT                   /locus_tag="BMA10229_A0520"
FT   CDS_pept        complement(541378..542163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0520"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00928"
FT                   /db_xref="GOA:A2S3J9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3J9"
FT                   /protein_id="ABN00928.1"
FT                   /translation="MMSAARKVLLVEDDEAQANWAKLVLTRGRFDVTHCQTGGQAIRAM
FT                   TKEVPDAVVLDMRLPDVHGLEVLVWIRRNFFDVPVIVLSNAMQEMQIVEAFSAGADDYV
FT                   LKPAREAEFLARIAAMMRRKGHAVSGTIEIGGIAIDLGWKAVRIDGEPVRMAPIEYEIL
FT                   EMMARHLGSVVQREVLVNRIWGRSIDEAVSRSLDTHVYRIRHKLKVHGVSNVSLRSVYN
FT                   LGYRLEWCRGRALAGAAPERDDALRLAEGGGEAMLPSLL"
FT   gene            complement(542574..543551)
FT                   /locus_tag="BMA10229_A0521"
FT   CDS_pept        complement(542574..543551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0521"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03053"
FT                   /db_xref="GOA:A2S3K0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3K0"
FT                   /protein_id="ABN03053.1"
FT                   /translation="MAAEWMGCDRFRANSMKVSLRHLRAFVAVAREGSFTAAAGALCLT
FT                   QSTLTKTIREFEQALGVHVFERNTRRIALTPYGAAFLVDAVRILNDLDLALDGVNQQLL
FT                   GNSGTVRVASGLAFASTVMPCVIRALHAQEPGIHVDLLDDTSGGVIRRIESGEVDVGIG
FT                   SYVGMAGNAPSVRRLLSARLGVLFPVGYPKIPSRPTLASLNEIPILRDSDESSIAAAFR
FT                   QQAPDLWERMRRKVSVTNLDLQLALVREGIGACIVSALAASHPSARGMPYRLLVEPEMT
FT                   RDVYVFTRRDVSLLPAAARFVDILMNVLPLIDFAEGVELACDGA"
FT   gene            complement(543654..543803)
FT                   /locus_tag="BMA10229_A0522"
FT   CDS_pept        complement(543654..543803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0522"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02178"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3K1"
FT                   /protein_id="ABN02178.1"
FT                   /translation="MRRARANRDVSQPSLAHRRNAAGMLLRDKSGRRSRVAAGSGRQRA
FT                   SEDG"
FT   gene            complement(543818..545242)
FT                   /locus_tag="BMA10229_A0523"
FT   CDS_pept        complement(543818..545242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0523"
FT                   /product="putative liporotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03255"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024745"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3K2"
FT                   /protein_id="ABN03255.1"
FT                   /translation="MKLGGGTVLGTLLAACGGGGGADAAAAAPQQSPPAGPSSSANVAM
FT                   TLPADAPRIARDFAGLSIEKAALSYPLLSGENGNMVGLFNRLGAGVLRIGGNSSDASGW
FT                   QRTGPDETSGVITPAAVDRLASFVRACRWRVIYGLNFVGNDPATIADEAAYAAQALGVQ
FT                   LAGFEIGNEPDLYAQHGLAPNANTYPGFVSRWTTFANAIRAAVPDAVFTGPATAWNYQR
FT                   YTVPFVSDAAGLVSLLTQHHYRNPDSATIEAMLSPDPSLAPMLQALQGAASARGIGFRL
FT                   AETNSYWGGGKPGVSDAHASALWVINFLFAVAQGGASGVNLHTGGGASYSAIKTNKTAG
FT                   TVAAIGPEYYGIYLFNQAAGGRLMQTRVDSAGTTLFAHAVAADGGGVRLILVNTDANSG
FT                   YDVAVDCSSVPNARAGIVTTLGGPSLGSLTGTQIDGATFALDGSGAPQGGRPVACVNGV
FT                   LGVHVASASALLVDFA"
FT   gene            complement(545526..545849)
FT                   /locus_tag="BMA10229_A0524"
FT   CDS_pept        complement(545526..545849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0524"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02940"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3K3"
FT                   /protein_id="ABN02940.1"
FT                   /translation="MRRSRSDARSGALSDLADSAARIANAAYIANRHMLRVPRCGRNRF
FT                   RMDIVDEPAARASRSAERKKRKKRDARRIPGAPRDRSSRGSRNGLDRLSDRVAGRAPSA
FT                   FVA"
FT   gene            complement(545957..546130)
FT                   /locus_tag="BMA10229_A0525"
FT   CDS_pept        complement(545957..546130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02216"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3K4"
FT                   /protein_id="ABN02216.1"
FT                   /translation="MAVAIAIAIAVVIAIANHIARFDEHFVKHFVKHFVKRSPDASCNE
FT                   SNVVTGAMCAGR"
FT   gene            complement(546202..546333)
FT                   /locus_tag="BMA10229_A0526"
FT   CDS_pept        complement(546202..546333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0526"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01075"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3K5"
FT                   /protein_id="ABN01075.1"
FT                   /translation="MRLCAYAPMRACAERPVDRSPAAAASRDRNCATARVECRARKR"
FT   gene            546815..547033
FT                   /locus_tag="BMA10229_A0527"
FT   CDS_pept        546815..547033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01147"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3K6"
FT                   /protein_id="ABN01147.1"
FT                   /translation="MDRIFMTRTEALEFLLKAHQTAVDKVGHPFRKPTPADHAAVEALD
FT                   RLLLDVRARRIDTFQINASSAQVIVTD"
FT   gene            547268..547558
FT                   /locus_tag="BMA10229_A0528"
FT   CDS_pept        547268..547558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02611"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3K7"
FT                   /protein_id="ABN02611.1"
FT                   /translation="MSLARPAKHAAARARDIETTTGDTSAADTAVHACTRMHVRTGNRR
FT                   RAICRLEADGFPRARRNLPACHRGGARRYPARIFRLARRISPNGIKCIRYF"
FT   gene            547741..549219
FT                   /locus_tag="BMA10229_A0529"
FT   CDS_pept        547741..549219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0529"
FT                   /product="poly(3-hydroxybutyrate) depolymerase"
FT                   /EC_number="3.1.1.75"
FT                   /note="identified by similarity to SP:P12625; match to
FT                   protein family HMM PF00041; match to protein family HMM
FT                   TIGR01840"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01419"
FT                   /db_xref="GOA:A2S3K8"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3K8"
FT                   /protein_id="ABN01419.1"
FT                   /translation="MTRNARRTWQWISGLLAICAAALAALPARADVAAGPGAWSSQQTW
FT                   GADTVNGGNLTGYFYWPATQPTTPNGKRALVLVLHGCLQSASGDVIDNSRGAGFNWKSV
FT                   ADRYGAIILAPNATGNVYGNHCWDYANTSPNRASGHVGVLLDLVSRFVGDAQYAIDPNQ
FT                   VYVAGLSSGGGMTMVLGCIAPDIFAGIGINAGPPPGTTTLQIGYVPSGYTAQTAANQCK
FT                   AWAGSKADQFSTQIAGAVWGTSDYTVAQAYGPLDTAAFRLIYGGTFAQGSKVSIAGGGT
FT                   NTPYSDSNGKVRTHEIVVSGMAHAWPAGAGGDNANYVDATHVNYPAFVMDYWVKNNLRA
FT                   NGAPVQAGTPPTGLTVTNATQTSISLAWNPVANASSYNVYRNGNKVGSSTSTAYTDAGL
FT                   IAGTAYSYTVTEIDPSLGESAPSPAVSATTQPSFACSATTATNYAHVQAGRAHDSLGIA
FT                   YATGSNQNMGLDNVFYTNTLAQTSAGYYIIGDCP"
FT   gene            549216..549353
FT                   /locus_tag="BMA10229_A0530"
FT   CDS_pept        549216..549353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0530"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00758"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3K9"
FT                   /protein_id="ABN00758.1"
FT                   /translation="MSRRPAHRPAGSRRASRMREAAAMAIEAAFVTRLSFAPATRRISV
FT                   "
FT   gene            549350..549604
FT                   /locus_tag="BMA10229_A0531"
FT   CDS_pept        549350..549604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00813"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3L0"
FT                   /protein_id="ABN00813.1"
FT                   /translation="MIRGKRACASAQRRRCPRESRDAHRLRAPAAGPPLSRRDARRGGT
FT                   AARRHDTADENGGALTAGAVRSKRPAARASCAVDPRLAV"
FT   gene            complement(549608..549778)
FT                   /locus_tag="BMA10229_A0532"
FT   CDS_pept        complement(549608..549778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0532"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03800"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3L1"
FT                   /protein_id="ABN03800.1"
FT                   /translation="MQWPDETGIAEVKVRRERRTGFHGRDDVAATECLHGAITVPGMRA
FT                   GVPAPVGARPL"
FT   gene            549773..553120
FT                   /locus_tag="BMA10229_A0533"
FT   CDS_pept        549773..553120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0533"
FT                   /product="alpha amylase family protein"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03330"
FT                   /db_xref="GOA:A2S3L2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3L2"
FT                   /protein_id="ABN03330.1"
FT                   /translation="MHAWPPLFERVAAWGFDHVLIGGLWAASRRGYPRHVADPDRPAES
FT                   FATSLDATSALARLSDSAREHGLRIAVEVVVDRVAREHPLHDAHRDWYVVDERDDALID
FT                   PRTAALAHDVAHANVGSAAALDALADWWRARLGALADAGAAAFLVDAPQRMPAHWWAAL
FT                   LRALRQARADLPVIAGVPGREREALAQLACAGFDAAFSSLRWWDLRAPWFVEEHRLLRR
FT                   VGAPIAFPDAFDGPRLAHDWRQAAPETIERAHRRALWTAAALGTGWLVPMGFERGVAVE
FT                   LMAREPRADAYRAALDSAPFDLSGAIAEANALRRAAPALRGNGEIAQLTGADAPATVLL
FT                   RGARTALEYDDEAALIAVNPDLAHPAAIAPCAALAGVPGGFTRFAPFADGRRPRMGALE
FT                   PFALAAGACTLLRAQRARPVTTAPAEDRRGNRPGTRASVTAALAGERIAIERIEPVVDD
FT                   GRFAVKRVIGERLAVRAAIFADGHARLAAAVQWRAADENGWHEARCAAEGNDAWRADIP
FT                   LERLGRHLFRVIAWRDDWATLVDEIGKKHAAGQAVALELEEARRLAADVLARAPEANPA
FT                   ALAVLREFAAALDAAPPDQRLALIGAPHVADAFAALRERAFATRDAPVFPVDVERRAAR
FT                   FASWYEMFPRSASDDVRRHGTFDDVVAHLPRIRDMGFDVLYFPPIHPIGTTARKGRNNS
FT                   LQAAPDDVGSPYAIGSPAGGHTAVHPQLGSLDAFRQLVAAARAHDLEIALDFAVQCSPD
FT                   HPWLTEHPGWFAWRPDGSLRYAENPPKRYQDIVNPDFYARDAMPALWIALRDVVLFWID
FT                   AGVRIFRVDNPHTKPLPFWAWMIADVRARHPDTVFLSEAFTRPSMMYRLAKLGFSQSYT
FT                   YFTWRESKREFIDYLTELADGPAREYFRPNFFVNTPDINPRHLQQAPRTQFVIRAALAA
FT                   TLSGLWGMYSGFELCESDALPDSEEYRDAEKYELRARDWRRPGHIGDEIARLNRARRDN
FT                   PALQTHLGIRFAHAPNDAVLVFSKATPAHDNVVVVAISLDPWHPQATDFTLDAALYRGW
FT                   GIADGERLVAVDQTADHVETWHGRRHYVALDPHVRPFAIWRVAPAAGVARGARDDARDV
FT                   PAQEVHER"
FT   gene            553117..556512
FT                   /gene="treS"
FT                   /locus_tag="BMA10229_A0534"
FT   CDS_pept        553117..556512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treS"
FT                   /locus_tag="BMA10229_A0534"
FT                   /product="trehalose synthase/maltokinase"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM TIGR02456; match to protein
FT                   family HMM TIGR02457"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02577"
FT                   /db_xref="GOA:A2S3L3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3L3"
FT                   /protein_id="ABN02577.1"
FT                   /translation="MKPADTLEDVGRAQFVAHMARRPRRARRREAPGVADTPLWYKDAI
FT                   IYQLHVKSFFDANNDGVGDFAGLIAKLDYIAELGVDTVWLLPFYPSPRRDDGYDIADYR
FT                   GVHPDYGTLADVRRFIREAHARGLRVITELVINHTSDQHPWFQRARRAKRGSVHRDYYV
FT                   WSDTDLKYAGTRIIFLDTETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVLQIM
FT                   RFWLDLGIDGLRLDAVPYLVEREGTSNENLPQTHAILKLIRATIDAEYPNRMLLAEANQ
FT                   WPEDVQEYFGDEDECHMAFHFPLMPRIYMSIASEDRFPIIDIMRQTPALAPSNQWAVFL
FT                   RNHDELTLEMVTDSERDLLWQAYASERRARLNLGIRRRLAPLMERDRRRIELINSILLS
FT                   MPGTPVIYYGDELGMGDNLHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMGTLY
FT                   GYDAINVEAQTRDPHSLLNWTRRILSTRRATRVFGRGAIRFLRPGNRKILAYLRELDGE
FT                   TPVLCVANLSRASQAVELDLSEFAGCVPTEMTSDSPFPPIGQLPYLLTFPPYGFLWFAL
FT                   SEHGREPAWHQQYAEPLPEYLTLVMRRGETQPGAALLDTLAQDALPSWLARRRWFASKE
FT                   RRVDSARFDALTPIPGEPFQYAEARVAVDGREERYVVPLASAWGSETPQPLFAQLALAR
FT                   VRRGHTVGLLTDAFALPSFAHGVLRQLRAGAAVPVAGGGRLEFRPEPDLARLDPGDAPG
FT                   VRWFAAEQSNSSLVIGEAIVLKIVRKLATGVHPEAEMGRHLRRIGYRNVAPLVGEVVRI
FT                   GADGAPHTVAILQEYVDNQGDAWTRSCDFLKRAIEELALPAANDADAAAPSAEPEMIDG
FT                   YATFAGIVGKRLGELHAALAQPSDDAAFAPQRVSPARVDGWIGDALGWFERAASLLAER
FT                   LDTLEGQTRAAAELLVAQRAAVAEALRALVPRELDGCCIRIHGDFHLGQVLDVQGDALL
FT                   IDFEGEPARPLGQRRAQSHPLRDVAGFLRSLSYASAAAQFTIEKAPQQAAERKRALFER
FT                   FGQAAADRFVAQYREALSAASREFVEPRYADRLLALFLIEKASYELCYEAANRPDWLSV
FT                   PANGLAALVARLIGGAAPQQEDAR"
FT   gene            556509..558721
FT                   /pseudo
FT                   /gene="glgB"
FT                   /locus_tag="BMA10229_A0535"
FT                   /note="1,4-alpha-glucan branching enzyme, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF02922"
FT   gene            558774..560882
FT                   /gene="glgX"
FT                   /locus_tag="BMA10229_A0537"
FT   CDS_pept        558774..560882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="BMA10229_A0537"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02922; match to protein
FT                   family HMM TIGR02100"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01326"
FT                   /db_xref="GOA:A2S3L6"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3L6"
FT                   /protein_id="ABN01326.1"
FT                   /translation="MPTPTPDRLEPGRSYPLGAHWDGLGVNFAVFSAHARRVQLCLFDP
FT                   TGRREIARLDLPECTDEIWHGYLPDAHPGTVYAFRADGAYEPQHGHRFNPHKLLLDPYA
FT                   RKLVGQFRWSDALFGYRLHSSRADLSIDRRDSAPAMPKCVVVDEAVDWSTDRRPCVPWR
FT                   DTVIYEAHVRGVSMRRAELRAPERGTFAALACPAFIDHLLALGVTSVELLPVHAFMHAR
FT                   ALVNLGLCNYWGYDTAAFFAPEPSYLATRRLDEMRIAIRQLHAAGIEVLLDVVYNHTCE
FT                   GNQLGPTICWRGLDNASYYRLAPDDPRRHIDETGCGNTLDLSHPRVLQMVMDSLRYWSN
FT                   AFNVDGFRFDLCATLGREAAGFDPGAGFFDALRQDPVLATRKLIAEPWDVGPGGYQLGR
FT                   HPAGFAEWNDRFRDTVRRFWRGDAGMRPELAARLAGSADLFNHHGRRTWSTVNFVAAHD
FT                   GFTLADLVSYAAKHNDANGEDNRDGRDDNCSANWGAEGPTEDRQVRAVRARVARSLLTT
FT                   LFAALGTPMLLGGDEFGRTQQGNNNAYCQDNELSWFDWSAAESADGRTMIHFVGRLAAL
FT                   RRAYPVLSEPRYPSGERDGAPGLHEIDWFDERGDALTVPAWHDRERRALTMRRVGNGRA
FT                   GRPEALLLMLNASSDAIVFHAPPPSLVYRILLDSAAPDAAPRLMPADGVEIAAHAAVIA
FT                   AASVPEAG"
FT   gene            560909..562651
FT                   /locus_tag="BMA10229_A0538"
FT   CDS_pept        560909..562651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0538"
FT                   /product="putative maltooligosyl trehalose
FT                   trehalohydrolase"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02922; match to protein
FT                   family HMM TIGR02402"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03509"
FT                   /db_xref="GOA:A2S3L7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3L7"
FT                   /protein_id="ABN03509.1"
FT                   /translation="MNDSTATHAYALPFGATCVDARHTRFHLWAPACRSAAVERQDGET
FT                   VAMTPDGGGGFDAIVRCGPGTLYRYLLDGTLRVPDPASRFQPHGVHGPSEVVDPAAYRW
FT                   RHDDWRGRPWRETVLYEVHVGAFGGYARIARRLPALAALGITAIELMPVNAFPGARNWG
FT                   YDGVLPFAPDASYGPPDALKSLVDAAHGLGLQVLLDVVYNHFGPDGNLLPRYAPAFFRR
FT                   DRDTAWGPAIDFSCPQAGAFFLENALYWLDEYRFDGLRIDAAHAIGDDAWLAGLARRVR
FT                   AYAGDARHVHLVLENERNTASLLAGGRFDAQWNDDFHNSMHVLLTGEQAGYYRAYADAP
FT                   IRHLARVLGEGFAYQGEPSPLHGGAPRGEPSADLPPSAFVAFLQNHDQIGNRAFGERLR
FT                   ALVNDDALRAASALALLAPQIPLLFMGEECGTTQPFQFFTDHRGALAAAVREGRRREFA
FT                   AFPAFADPAHRDAIPDPNDPATFARSSLVARWRLGDGSTLAIALNLDARPAALAAPPDG
FT                   KIVFETPPRARDALADARLAAHACIAWRSGNVNGVARRGRAVDAKHMPAVKHANGVNGQ
FT                   DGAP"
FT   gene            562648..564870
FT                   /gene="malQ"
FT                   /locus_tag="BMA10229_A0539"
FT   CDS_pept        562648..564870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="BMA10229_A0539"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="identified by match to protein family HMM PF02446;
FT                   match to protein family HMM TIGR00217"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01969"
FT                   /db_xref="GOA:A2S3L8"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3L8"
FT                   /protein_id="ABN01969.1"
FT                   /translation="MTADPRHPSIVELADAAGLDAHWIDASGFARRVGDDMLAALLDAL
FT                   GYPCDTRAARAESAARLAAHAQAAPRLVTGDVDAPLTLPASLGRPGACYRVTLENGDAV
FT                   AGRFAQPAGAAVLPPLATPGYHVLDTGEQRTTLAIAPPSAWTPADAMRAAAAGGRERPP
FT                   PWGLAAQLYGLRREADGGIGDFTALAACARAAARRGAHALAISPTQAAFPALPEHDSPY
FT                   SPSSRLWRNAAYIDVETVLGAHAARAAIADAGLAAQWSALTRAPLVDWPGAVPAKLRVL
FT                   RLLFDRWRAQAPTGADAGPRAFARFRARHAGALDAHATFDALQACCIDNGIGADWRRWP
FT                   PAWRTPDAPDVAAFARAHAHDIAFHAFLQWQAARGLAAAQRAARGRGMAIGLIADLPVG
FT                   CDAAGSDAWRDGDAMLRGLSIGAPADPFNARGQAWGVTTWTPTALRARGFAPFVECLRA
FT                   GFAHAGGVRIDHVLGLARLWVVRDGAPPRDGAYLRYPRDDLLRLAALESFRHRAIVIGE
FT                   DLGTVPADFRARIAARGIVGLRALWFERDPAGAFRAPGDWDRHAAATSSTHDLPTVAGW
FT                   WRGVDLGWRWHAAASASACAPASSLSPASDAEAEANAPPARPGESEVAGPDALPPEVRD
FT                   MRRAERAALWRALQQAGVAARGQKMPPRDAPPVGAILAYVAQAPAPLAIFPLEDLLALE
FT                   GQPNVPGPPCGHPNWRRRMPRSVDALFDAPARTRIAAVRRARKRAR"
FT   gene            564867..567659
FT                   /gene="treY"
FT                   /locus_tag="BMA10229_A0540"
FT   CDS_pept        564867..567659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treY"
FT                   /locus_tag="BMA10229_A0540"
FT                   /product="(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM TIGR02401"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01039"
FT                   /db_xref="GOA:A2S3L9"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3L9"
FT                   /protein_id="ABN01039.1"
FT                   /translation="MKPRATLRLQLHAGFTFDDAAAHVGYFARLGVSHLYLSPITAAEP
FT                   GSRHGYDVIDYSTVNPELGGEAAFVRLIDALRRRGMGAIVDIVPNHMGVGGSSNRWWND
FT                   VLEWGARSRFARHFDIDWHASDPALQRKVLLPCLGRPYGEALAAGDIALRADAAHGRFA
FT                   IACAGRTLPVQIGAYPDILRAANRSDLNALAERFDAPGARPSNHARLDAAHAALRDYAA
FT                   ARGPGALDAVLHGFDPRIARSREMLHRLLEQQHYRLAWWRTATDEINWRRFFDISTLAC
FT                   MRIEDAAVFDDVHALLWRLYAAGLVDGVRIDHVDGLADPRGYCRQLRGRLAALRDGEPY
FT                   IVVEKILAPDERLPEDWRVDGTTGYDFMNDVSALLHDAAGAAPLAALWADMTGAETTFA
FT                   REALDGKRRVLARQFAAEHERVARAMHRLARASRDARDFALNPIRRAVAELAIRLPVYR
FT                   LYPSAGAPQRTDRALLAGAWQAARSAIAPADRAALDYVAATLGLPGVARAVAGLGDPAR
FT                   LAARVGFAQLTAPLAAKGVEDTACYRYGRLLSRNEVGAHADALSLAPGAFHTRNRRRRR
FT                   TFPGALLATATHDHKRGEDARARLAVLSEAHRAWRAAALDWAAFNAPHHHGAPAAADRI
FT                   PGPAAEAMLYQTLVGAWPPALAPDDAPGLAALTDRVERWQLKALREAKRDTDWLEPNLG
FT                   YEAGCAAFLRAIMTPRGPDDFAHRLHRLVARIAPAGIVNSLSQAALRLLSPGVPDLYQG
FT                   AQTWDHTLVDPDNRADVPFARYAAQRIDAPVAAYLRDWADGRVKHALIGRLLALRAAHP
FT                   ETFAAGAYVPLHVRGTRRGHALAFARRDASTTIVVIATRLAYPLLGDAPARPCVEAACW
FT                   ADTAVGLAPGFAGPWRDMLNDGTLDAPSGMLPLAAALAHLPVAVLIREGGAADTPRRGA
FT                   "
FT   gene            567656..567922
FT                   /locus_tag="BMA10229_A0542"
FT   CDS_pept        567656..567922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0542"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03351"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3M0"
FT                   /protein_id="ABN03351.1"
FT                   /translation="MSARAARTKRRDAAAPIIGPNRRVCAAGARACIRENKACIRENKY
FT                   CRRACASREVDRHAYAYLAYSAYSAYSAYSAYSGCSGGAASGP"
FT   gene            complement(567883..568371)
FT                   /locus_tag="BMA10229_A0541"
FT   CDS_pept        complement(567883..568371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00979"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3M1"
FT                   /protein_id="ABN00979.1"
FT                   /translation="MVGSRLAGLSIPIPRIGANEAIEFAPRACEPEFAARRRGMNGAFH
FT                   RRRQYTGYMAGVSAEFKAFEEATSGAVMTKGFLWRNKIAAGFTNSGAHAGDKLSTLMQL
FT                   ALFAARYGMHWVNLGLPPANDSTAGSPAELNRLGFGLGAGAQSNTDQGPDAAPPEQPE"
FT   gene            complement(568485..568862)
FT                   /locus_tag="BMA10229_A0543"
FT   CDS_pept        complement(568485..568862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01324"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039437"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3M2"
FT                   /protein_id="ABN01324.1"
FT                   /translation="MEIDAISRALQIYFDVMYECDLEKFDLVFHPTSSLFTMKDGELSV
FT                   RPFARYRSEIAARTPPKSVSQPRMDAILQIAVLSPEIAFAQVRVRLFGKVFIDNLNLLK
FT                   FDGRWMIVAKIFHHARTIAAV"
FT   gene            568866..570545
FT                   /locus_tag="BMA10229_A0544"
FT   CDS_pept        568866..570545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0544"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02076"
FT                   /db_xref="GOA:A2S3M3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3M3"
FT                   /protein_id="ABN02076.1"
FT                   /translation="MWPRLAGNFGGGRPRAKRGASASARCDGAGGAHRRRSARKRREGA
FT                   RRGESRYDYRFDRYFPEGYVFVKTWGQFMVETLAGLFDFEMDPQSGVALTRQLRDQLRR
FT                   AIAAGSLASGRRLPSSRALALHLRVSRNTVCAAIEQLAMEGYLDVSRGRRPVVAPMPSA
FT                   GLVAIGSDRPVSDGRSGMSQWAQRIDRSDWPFISEGRPTPFAPCVADARAFPHAIWGRC
FT                   LRTATRYAVARTSTACNRPGLRRALLHHLVEYRGVNADAHQVFLMPTAQAAIALVARVL
FT                   LDPGDLAWVESPGYGGARAAFEAAGATVQGIALDQSGMAFETSTDTPRLIFVTPAHQHP
FT                   TGLLMPPARRQALLRFAARVGARIIEDDYDSEFHYEGRPVAALQGADDADSVFYVGTFS
FT                   KSLHADIRVGYVVVPGHFVDVFAKAQRHTGQIVGATLQDALAEFIDDGHYAAHIRKTTR
FT                   LYHARRDYLCDALKAVGSELTVSPPDGGMQVVARLGPLRDDREICRRLAEAGVTARPLS
FT                   PHYCAQTGAQGLFLGFAAWNECEIDAGVRILARVIREPEPSK"
FT   gene            complement(570612..572504)
FT                   /locus_tag="BMA10229_A0545"
FT   CDS_pept        complement(570612..572504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0545"
FT                   /product="transcriptional regulator, MerR
FT                   family/methyltransferase, TIGR00027 family"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF02409; match to protein
FT                   family HMM PF05583; match to protein family HMM PF09278;
FT                   match to protein family HMM TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02561"
FT                   /db_xref="GOA:A2S3M4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3M4"
FT                   /protein_id="ABN02561.1"
FT                   /translation="MRLKIGELAKKVGLSVRALHHYDAIGLLSPSQRTDGGARLYGRDD
FT                   LIRLHRIEALKRFGYSLPAIQASLDGPPAGAPLQILRRQIAALDAQAARAQRLSRHLQH
FT                   LVAMVAAGGETAAIDWLNVLELMNMYQKHLDDNELDTLLASGPDTVAPMDPSWVGLVDE
FT                   VRDAMRRALPADSDAAQALAWRWSRLMNRMTRNDPALAGKLMGIQLGEPRAQHIVGITP
FT                   AMLTWIGEACAHARCTLFAKYLNPAQIAEVRRRQLADTHMHAWLALVAELRAHMEAGVD
FT                   AGAAPVQAIVARWQQLFRDSFCGEEEGLEAKVRDALMREPDLQLGGGFDEALLVYLNKA
FT                   HIAGRDIASGDDGPKPSALMVAKQRAAHQLLDRPLVLDDPIALSILGAAEEQALRADLD
FT                   RFRYPASLGMRSSVVVRSRLADDMRAEAIGRGVRQYVVLGAGLDTSAYRHPEAPGRLFE
FT                   VDLPATQRWKQARLREAGIALPRSLRFVPVDFEHVSLADGLARAGFDPGAPALFSWLGV
FT                   TMYLDEAAVVETLRFIAGCAKGSAVLFEYVTPLSGLPPMMRIAMEQLTAQLAARGEPWK
FT                   CFFEPAALAEMLIGLGFGSIGAWSPDELNRRYLADRADGLHIGATPARLILATV"
FT   gene            573250..573675
FT                   /locus_tag="BMA10229_A0546"
FT   CDS_pept        573250..573675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05488"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03298"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3M5"
FT                   /protein_id="ABN03298.1"
FT                   /translation="MAKRAIICVGDTTTHGGKVLEGAPTFTLNGRNVAGVGHQVLCPRC
FT                   KGIFPILPDLLGRRYPHTIGERDTAVDGMRTACGAELIASQGTGTIDDVGAGERGDGGS
FT                   PGGSAAAAAAAVAPSPTLCLECLKAAAKKAATMVARG"
FT   gene            573672..574178
FT                   /locus_tag="BMA10229_A0547"
FT   CDS_pept        573672..574178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02887"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3M6"
FT                   /protein_id="ABN02887.1"
FT                   /translation="MMTPPSINAHFEMRRQQITLPARLFAMVDALLFAEASDAPALRRA
FT                   NYSIALFDRTPDASLADHGPWLIDYALAPGPIRRVLAELAAGPIGMSWLISAYPFDRLA
FT                   AELREHLDVRLPDGRTALFRFYDARIMPDIARVMSDAQRSQFFVATYDWLVEIDGRLTG
FT                   VHPHA"
FT   gene            574171..574644
FT                   /locus_tag="BMA10229_A0548"
FT   CDS_pept        574171..574644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03598"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3M7"
FT                   /protein_id="ABN03598.1"
FT                   /translation="MLELSAEQMAGLAQIDERGFVERVRQDLVKENPAFADDGGLSSRL
FT                   WTAYRAARTFGIERDENVVAFLRLEAYAPGFYEKPATKAWLMRPGRSADARFHDYLRVI
FT                   KWRIEHPDGGLEHGGIGISGNRSGGGRAWADLGARWRRLVGRRDGGGNGESVG"
FT   gene            574949..575110
FT                   /locus_tag="BMA10229_A0549"
FT   CDS_pept        574949..575110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01362"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3M8"
FT                   /protein_id="ABN01362.1"
FT                   /translation="MKWFSGFGKIDLQIEARANIVRANPPTKLRYYFQTPLTASYFRER
FT                   LARNGIAY"
FT   gene            complement(575155..575988)
FT                   /locus_tag="BMA10229_A0550"
FT   CDS_pept        complement(575155..575988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0550"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02005"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABN02005.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(576012..576275)
FT                   /locus_tag="BMA10229_A0551"
FT   CDS_pept        complement(576012..576275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0551"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01477"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABN01477.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            576478..577179
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0552"
FT                   /note="aldose 1-epimerase, truncation; comparison of this
FT                   gene to its homologs suggests this gene has been truncated;
FT                   identified by similarity to GB:ABA50366.1; match to protein
FT                   family HMM PF01263"
FT   gene            577287..578177
FT                   /locus_tag="BMA10229_A0553"
FT   CDS_pept        577287..578177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0553"
FT                   /product="putative peptidoglycan-binding LysM/M23B
FT                   peptidase"
FT                   /note="identified by similarity to SP:P33648; match to
FT                   protein family HMM PF01476; match to protein family HMM
FT                   PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03374"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3N1"
FT                   /protein_id="ABN03374.2"
FT                   /translation="MSHGGSPLGRPPRSPRPTRAPPAARPPSAPPRPRNREPAAEPVKI
FT                   GRFCPAVAHRRDGALRGSMLLKTTRRLVVASLAALLAACGSAPVGPGFYRVERGDTLSK
FT                   IARSNRQSVANIARWNQITNPDAIEVGQVLRVAPPPGTASTSGTTGASRGPSRQAPSSS
FT                   ATSPASSVKPASSISLVWPAAGSVIRSFDGSKSKGIDIANTAGTPVIAAAAGTVVYAGN
FT                   GLRGYGNLLIVKHDADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDTDNDRVALHFELR
FT                   YGGRSIDPARYLPSR"
FT   gene            578533..580158
FT                   /gene="acsA-2"
FT                   /locus_tag="BMA10229_A0554"
FT   CDS_pept        578533..580158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsA-2"
FT                   /locus_tag="BMA10229_A0554"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01904"
FT                   /db_xref="GOA:A2S3N2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3N2"
FT                   /protein_id="ABN01904.1"
FT                   /translation="MLPHAAHYAELVERFAWRVPAHYNIGVDACDKWADGSGRLALIHE
FT                   HAHGVVARYTFDELRSSSNRLANSFARAGVKRGDRIGILLAQGPETAIAHLAAYKLGAI
FT                   AVPLFTLFGADALEFRLGDSGAVALVTDRAGYEKIAPLHASLPSLATIYCIDGAPDLAE
FT                   PGVLAFDAALAAESDTFRPADTSADDPALIIYTSGTTGKPKGALHAHRVLLGHLPGVEM
FT                   SQNLFPARARLFWTPADWAWIGGLLDVLLPSLHHGVPVLARRFEKFGGAAAFDLLARHG
FT                   VTHAFLPPTALKLMRAAVARPRERYALALESVASGGESLGAELVSWGRDAFGVTINEFY
FT                   GQTECNVVLSSCSALFEPRAGTIGKAAPGHRVAIVDDAGNALPPGVTGNIGVRAPDPVM
FT                   FIGYWRRPEATREKFAGDFLLTGDLGIADADGFIRFVGRNDDVITSAGYRIGPGPIEDC
FT                   LLEHPAVRMAAVVGVPDAVRTEIVKAFVVLNAGYEGSAALARELQTHVKTRLAAHEYPR
FT                   ALAFVDSLPMTATGKIIRRALRDT"
FT   gene            580220..580390
FT                   /locus_tag="BMA10229_A0555"
FT   CDS_pept        580220..580390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0555"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01006"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3N3"
FT                   /protein_id="ABN01006.1"
FT                   /translation="MREAAAPHACAGRHRGRRACRSNGLIGFIHVPIVARRRPPRNPSE
FT                   RPSLAARANGL"
FT   gene            580423..580740
FT                   /locus_tag="BMA10229_A0556"
FT   CDS_pept        580423..580740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03869"
FT                   /db_xref="InterPro:IPR018741"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3N4"
FT                   /protein_id="ABN03869.1"
FT                   /translation="MSSNTPPSASHSPLYLNLLGETAKIDWCDLERFFAQGKLLSVARD
FT                   LDLVSVAEAIASDDKEQVTRWLSAGHVERMQAGTAQDYATRNPELWAVVVSPWVCVQAR
FT                   S"
FT   gene            580748..582139
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0557"
FT                   /note="DNA-damage-inducible protein F, truncation;
FT                   comparison of this gene to its homologs suggests this gene
FT                   has been truncated; identified by match to protein family
FT                   HMM PF01554; match to protein family HMM TIGR00797"
FT   gene            complement(582394..582585)
FT                   /locus_tag="BMA10229_A0558"
FT   CDS_pept        complement(582394..582585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0558"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03892"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3N5"
FT                   /protein_id="ABN03892.1"
FT                   /translation="MTRIVIIALVAAVLAGCASDPRQGRRGTPPQDPPDYQGVPTDMTP
FT                   PSMLGEPGTGGTAATPAK"
FT   gene            582753..582923
FT                   /locus_tag="BMA10229_A0559"
FT   CDS_pept        582753..582923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0559"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02941"
FT                   /db_xref="GOA:A2S3N6"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3N6"
FT                   /protein_id="ABN02941.1"
FT                   /translation="MDAESIAGLIGLGIGLLVLVSLSVYESREYKRAHNGEGMIHHWMA
FT                   EHHLLDWRRKH"
FT   gene            complement(583274..584026)
FT                   /locus_tag="BMA10229_A0560"
FT   CDS_pept        complement(583274..584026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02558"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3N7"
FT                   /protein_id="ABN02558.1"
FT                   /translation="MPRAAETVTAEFRLRAAWARTEDELREAQRLRHSVFAEEMGAHVS
FT                   GPAGLDVDPFDPYCDHLLVRDLDTLKVVGTYRVLPPHQAARVGRLYAEGEFDLSRLTHL
FT                   RSKMVEVGRSCVHRDYRSGAVIMALWGGLGTYMLQNGYETMLGCASVSMADGGHYAANL
FT                   YQSLGDALTAPEYRAFPHTPLPVDELQTGAKVAPPPLIKGYLRLGAKICGAPAWDPDFN
FT                   CADFLTLFRLSDINARYARHFLSDPLPR"
FT   gene            complement(584244..584705)
FT                   /gene="sixA"
FT                   /locus_tag="BMA10229_A0561"
FT   CDS_pept        complement(584244..584705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sixA"
FT                   /locus_tag="BMA10229_A0561"
FT                   /product="phosphohistidine phosphatase SixA"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF00300;
FT                   match to protein family HMM TIGR00249"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01619"
FT                   /db_xref="GOA:A2S3N8"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3N8"
FT                   /protein_id="ABN01619.1"
FT                   /translation="MMNLILWRHAEAEDYAGTDLARQLTARGRKDAQAVAKWLRARIER
FT                   HATVLASPAARTVQTAKALTDHYRTANELAPGCDVGDVLAAAGWPDGIAPTVVVVGHQP
FT                   TLGSVAAHLLAGSHESWSVKKGGLLWLSSRTREGNGQTVLRAAISPDLV"
FT   gene            584867..584943
FT                   /locus_tag="BMA10229_A0562"
FT   tRNA            584867..584943
FT                   /locus_tag="BMA10229_A0562"
FT                   /product="tRNA-Pro"
FT   gene            585195..585677
FT                   /locus_tag="BMA10229_A0563"
FT   CDS_pept        585195..585677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01786"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3N9"
FT                   /protein_id="ABN01786.1"
FT                   /translation="MPAQCFFTLNGQRVSNLTCAGFGGVMAFSGNKQFVDKPDATAVAN
FT                   AGPIPKGRYYIVKRDTGGRLGPIRDLALDLWSNSDRSTWFALYRADAKIDDETYVNGVK
FT                   RSAFRLHPNGRWGVSDGCITVTTQVQFDQLRAYLMKQPTAKIPGTDIEYYGTVDVR"
FT   gene            585674..585934
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0564"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            586610..586867
FT                   /locus_tag="BMA10229_A0565"
FT   CDS_pept        586610..586867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0565"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03175"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3P1"
FT                   /protein_id="ABN03175.1"
FT                   /translation="MNWHCYVARELAHLEVAIGVLEKARKEFVHHTAVCDPAYWRLRLD
FT                   TIRERLDEDPTLERQMSELLARIDRLEARNPRRESADFLA"
FT   gene            complement(587290..587859)
FT                   /locus_tag="BMA10229_A0566"
FT   CDS_pept        complement(587290..587859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03054"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3P2"
FT                   /protein_id="ABN03054.1"
FT                   /translation="MASPVAHKIMIVRHAEKPAGDGAPYGVNAKGEQDVEALTVFGWQR
FT                   AGALAVLFAPSRGPLQHAELATPDWLFAAAVAKHAKSERPIDTITPLAHKLGLAIGDAY
FT                   TKGQEKDLAQAAVASKGCVLIAWQHEDIPAIADALPLGKQTVPQKWPDDRFDIVWVFDL
FT                   DTGSGTYRFSQVSQMLLKGDRNSVIE"
FT   gene            complement(587981..589054)
FT                   /locus_tag="BMA10229_A0567"
FT   CDS_pept        complement(587981..589054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0567"
FT                   /product="PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02051"
FT                   /db_xref="GOA:A2S3P3"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3P3"
FT                   /protein_id="ABN02051.1"
FT                   /translation="MPNCADIAAADHARRRALAMRRYRAGAALCAAVALVDAVWLHAGG
FT                   YALQWSGVAVAARAIAVCAAFSLVLRGVARVPRYASVAARFRYGEAARTFAWLALLAAF
FT                   VAAAGILSYLCVTLKPPLIDGALIRLDARLGFDWPAVYERIRAHPALQRALAFAYDSAQ
FT                   WQLIGIPVWLGLTRRDDDLSEFIALFMLTSVTVLLISTPFPAASAFLHFRVADPIALAG
FT                   VSDFVRLRDGTLRVIDPAALQGMVSMPSFHTVLGVLFAYALRRGRVVAPLALLFNGWMI
FT                   ASTPTQGGHYFVDVLAGLLVACAAIAALRYAADARAGTGDTARSGRPRQSMAGPAADGE
FT                   AAFSARAARASRPSGDA"
FT   gene            589569..590012
FT                   /locus_tag="BMA10229_A0568"
FT   CDS_pept        589569..590012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0568"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01117"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3P4"
FT                   /protein_id="ABN01117.1"
FT                   /translation="MNNPLRLIARLLIPFATLAAAPAASADSQALDAALDCSSTGHAFV
FT                   APLVASGAVRSQPMHVEANSMNAFRTNRSLSAYGFSVYVVLGYQANDPLFAHGDGEPIG
FT                   DWAYGVVVRGSKQAVEAKVRAAGSQAVVKDAFPFLTAIVCTSP"
FT   gene            complement(590325..591839)
FT                   /gene="ppx"
FT                   /locus_tag="BMA10229_A0569"
FT   CDS_pept        complement(590325..591839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="BMA10229_A0569"
FT                   /product="exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /note="identified by match to protein family HMM PF02541;
FT                   match to protein family HMM TIGR03706"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03606"
FT                   /db_xref="GOA:A2S3P5"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3P5"
FT                   /protein_id="ABN03606.1"
FT                   /translation="MVTSPHLLAAVDLGSNSFRLIVGRVEETPAGSQIYPVDALREPVR
FT                   LAAGLSRDKMLDRASQERGWEALKRFGERLRDFHPDHVRAVATNTLRVAKNAGEFLAEA
FT                   QAALGFPIEVIAGREEARLIYAGAAHSVPANAGKRLVVDIGGGSTEFIIGQHYTPLVME
FT                   SLYIGCVSHSRAFFPAGNVDEYTMRQAELAAKREIQIISGEYKKAGWDQAIGSSGTARA
FT                   LAELVEANGFNDAGVSHGISRGGLERLKRALIKAENVNRLKLVALKPDRVPVLAGGLSI
FT                   MLAVFEELGVDYVDTTDGALRLGVLYDLLGRTQHEDMRAVTVDGFTRRYGVDRAQAARI
FT                   GALAARFYDQLDEPEGEDRDESRTFLGWAAALHEIGLSISHSAYHKHSAYIASNADMPG
FT                   FSRTDQARLAALVLGHAGKLGKLSQSREVEWPLLFCLRLAALLCRRRNDAGLPDINVAQ
FT                   MKKGGYEVHLPSAWVQQNPLTDYSLSQEAAEWEKVGIPYRVVYTDA"
FT   gene            592115..594175
FT                   /gene="ppk"
FT                   /locus_tag="BMA10229_A0570"
FT   CDS_pept        592115..594175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="BMA10229_A0570"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="identified by match to protein family HMM PF02503"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01063"
FT                   /db_xref="GOA:A2S3P6"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3P6"
FT                   /protein_id="ABN01063.1"
FT                   /translation="MSLRYPLLNRELGILGFNERVLAQAADPHVPLLERLRFICITSSN
FT                   LDEFFEVRMAGLQEQMRDNPGALAPDGMSLQHVYDLVVERAQRLVHRQYTMLHETILPA
FT                   LEQEGIYFHGTETWSDAQIEWARRYFFDELLPVLTPIGLDPAHPFPRVLNKSLNFVIEL
FT                   EGRDAFGRQAVMGIVQAPRALPRLVRMPHALSGFQHGFVLLSSLMQRFVGELFPKLVVK
FT                   SCNQFRITRNSELFVDEDEITNLRVALQGELPARHLGNAVRLEVSADTPAHLVRRLLDE
FT                   SGLTEKDCYRVDGPVNLVRLMQLPDLVDLPELKFTPFLPAISPAIANAPSMFDAIDHGD
FT                   ILLHHPYESFQPVLELLQQAAQDPSVVAIKQTIYRTGTDSPLMDALMEAARNGKEVTVV
FT                   VELLARFDEETNINWAAQLESVGAHVVYGVVGHKCHAKMMLIVRRVTQGGKSVLRRYVH
FT                   LGTGNYHPRTARLYTDFGLMTSEPTICEDVHHVFQQLTGIGGELKLHEMWQSPFTLHPR
FT                   LMEHIRAEAGNARAGKRARIVAKMNALLEPTVIAELYEASQAGVKIDLIVRGVCALQPG
FT                   VPGLSENITVRSIVGRFLEHHRIYYFHANGEELVYLSSADWMDRNLFRRVEVAFPVRER
FT                   KLKRRVIAEGLSVFLGDNQSAWLMQSDGHYRRRRAGKAPRNAQLGLLAKFC"
FT   gene            complement(594376..595722)
FT                   /gene="phoR"
FT                   /locus_tag="BMA10229_A0571"
FT   CDS_pept        complement(594376..595722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="BMA10229_A0571"
FT                   /product="histidine protein kinase PhoR"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM TIGR02966"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03568"
FT                   /db_xref="GOA:A2S3P7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3P7"
FT                   /protein_id="ABN03568.1"
FT                   /translation="MPSVFSFVGRRIMNIIWARFLVSLVLLALVSVIIGAIAGPVPGLV
FT                   FALAMLVVQGFVSTFHTQRLWRLLDAPVYGEVPSAPGIWGEIYYRLHKLAKQWHAQVRQ
FT                   VEQQHSRFIQAIQASPNGVAMLDDRDQIEWCNAIAEVHFGLDAKRDLRQHVTHLVRHPD
FT                   FVRYLNGQHYDETLVMRGMGGNRQNVLAVQVFPYGENRKLLLTQDITELERTDAMRRDF
FT                   VANVSHELKTPLTVLSGFLETMRELPLSDDERARYLELMEQQASRMRHIVTDLLVLAKL
FT                   EGESKPPADRAVDMRTVLDHLRDDAQTLSGGHHEITFKVDETLAVTGAQTEIFSALGNL
FT                   VTNAIRYTPEGGTIRVEWRRDGAQAVFSVTDSGLGIPAAELPRLTERFYRVDRSRSRDT
FT                   GGTGLGLAIVKHVLQRHDAQLSIQSEEGRGSTFTARFPAHRTISRRHAA"
FT   gene            complement(595756..596457)
FT                   /gene="phoB"
FT                   /locus_tag="BMA10229_A0572"
FT   CDS_pept        complement(595756..596457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="BMA10229_A0572"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486; match to protein
FT                   family HMM TIGR02154"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00797"
FT                   /db_xref="GOA:A2S3P8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3P8"
FT                   /protein_id="ABN00797.1"
FT                   /translation="MPSNILVIEDEPAISELISVNLQHAGHCPIRAYNAEQAQSLISDV
FT                   LPDLVLLDWMLPGKSGIAFARDLRNNERTKHIPIIMLTARGDEQDKVLGLEIGADDYVT
FT                   KPFSPKELMARIKAVLRRRAPQLTEDVVSINGLRLDPATHRVAAQSDGSEIKLDLGPTE
FT                   FRLLHFFMTHPERVHSRTQLLDQVWGDHVFVEERTVDVHIKRLRAALKPAGCDAMIETV
FT                   RGSGYRLAKHA"
FT   gene            complement(596486..597190)
FT                   /gene="phoU"
FT                   /locus_tag="BMA10229_A0573"
FT   CDS_pept        complement(596486..597190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="BMA10229_A0573"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="identified by match to protein family HMM PF01895;
FT                   match to protein family HMM TIGR02135"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01473"
FT                   /db_xref="GOA:A2S3P9"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3P9"
FT                   /protein_id="ABN01473.1"
FT                   /translation="MSDKHLSSQFDADLNAVSSKVLEMGGLVEAQITEAMYALNEFDRA
FT                   AAERVIEAEDRLNHMEVEIDEECGNIIARRQPAARDLRLLMSISKTITNLERAGDEAEK
FT                   IAKRVRRLVDEPAARGVNIAEIKVSGDMAVTILRRALDAFARLDTVSAAQIVKDDKEID
FT                   QEFRAFVRKLVSYMQEDPRMISVGLDYLFIAKAIERIGDHAKNIAEFIIYIVKGTDVRH
FT                   QPRDLLDREANS"
FT   gene            complement(597210..598058)
FT                   /gene="pstB"
FT                   /locus_tag="BMA10229_A0574"
FT   CDS_pept        complement(597210..598058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="BMA10229_A0574"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="identified by similarity to SP:P07655; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR00972"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00727"
FT                   /db_xref="GOA:A2S3Q0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Q0"
FT                   /protein_id="ABN00727.1"
FT                   /translation="MNMAESHLDPSKLATGPAGFGAAAGQRPLAPLNAKIEVKNLNFFY
FT                   NQFHALKNINLSIPEGKVTAFIGPSGCGKSTLLRTFNKMYALYPEQRAEGEIVMDGENL
FT                   LQSKLDISLLRARIGMVFQKPTPFPMSIYDNIAFGVKMFERLTRSEMDDRVEWALTKAA
FT                   LWNEVKDKLSQSGYGLSGGQQQRLCIARGIAIRPEVLLLDEPCSALDPISTGRIEELIA
FT                   ELKSDYTVVIVTHNMQQAARCSDYTAYMYLGELIEFGETEKIFIKPARKETEDYITGRF
FT                   G"
FT   gene            complement(598074..598967)
FT                   /gene="pstA"
FT                   /locus_tag="BMA10229_A0575"
FT   CDS_pept        complement(598074..598967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="BMA10229_A0575"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00974"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01449"
FT                   /db_xref="GOA:A2S3Q1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Q1"
FT                   /protein_id="ABN01449.1"
FT                   /translation="MSAPIVNMPGPDGAALDAMRARLQRRRKATNVVALTASLAAMAFG
FT                   LLWLVWILYTTLHLGVGGLSLALFTESTPPPNTAGGGLANAIVGSLLLVALATFVGTPI
FT                   GILTGVYLAEYGQKSWLASVMRFINDILLSAPSIVVGLFVYALVVAKSGHFSGWAGVIA
FT                   LALLQIPIVIRTTENMLKLVPNALREAAFALGTPKWRMILKITLRASVGGIVTGVLLAV
FT                   ARIAGETAPLLFTALSNQFFSADMSQPMANLPVTIFKFAMSPFAEWQSLAWAGVFLITL
FT                   GVLGLNILARSIFSKK"
FT   gene            complement(598964..599902)
FT                   /gene="pstC"
FT                   /locus_tag="BMA10229_A0576"
FT   CDS_pept        complement(598964..599902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="BMA10229_A0576"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02138"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02600"
FT                   /db_xref="GOA:A2S3Q2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Q2"
FT                   /protein_id="ABN02600.1"
FT                   /translation="MRAPSRYGDIVFGGLTRVAAIVTLLLLGGIIVSLIVASMPTIEKF
FT                   GLSFLWHAEWDPNSDTYGALVPIYGTIVTSIIALVIAVPVSFGIALFLTELSPVWLRRP
FT                   LGVAIELLAAIPSIVYGMWGLLVFAPIFATYFQKPVGALLGPIPVIGALFQGPPIGIGI
FT                   LSAGVILAIMIIPYIASVMRDVFEVTPVLLKESAYGIGCTTWEVMWKIVLPYTKTGVIG
FT                   GVMLGLGRALGETMAVTFVIGNTNLLDNVSLYSPGNSITSALANEFAEAAPGLHTSALM
FT                   ELGLILFVITFVVLAVSKLMLLRLERGEGRK"
FT   gene            complement(600057..601085)
FT                   /gene="pstS"
FT                   /locus_tag="BMA10229_A0577"
FT   CDS_pept        complement(600057..601085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="BMA10229_A0577"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00975"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03358"
FT                   /db_xref="GOA:A2S3Q3"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Q3"
FT                   /protein_id="ABN03358.1"
FT                   /translation="MKLMQTAFAGLAGALFAVAAHADITGAGSTFAMPIYTKWAADYQQ
FT                   SGGAKVNYQGIGSSGGLKQIVAKTVDFAGSDAPLKDDELAKEGLFQFPTVVGGVVPVIN
FT                   VPGVKAGELTLSGAVLGDIYLGKIKKWNDPAIAALNPKVKLPDTDIAVVRRADGSGTSF
FT                   IWTNYLSKVNDEWKSKVGEGTTVNWPTGTGGKGNDGVAAFVQRLPGAIGYVEWAYAKKN
FT                   NMVYTALKNSTGTVVEPKTETFKAAAAGANWSKSFYQILTNQPGKEAWPVVGATFVLLH
FT                   AKQDKPAQGAETLKFFDWAFKNGAKAADDLDYISLPASVETEIRKQWKVKVTDAAGKAV
FT                   AE"
FT   gene            complement(601521..602879)
FT                   /gene="glmM"
FT                   /locus_tag="BMA10229_A0578"
FT   CDS_pept        complement(601521..602879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BMA10229_A0578"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880;
FT                   match to protein family HMM TIGR01455"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02024"
FT                   /db_xref="GOA:A2S3Q4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S3Q4"
FT                   /protein_id="ABN02024.1"
FT                   /translation="MGRRYFGTDGIRGKVGDAPITPDFVLRLGYAAGKVLASAPGRAAS
FT                   GARPTVLIGKDTRVSGYMLEAALEAGFSAAGVDVMLAGPMPTPGVAYLTRALRLSAGVV
FT                   ISASHNPYHDNGIKFFSADGNKLPDEIEAEIEAWLDKPLDCAASDGLGKARRLDDAAGR
FT                   YIEFCKSTFPAAFDLRGMKLVVDCAHGAAYQVAPHVFHELGADVIPIGVAPNGFNINDG
FT                   VGATAPDALMRAVRANHADLGIALDGDADRLLVVDHTGRLYNGDELLYVLVKDRIATNG
FT                   QVEGAVGTLMTNFAVEVALKEAGVQFVRAAVGDRYVLEQLRERGWQLGAEGSGHILSLD
FT                   RHSTGDGIVSALLVLAALKRSGKTLAQMLEGVTLFPQKLINVRMKPGADWKGSEAIRRA
FT                   IDSAEQALSGSGRVLIRASGTEPVLRVMVEARQATDANRHAEAIADAVKQATA"
FT   gene            complement(602905..603795)
FT                   /gene="folP"
FT                   /locus_tag="BMA10229_A0579"
FT   CDS_pept        complement(602905..603795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BMA10229_A0579"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03024"
FT                   /db_xref="GOA:A2S3Q5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Q5"
FT                   /protein_id="ABN03024.1"
FT                   /translation="MSSSDSVFPVPAPLQCGRFTLTFERPLVMGILNVTPDSFSDGGRY
FT                   VARDAALAQAERMLAEGADILDIGGESTRPGAPPVPLNEELERVIPLVEALRGRNVPLS
FT                   IDTYKPAVMRASLAAGADLINDIWGLRQPGAIDAVRDSACGLCVMHMLGEPRTMQVHAP
FT                   EYRDVIDDVRAFLAERADALVQAGVDARRISVDPGFGFGKSVIEHNYALLAHLPRTAPA
FT                   RPDGRAYPILAGMSRKSMLGAVIGRPAPERIAASVAAAVCAAERGAAIVRVHDVAATVD
FT                   ALKVWSAVRDAARRA"
FT   gene            complement(603908..605794)
FT                   /gene="ftsH"
FT                   /locus_tag="BMA10229_A0580"
FT   CDS_pept        complement(603908..605794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BMA10229_A0580"
FT                   /product="cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03742"
FT                   /db_xref="GOA:A2S3Q6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Q6"
FT                   /protein_id="ABN03742.1"
FT                   /translation="MNNNMFSKAAVWLVIALVLFTVFKQFDKPRVQEGVSYSQFMDDAK
FT                   NGKVKNVVVQGRNLTVTPADGQKYQIVSPGDIWMVGDLMKYGVQVSGKADDEPNALVSA
FT                   LYYLGPTLLIIVFWFYMMRQMQGGGKGGAFSFGKSRARLIDENNNAVNFSDVAGCDEAK
FT                   EEVSELVDFLRDPQKFQKLGGRIPRGVLLVGPPGTGKTLLARAIAGEAKVPFFSISGSD
FT                   FVEMFVGVGAARVRDMFEQAKKHAPCIVFIDEIDAVGRHRGAGMGGGNDEREQTLNQML
FT                   VEMDGFEANSGVIVIAATNRSDVLDKALLRPGRFDRQVYVGLPDIRGREQIMRVHLRKV
FT                   PIANDVDAAVIARGTPGFSGADLANLVNEAALFAARRGKRIVEMQDFEDAKDKIFMGPE
FT                   RKSAVIREEAKRATAYHESGHAVIAKLLPKADPVHKVTIIPRGRALGVTWQLPEHDNET
FT                   YSKDYLLDRLAILFGGRVAEELFLNLVSTGASDDFNKATQTARAMVARFGMTDALGPMV
FT                   YVDDENDGGPFGRGFTRTISEATQQKVDAEIRRVLDEQYGLARRLLEENRDKVEAMTAA
FT                   LMEWETIDADQINDIMEGRPPRSPKSVPPAGDPSSGGSSGAEVKPGNATAPA"
FT   gene            complement(605962..606624)
FT                   /gene="rrmJ"
FT                   /locus_tag="BMA10229_A0581"
FT   CDS_pept        complement(605962..606624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrmJ"
FT                   /locus_tag="BMA10229_A0581"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01728"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00756"
FT                   /db_xref="GOA:A2S3Q7"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S3Q7"
FT                   /protein_id="ABN00756.1"
FT                   /translation="MAKNRFNQSWLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKL
FT                   IRPGQVIVDLGAAPGSWSQYARNKLAQGKRRDAVREGGIDGTIIALDMLPMEPVADVHF
FT                   IQGDFREESVLHQLEEVLAGRAVDLVISDMAPNLSGVAVADAARIEHVCDLALEFAQNH
FT                   LKPDGALLVKCFHGSGYSQIVEKFKHQFKTVAPRKPKASRDKSSETFILGRHLKQPR"
FT   gene            606818..607372
FT                   /locus_tag="BMA10229_A0582"
FT   CDS_pept        606818..607372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01985"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03779"
FT                   /db_xref="GOA:A2S3Q8"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Q8"
FT                   /protein_id="ABN03779.1"
FT                   /translation="MPALSLSPAERSALRSEAHALKPVVLIGAEGLTDAVLAEIEVHLA
FT                   AHQLIKIRVFGDERDERVAIYDEICDRLNAAPIQHIGKLLVIWKPEQAEAAPQRGRRGV
FT                   PSAREAARASAAQPDEGRAAKGRAPRVVKVVKQSPNAPAVRRPKPQKVRVLGNERVTAG
FT                   GNVKRAKKRQSSAKRQHQNEK"
FT   gene            complement(607443..607946)
FT                   /locus_tag="BMA10229_A0583"
FT   CDS_pept        complement(607443..607946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0583"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01567"
FT                   /db_xref="GOA:A2S3Q9"
FT                   /db_xref="InterPro:IPR025423"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Q9"
FT                   /protein_id="ABN01567.1"
FT                   /translation="MAGAAAPHRLFRLLATVWVGSLLTIGYAVAPVLFATLDRATAGAV
FT                   AARLFSIEATIGAVCGVLLIGLSNLLVRRGHDAYWPLRWLLAAMLGCVLVGYFALQPFM
FT                   NALRVAALEAGTDVGHSAYAGRFALLHGVSSVFYLVESLVGIGLIWRLPGQGGASPLGG
FT                   ERRA"
FT   gene            complement(607946..608422)
FT                   /gene="greA"
FT                   /locus_tag="BMA10229_A0584"
FT   CDS_pept        complement(607946..608422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="BMA10229_A0584"
FT                   /product="transcription elongation factor GreA"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449; match to protein
FT                   family HMM TIGR01462"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01917"
FT                   /db_xref="GOA:A2S3R0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3R0"
FT                   /protein_id="ABN01917.1"
FT                   /translation="MSTIPLTKRGADQLRDELQRLKSVERPAVINAIAEARAQGDLSEN
FT                   AEYDAAKEKQGFIEGRIAEIESKLSAAQIIDPATLDTDGRVVFSSTVELEDLETGAKVK
FT                   YQIVGDDEADLDHGLISVSSPIARALIGKSEGDVAAVQAPSGVREYEIISVQFV"
FT   gene            complement(608541..611795)
FT                   /gene="carB"
FT                   /locus_tag="BMA10229_A0585"
FT   CDS_pept        complement(608541..611795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="BMA10229_A0585"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM PF02222; match to protein family HMM PF02786;
FT                   match to protein family HMM PF02787; match to protein
FT                   family HMM TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02966"
FT                   /db_xref="GOA:A2S3R1"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3R1"
FT                   /protein_id="ABN02966.1"
FT                   /translation="MPKRTDINSILIIGAGPIIIGQACEFDYSGAQACKALREEGYKVI
FT                   LVNSNPATIMTDPNTADVTYIEPITWEVVERIIAKERPDAILPTMGGQTALNCALDLFH
FT                   HGVLEKYGVELIGASPEAIDKAEDRQKFKDAMTKIGLGSAKSGIAHSMEEALKVHADIA
FT                   AATGGSGYPVVIRPSFTLGGSGGGIAYNREEFEEICKRGLDLSPTRELLIEESLLGWKE
FT                   YEMEVVRDRADNCIIVCSIENLDPMGVHTGDSITVAPAQTLTDKEYQILRNASLAVLRE
FT                   IGVDTGGSNVQFSINPKDGRMVVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLD
FT                   ELKNEITGGATPASFEPTIDYVVTKIPRFAFEKFREADSRLTTQMKSVGEVMAIGRTFQ
FT                   ESFQKALRGLEVGVDGLDEKTTSRDEIIREIGEPGPDRIWYVGDAFRVGMSREQIFEET
FT                   AIDPWFLAQIEQIVLKEKALAGRTLASLTKDELHYLKQSGFSDRRLAKLLGATPADVRA
FT                   RRLELNVRPVYKRVDTCAAEFATKTAYMYSTYEEECEAQPTGNRKIMVLGGGPNRIGQG
FT                   IEFDYCCVHAALAMREDGYETIMVNCNPETVSTDYDTSDRLYFEPLTLEDVLEIVDKEK
FT                   PVGVIVQYGGQTPLKLALDLEAHGVPIIGTSPDMIDAAEDRERFQKLLQDLGLRQPPNR
FT                   TARAEDEALALADEIGYPLVVRPSYVLGGRAMEIVHEPRDLERYMREAVKVSNDSPVLL
FT                   DRFLNDAIECDVDCICDGDAVFIGGVMEHIEQAGVHSGDSACSLPPYSLSTQTVAELKR
FT                   QTGAMAKALNVVGLMNVQFAIQQVPRPDGSKEDIIYVLEVNPRASRTVPYVSKATSLPL
FT                   AKIAARAMVGQKLAQQGVTKEVEPPYFSVKEAVFPFIKFPTVDPVLGPEMRSTGEVMGV
FT                   GATFGEALFKSQLAAGSRLPESGTVLLTVMDADKPKAVEVAKMLHDLGYPLVATRGTAA
FT                   AIEAAGVPVKVVNKVKDGRPHIVDMIKNGEIALVFTTVDETRAAIADSRSIRMSAQAHK
FT                   VTYYTTMSGARAAVEGLRYLKDLEVYDLQGLHARLN"
FT   gene            complement(611847..612509)
FT                   /locus_tag="BMA10229_A0586"
FT   CDS_pept        complement(611847..612509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0586"
FT                   /product="putative homoserine/threonine efflux protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02790"
FT                   /db_xref="GOA:A2S3R2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3R2"
FT                   /protein_id="ABN02790.1"
FT                   /translation="MFGHALGITDLWTYVFGVVFIILLPGPNSMYVLSLAAQRGVKAGY
FT                   RAACGVFVGDTVLMVLSAAGVASLLKANPLLFSVVKYGGAAYLLYIGVGMLRGAWRKLA
FT                   RPAADAGADVRRAVDGERPFRKALVVSLLNPKAILFFISFFIQFVDPAYAHPALSFVVL
FT                   GAIAQLASFVYLSTLIFTGARLADHFRRRRKLAAGASGGVGGLFVGFSVKLALATMS"
FT   gene            complement(612541..613686)
FT                   /gene="carA"
FT                   /locus_tag="BMA10229_A0587"
FT   CDS_pept        complement(612541..613686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="BMA10229_A0587"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00988; match to protein
FT                   family HMM TIGR01368"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02097"
FT                   /db_xref="GOA:A2S3R3"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3R3"
FT                   /protein_id="ABN02097.1"
FT                   /translation="MLPSFSPALLALADGTVFRGYSIGAAGHTIGEVVFNTAITGYQEI
FT                   LTDPSYARQIVTLTYPHIGNVGVNAEDVEATKVHAAGLIVRDLPALASNFRMARTLGDY
FT                   LRDEGVVAIAGIDTRKLTRILRDKGAQNGCILTGSDDETKALALARSFPGLAGMDLAKV
FT                   VSTAKPFEWKQTEWRLGSGYGMQETPRYRVVAFDFGVKYNILRMLAERGCHVSVLPAQS
FT                   SAADALALNPDGIFLSNGPGDPQPCDYAIAATREFIERGVPTFGICLGHQIMGLALGAK
FT                   TLKMKTGHHGANHPVKDLANGRVVITSQNHGFAVDADSLPANARATHVSLFDGTLQGFE
FT                   LTDKPAFCFQGHPEASPGPHDIGYLFDRFTALMDAAKARSA"
FT   gene            complement(614083..615105)
FT                   /locus_tag="BMA10229_A0588"
FT   CDS_pept        complement(614083..615105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0588"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03484"
FT                   /db_xref="GOA:A2S3R4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3R4"
FT                   /protein_id="ABN03484.1"
FT                   /translation="MTAKLAHWDFVRPVATTRVLVDVGVEQGLAVGQCLGGSGVCADLL
FT                   DKPDATVAAAQELRIVRNLMRLLGPDFPLGIEIGRRYHATAYGVWGFALMSSATFGDAV
FT                   SVGLRYLQLTSTFCEIRPTLRGDDATLVIDDRDLPGDVRDVLVEITVAALITLQFDLDA
FT                   ANLPVKRLALKMKPPSYAGRFRTLFDATPEFGAAHNALTVDARCLDLKLPQRNALTRRR
FT                   CEDECRRVLERHRRSEGWAGRVRRQLAGDPARGPTMDVLAAELGLSPRTLRRRLANEGT
FT                   DYETVVDELRQALAEALLATTTLTLAEVSERLGYSEPSAFARAFRRWKGMSPSEYRRAA
FT                   "
FT   gene            complement(615186..615320)
FT                   /locus_tag="BMA10229_A0589"
FT   CDS_pept        complement(615186..615320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0589"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03595"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3R5"
FT                   /protein_id="ABN03595.1"
FT                   /translation="MSFARGIGGARPAPRRRLRDGGRLADAAAGRPASRPRLAGRARP"
FT   gene            615333..616475
FT                   /locus_tag="BMA10229_A0590"
FT   CDS_pept        615333..616475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0590"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01487"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3R6"
FT                   /protein_id="ABN01487.1"
FT                   /translation="MSTILAPHSGAAPTLPLIDSDHRRRGWRGWRGRLIAKAAMQILRP
FT                   VEPCVQHGLPAPTTFPPNGGARRFGLVHYGIMIPDLPAPHRFMATAIILGSAGMRVFDA
FT                   DFAAAPGDGPLQTATLVHGTAAAVDRHFTRYSIPRDVESRADGSLLRLGDDLELSGRYP
FT                   EFRLESRRGGFAVDLTLTATGDVTWFAKGLFYEHIALVTRYRGTIEHGGATTEVAGLCT
FT                   YEYARGTSPYLLRNRFLPQAAKLPWDVFSYQVIDLDADTQLLLAHVQVDQYPALTSAYL
FT                   RVIGQRAHRLDADVHFRVTSAQARPAVGPDGHAMWLPETFAWRVRDRHGRTLFAIDATV
FT                   DTPMLFGIGTGYVGGYRWEGERDGRPASGRGYIEYVDRRG"
FT   gene            complement(616582..617820)
FT                   /locus_tag="BMA10229_A0591"
FT   CDS_pept        complement(616582..617820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0591"
FT                   /product="major facilitator family tranporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00848"
FT                   /db_xref="GOA:A2S3R7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3R7"
FT                   /protein_id="ABN00848.1"
FT                   /translation="MIVMSLMQFRVFALFAIGYFVSYVFRGVNLGFAPLITRELGLSAA
FT                   DLGLLTSLYFLGFACAQIPAGVLLDRYGPRRVSAALLLVAAAGAWVFGAAHDTGAMMLG
FT                   RLLIGVGVSVCLGGAFKALAQHFPVARLPLLNGFVMAVGGLGGVAVGSPLDWLLGFAGW
FT                   RAVCAGLGAFTVAVAAALWAFAPDARQSRHDASVAAQFAGTWRIVTNRTFWKIASFSVV
FT                   TQGVFYAMQSLWVGAYLRDVSGFAPRDAAVLVSVLGFAMMAGCVGFGAAARGLERRGMS
FT                   LYAFCGFGMALFVATQLAIMLRAPLPAAVLWAAYGVFGGVGILSYAVLAEYFPVHVIGR
FT                   ANTTLTLVIFVLIFGFQVGVGAVLSHWPMRAGHYPAEAHLSAWGALVALQIASAVWYVL
FT                   PDRALDKSARHAG"
FT   gene            complement(617955..619547)
FT                   /locus_tag="BMA10229_A0592"
FT   CDS_pept        complement(617955..619547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0592"
FT                   /product="putative membrane-bound lytic murein
FT                   transglycosylase D"
FT                   /note="identified by similarity to SP:P23931; match to
FT                   protein family HMM PF01464; match to protein family HMM
FT                   PF01476; match to protein family HMM PF06474"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03274"
FT                   /db_xref="GOA:A2S3R8"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3R8"
FT                   /protein_id="ABN03274.2"
FT                   /translation="MRFLLSALLVLTLAACAGTGPTAQNPAASDPQAASDYLRKSASAK
FT                   ETVDVDKQSVGDLTTADSDLWARIRRGFQMPDLQSDLVDMQASWYAQRPDYVQRMTERS
FT                   QKYLYHIVEELESRHMPTELALLPFIESAYNPQALSVAKAAGMWQFMPATGRTFNLKRN
FT                   MWQDERRDVLASTSAALDYLSRLHDMFGDWYLALAAYNWGEGNLQRAIARNQAAGLPTD
FT                   YQSLRMPNETRNYVPKLQAVKNIVTNPQQYGLTLPEIPNHPYFVTVTTSRDIDVTVAAK
FT                   LANLPLDEFKSLNPSFSKPVILGATQPQILLPFDNAAAFEKGLKSYDGQLSSWTAYTVT
FT                   ERARPAAIAEKIGVDADTLMQVNKIPAGMRLKPGSTIVVPRTDDDDEDISADVAENGVL
FT                   AMEPDVPDTRKMLIRVRRKQSMEALASRYGVSAAQLRGWNRTRRAVVMPGQTMVLHVPV
FT                   GRAVPAEPGPERIATSVGGGRIERASLHTGGKASSRGRKAGPAAKASAKAATKSGAKAA
FT                   PAKTAGRKTTKKK"
FT   gene            619546..619638
FT                   /locus_tag="BMA10229_A0593"
FT   CDS_pept        619546..619638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0593"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02569"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3R9"
FT                   /protein_id="ABN02569.2"
FT                   /translation="MKISASNGWKLQAIVRKCVLRVNKKAEKTC"
FT   gene            complement(619700..620506)
FT                   /gene="gloB"
FT                   /locus_tag="BMA10229_A0594"
FT   CDS_pept        complement(619700..620506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="BMA10229_A0594"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="identified by similarity to SP:Q47677; match to
FT                   protein family HMM PF00753; match to protein family HMM
FT                   TIGR03413"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02189"
FT                   /db_xref="GOA:A2S3S0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3S0"
FT                   /protein_id="ABN02189.1"
FT                   /translation="MNELEYVPVPAFDDNYIWLVSDGRQAVAVDPGEAAPVRRHLDARG
FT                   WRLTAILLTHHHRDHVGGVAELLAGAREGEPIAVFGPAHEAIEHITRRVAGGERVRIGA
FT                   PALEFDVIDVPGHTRGHIAYFQPAGPGNAAPHLFCGDTLFSCGCGRLFEGTPAQMLASL
FT                   DALAALPGDTRVHCAHEYTLSNIQFALACEPGNAALAAWRDEALARRARGEPTLPTTIA
FT                   HECAVNPFLRADSASIRATLEARLHEAAPDRLAAFTLMREWKNRFR"
FT   gene            620527..621339
FT                   /locus_tag="BMA10229_A0595"
FT   CDS_pept        620527..621339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08241"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01424"
FT                   /db_xref="GOA:A2S3S1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3S1"
FT                   /protein_id="ABN01424.1"
FT                   /translation="MSDRSIIDWPAWTDSPPGRYVLGWEQAQLDRTVSDVFGFHALQLG
FT                   LPQLDALRENRMPCRGLVLDPASGASAPYHYPWAREARSAEHAPAGRSTVWCDLLDLPF
FT                   ESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGARHSVGKMAK
FT                   RPFVPATRDQITFIRLKDWIKLLGFDLERGRFGCYRPPLATDKWLSRYAFMEAAGDRWW
FT                   PIFGAVYMVTAIKRVRGMRLVGPIKMKKPVLAPGLTPAATPTTHQEHS"
FT   gene            621336..621782
FT                   /gene="rnhA"
FT                   /locus_tag="BMA10229_A0596"
FT   CDS_pept        621336..621782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="BMA10229_A0596"
FT                   /product="ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF00075"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03534"
FT                   /db_xref="GOA:A2S3S2"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3S2"
FT                   /protein_id="ABN03534.1"
FT                   /translation="MTLQTIDIYTDGACKGNPGPGGWGALLRYGAQEKELFGGEPGTTN
FT                   NRMELTAVIAALEALKRPCKVVVHTDSQYVQKGISEWIHGWKKKGWVTAAKTPVKNADL
FT                   WQRLDALVAQHDVEWRWVKGHAGHPENERADALANRGVESLAQA"
FT   gene            621801..622562
FT                   /gene="dnaQ"
FT                   /locus_tag="BMA10229_A0597"
FT   CDS_pept        621801..622562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="BMA10229_A0597"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM TIGR00573; match to protein
FT                   family HMM TIGR01406"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02784"
FT                   /db_xref="GOA:A2S3S3"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3S3"
FT                   /protein_id="ABN02784.1"
FT                   /translation="MPFTTDSNFRFPDMRQIILDTETTGLNARAGDRIIEIGCVELLNR
FT                   RLTGKNLHFYVNPERDSDPGALAVHGLTTEFLSDKPKFAEIVDPLRDFVRDAELIIHNA
FT                   PFDLGFLDAEFALLGLPSFTDHCAGVIDTLVQAKQMFPGKRNSLDALCDRFGISNAHRT
FT                   LHGALLDSELLAEVYLAMTRGQESLVIDMLDEAGDAHRNGDAPRMAFSGLDLPVLAATD
FT                   AELAAHEAQLDALDKSAKGVCVWRKEAVGEA"
FT   gene            complement(622995..623327)
FT                   /locus_tag="BMA10229_A0598"
FT   CDS_pept        complement(622995..623327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02694"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01103"
FT                   /db_xref="GOA:A2S3S4"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S3S4"
FT                   /protein_id="ABN01103.1"
FT                   /translation="MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSL
FT                   ALFAWLLTLHPAAAARTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVI
FT                   ALQPRG"
FT   gene            623336..623737
FT                   /locus_tag="BMA10229_A0599"
FT   CDS_pept        623336..623737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0599"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03852"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3S5"
FT                   /protein_id="ABN03852.1"
FT                   /translation="MREMRVENAARRPRQTARSYPTRRPPNRRMTGNLHDPPPSCYYVA
FT                   SFNSLRLSFISVTRPFGRVPRLVARNFAHKKARLRAAFFVSTPSKGIQPAAYATRCAGS
FT                   PTVPMRRSFLTSASARRPSEPRRSVSVMD"
FT   gene            623745..625349
FT                   /gene="proP"
FT                   /locus_tag="BMA10229_A0600"
FT   CDS_pept        623745..625349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="BMA10229_A0600"
FT                   /product="proline/betaine transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02552"
FT                   /db_xref="GOA:A2S3S6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3S6"
FT                   /protein_id="ABN02552.1"
FT                   /translation="MRPFTLATDPRPIASGTPGKPWRTAPRRAVRPPSQEFSTLTATPA
FT                   PSSSSSAPTEGALPAAAHEITVVDQGLLKRAVGAMALGNAMEWFDFGVYSYIAVTLGQV
FT                   FFPSSSPSAQLLATFGTFAAAFLVRPLGGMVFGPLGDRIGRQRVLAMTMIMMAVGTFAI
FT                   GLIPSYDSIGLLAPVLLLVARLVQGFSTGGEYGGAATFIAEFSTDKRRGFMGSFLEFGT
FT                   LIGYVMGAGVVALLTASLSHDALLSWGWRVPFLIAGPLGLIGLYIRMRLEETPAFKRQA
FT                   EAREAQDKAVPKAHFRRQLARHWRALLLCVGLVLIFNVTDYMALSYLPSYLSSTLHFDE
FT                   AHGLVLILIVMVLMMPMTLATGRLSDAVGRKPVMLAGCVGLFALAIPALLLIRTGETAL
FT                   VFGGLLILGALLSCFTGVMPSALPALFPTEIRYGALAIGFNVSVSLFGGTTPLAAAWLV
FT                   DATGNLMMPAYYLMGAAVIGAISVLALPESARQPLKGSPPAVASHREAHALAREIKRRE
FT                   AAERDDSGYPSAAALRA"
FT   gene            complement(625819..626208)
FT                   /locus_tag="BMA10229_A0601"
FT   CDS_pept        complement(625819..626208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0601"
FT                   /product="glutathione S-transferase domain protein"
FT                   /note="identified by match to protein family HMM PF00043"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01973"
FT                   /db_xref="GOA:A2S3S7"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3S7"
FT                   /protein_id="ABN01973.1"
FT                   /translation="MPDDLPARVRVLELTGLALAAAEKTVQVVYEHGLRPGEKQHQPWL
FT                   DRVLGQLDAAYGALDARIAGASGWLVGERITQADVTVAVAWRFTQFMQGDYPDLARVDP
FT                   ARYPALAALSARAEALPEFEGTPLD"
FT   gene            626333..626596
FT                   /locus_tag="BMA10229_A0602"
FT   CDS_pept        626333..626596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0602"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01905"
FT                   /db_xref="GOA:A2RW75"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW75"
FT                   /protein_id="ABN01905.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            626620..627453
FT                   /locus_tag="BMA10229_A0603"
FT   CDS_pept        626620..627453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0603"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01150"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABN01150.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(627464..627700)
FT                   /locus_tag="BMA10229_A0604"
FT   CDS_pept        complement(627464..627700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0604"
FT                   /product="hypothetical GST-like protein yibF"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03735"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3T0"
FT                   /protein_id="ABN03735.1"
FT                   /translation="MKLIGMLDSPFVRRVAISAKLLGLPFEHHSISVFRQFDAFKSFNP
FT                   VVKAPTLLTDDGTMLVDSDLPPDLPPSIGPMGF"
FT   gene            complement(628134..629015)
FT                   /locus_tag="BMA10229_A0605"
FT   CDS_pept        complement(628134..629015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00736"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3T1"
FT                   /protein_id="ABN00736.1"
FT                   /translation="MHERPPITAETTRFAARDGRLLTGTFYAPGAPSASNGRSVLVSGA
FT                   LGVPRGFYERYARFLASDGFTVLTYDYRGIGDSRKPPAEADGASLRDWGEADLPGALDH
FT                   LAARAPSHRLLAVAHSVGGQLFGLAHNNGRAAALLSICCPSGYWRLWPWPHRLWLAPLW
FT                   FCVVPALGGVLSHLPVRRAGLGFAADLPAGVMREWARWCRHADYLVDDEGHPLREHFRG
FT                   YRGRILAYTVSDDWMAPPAAVQALHRFYSTAQVEHREIAPDRRRHAIGHFGYFRDDNRA
FT                   LWPLGAAWLREQ"
FT   gene            complement(629027..629407)
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0606"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(629364..629849)
FT                   /locus_tag="BMA10229_A0607"
FT   CDS_pept        complement(629364..629849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0607"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02634"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3T3"
FT                   /protein_id="ABN02634.1"
FT                   /translation="MSAFECARAAQLPSRDAALGAYFDADAGSTDIEVDLIHRARTRVL
FT                   VAGGASVPAAVAAALCAARGRGVDVRVVLDRTGRATRYSGAAFLANAGIDVVLSDRVPN
FT                   AHGPFVVVDDAVVLGRASFAQTRDARAAGNFDVFYRAPQLAQSYATAFWRLYGLARR"
FT   gene            complement(630003..630941)
FT                   /locus_tag="BMA10229_A0608"
FT   CDS_pept        complement(630003..630941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0608"
FT                   /product="acyl transferase domain protein"
FT                   /note="identified by match to protein family HMM TIGR03131"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01850"
FT                   /db_xref="GOA:A2S3T4"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR017554"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3T4"
FT                   /protein_id="ABN01850.1"
FT                   /translation="MTIAILCSGQGGQHAGMFALTADLPEAAPLFAHAAALLGADPREW
FT                   VCDADDEALRENFAAQLVCTLQAVAAMTRLDALLPRRRCVAGYSVGELAAWSVAGLVEA
FT                   RDALDLVAARARAMDAASDGDARMLFVRGLARDAVDASCAAHGAAVAIVNPGDAYLLAG
FT                   PRAALDALAADARARGAARVTPVCVRVASHTRWLDAAVPRFRAALAGARIARAPAPGTR
FT                   LLSGIDGAPVLDVAAGADKLARQIAEPLDWAACVAGCVEAGARAFVELGPGRALAEMAA
FT                   AAFPALPARSLADFRSWDGVRAWLSRVDLDA"
FT   gene            complement(630938..632209)
FT                   /gene="citG"
FT                   /locus_tag="BMA10229_A0609"
FT   CDS_pept        complement(630938..632209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="BMA10229_A0609"
FT                   /product="triphosphoribosyl-dephospho-CoA synthase"
FT                   /EC_number="2.7.8.5"
FT                   /note="identified by match to protein family HMM PF01874;
FT                   match to protein family HMM TIGR03132"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01131"
FT                   /db_xref="GOA:A2S3T5"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3T5"
FT                   /protein_id="ABN01131.2"
FT                   /translation="MAMKRHACAVAKPARRDAMCRDRARALDDGGGADTLLDALDASGV
FT                   SNASSSMGAGDASNRPNIAAVSSIWASQYFPPATRNASDGADARDSRGRRRHPTFAAHR
FT                   LASLTATATATATATAAATPASIPTPTPRPTSTATPTPTATAIAANAVRCLRVEIDTWP
FT                   KPGLVSHVDAGSHDDMTADTFYRSAAALAPFFAELADAGARDAGMPALRKIGLRAERAM
FT                   LAATGGVNTHRGAIFGLGLLCAAAGLRGSRERRAQRGQAAGATLGDLVAARWGDEIAGG
FT                   PRAADSHGARAARRYGAGGARAEAAGGFARVYAVGVPALRDGARRARGDAEAARVHACF
FT                   ALIAALDDDTNLLHRGGRDGLDFAQRTAREFLAAGGVGACDWRARAAAAHRAFVARRLS
FT                   PGGAADLLAMSLFVVALDDARALP"
FT   gene            complement(632200..633090)
FT                   /gene="mdcG"
FT                   /locus_tag="BMA10229_A0610"
FT   CDS_pept        complement(632200..633090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcG"
FT                   /locus_tag="BMA10229_A0610"
FT                   /product="mdcG protein"
FT                   /note="identified by match to protein family HMM TIGR03135"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03759"
FT                   /db_xref="GOA:A2S3T6"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3T6"
FT                   /protein_id="ABN03759.1"
FT                   /translation="MRHTLVRVRAQAWPALLAAHGGIGTLPFVRDWAARGWPLIVRRRS
FT                   PCDAGVPLGLPLPPSEGKRRVALAAAREQIDSACALPTLADVGRQAPPAWRPTLARLRA
FT                   LADAHRVDCRVFGSLAWQTLTGLRYLSDESDLDVLLMPCGASSSASLFRFSSSFASSFA
FT                   SVSVSPSSPSVSIPQSSRAWPVPALASASSSAAVTGAEASAPMTAQMEASASRLSRWPG
FT                   SSSMPSRRDAIAPFLAALAEIDADAPMRIDGELLCADGAGVNWRELHAGGRAVAMKTAT
FT                   GVELVAPRTFLEAWR"
FT   gene            complement(633101..633826)
FT                   /gene="mdcC"
FT                   /locus_tag="BMA10229_A0611"
FT   CDS_pept        complement(633101..633826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcC"
FT                   /locus_tag="BMA10229_A0611"
FT                   /product="malonate decarboxylase, gamma subunit"
FT                   /note="identified by match to protein family HMM PF06833;
FT                   match to protein family HMM TIGR03134"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03152"
FT                   /db_xref="GOA:A2S3T7"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3T7"
FT                   /protein_id="ABN03152.1"
FT                   /translation="MTLDDVLASLFPSGHDVAADAAGLLAGHGMLAGRALDVIGVAHGA
FT                   ALGVDGALALAERVLATIRRGGETPILVLVDGDSQRMSKRDELLGLNECLAHLAKCLLH
FT                   ADALGHPTIGLLYGHAAAGAFIATALATRTLVALPGAQPEVMDLQAISRVTKLPVDVLR
FT                   EKARSTAVFAPGLENFAKTGAVDAVLDPARPLAEQLAAVLARPADRCDRRDRYGAERGG
FT                   RPVAADVAQRVYELARAGR"
FT   gene            complement(633813..634760)
FT                   /gene="mdcB"
FT                   /locus_tag="BMA10229_A0612"
FT   CDS_pept        complement(633813..634760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcB"
FT                   /locus_tag="BMA10229_A0612"
FT                   /product="malonate decarboxylase, beta subunit"
FT                   /note="identified by match to protein family HMM TIGR03133"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00678"
FT                   /db_xref="GOA:A2S3T8"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3T8"
FT                   /protein_id="ABN00678.1"
FT                   /translation="MNAAATTLHPKLAPAGASWFEASARQRLAGLVDAGSLDEFAGPPA
FT                   RLASPHLPLFDLPQQFDDGMIVGRATLAGEPVFVAAQEGRFMGGAFGEVHGAKLTGLLR
FT                   AARELRAAPVLILFDTGGVRLQEANAGEIAVSEIVRAVIDARAAGVPVVGLVGGRAGCY
FT                   GGGGIIAACCSALAVSEAGRIGVSGPEVIESRRGVDEFDSRDRALVWRTMGGKHRRLVG
FT                   GADAFVDDTIDAFRHAAIALLARVRAGGAFGTATLEAEHARLAARIARFRDCDDALDVW
FT                   RALGAPDAGAIPALDAAAFAALADRLTEVCDDAR"
FT   gene            complement(634757..635074)
FT                   /gene="mdcD"
FT                   /locus_tag="BMA10229_A0613"
FT   CDS_pept        complement(634757..635074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcD"
FT                   /locus_tag="BMA10229_A0613"
FT                   /product="malonate decarboxylase, delta subunit"
FT                   /note="identified by match to protein family HMM PF06857;
FT                   match to protein family HMM TIGR03130"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02671"
FT                   /db_xref="GOA:A2S3T9"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3T9"
FT                   /protein_id="ABN02671.1"
FT                   /translation="MEQLNYRHTARARAKGDAEWALVGVVASGNLEVLVERVLPGNECE
FT                   VDIRTAAVGFGDVWQAVVADFVERRSPGGLRLSVNDGGARPDMVSLRLAQAVRAIEANA
FT                   R"
FT   gene            complement(635088..636728)
FT                   /locus_tag="BMA10229_A0614"
FT   CDS_pept        complement(635088..636728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0614"
FT                   /product="putative malonate decarboxylase, alpha subunit"
FT                   /note="identified by match to protein family HMM TIGR01110"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03594"
FT                   /db_xref="GOA:A2S3U0"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3U0"
FT                   /protein_id="ABN03594.1"
FT                   /translation="MTGWNEARAARAARLAAAAPLARGKRVAARDATALLEAVLRPGER
FT                   VCIEGDNQKQADLLAAALAAVDSAKVHGLHMVQSGVVLPEHLDVFERGIAKRLDYAYSG
FT                   PQSQRIAKLLFGGGIELGAVHTYLELFARYFIDLTPHVALIAAVSADGNLYTGPNTEDT
FT                   PTVVEATAFKDGIVIAQVEKIVERVPRVDIPGDRVHFVVEAGRPFYVEPLFTRDPAGIT
FT                   ETQILTAMLAIKGIYARYGVKRLNHGIGFNTAAIELLLPTYGERLGLKGQVCTHWALNP
FT                   HPTLIPAIESGWVEQIHCFGSEVGMDDYIRARSDIFFTGADGSLRSNRAFCQTAGLYAC
FT                   DLFIGSTLQIDLAGHSSTVTAERIAGFGGAPNMGSDARGRRHPSEPWLKAGEEADARTP
FT                   AALRRGRKLVVQIGETFGEKNAPMFVEQLDALRLADKLALDLAPVMVYGDDVTHVVTEE
FT                   GIANLLMCRDADEREHAIRGVAGYTEIGRGRDRRLVERLRERGVIRRPEDLGIDALDAD
FT                   RRLLAARSIKDLVHWSEGLYAPPARFRNW"
FT   gene            complement(636725..637024)
FT                   /locus_tag="BMA10229_A0615"
FT   CDS_pept        complement(636725..637024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0615"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01375"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3U1"
FT                   /protein_id="ABN01375.1"
FT                   /translation="MALFRESARDIACGNEAARAARGGTRGFDPERGANDTNDANDAND
FT                   ANDANDAKAACAAFAPRSIARATESYRATSSIAPAVRLTMPQNQPGRISQETIL"
FT   gene            complement(637045..637812)
FT                   /gene="madM"
FT                   /locus_tag="BMA10229_A0616"
FT   CDS_pept        complement(637045..637812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="madM"
FT                   /locus_tag="BMA10229_A0616"
FT                   /product="malonate transporter, MadM subunit"
FT                   /note="identified by match to protein family HMM PF03818;
FT                   match to protein family HMM TIGR00808"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02152"
FT                   /db_xref="GOA:A2S3U2"
FT                   /db_xref="InterPro:IPR004691"
FT                   /db_xref="InterPro:IPR018402"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3U2"
FT                   /protein_id="ABN02152.1"
FT                   /translation="MIDMLGKVVAHNGLVASFALVGCVMFASAALSRKLTLGRVHGSAI
FT                   AIVIGLALAYAGGAYTGGEKGIADVPLFAGVGLMGGAMLRDFAIVATAFEVQPAQARKA
FT                   GLVGAVSLLLGTVLPFIVGASVARAFGYSDAVSMTTIGAGAVTYIVGPVTGAAIGASSD
FT                   VIALSIATGLVKAVIVMVGTPFAAGFMGLRTPRAAMIFGGLAGTVSGVSAGLAATDRRL
FT                   VPYGALIATFHTGVGCLLGPSLLFFATKAAMGG"
FT   gene            complement(637826..638221)
FT                   /gene="madL"
FT                   /locus_tag="BMA10229_A0617"
FT   CDS_pept        complement(637826..638221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="madL"
FT                   /locus_tag="BMA10229_A0617"
FT                   /product="malonate transporter, MadL subunit"
FT                   /note="identified by match to protein family HMM PF03817;
FT                   match to protein family HMM TIGR00807"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02375"
FT                   /db_xref="GOA:A2S3U3"
FT                   /db_xref="InterPro:IPR004690"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3U3"
FT                   /protein_id="ABN02375.1"
FT                   /translation="MIIYGTALLAFCHLAGLFIGDLLGAAIGAKTNVGGVGIAMLLLIG
FT                   LRLALHRRGWLPEETEAGIAFWGAMYIPVVVAMAANQNVVAALKGGPVALLSAVGAVAV
FT                   CVLSIAALARVGHDATSLAALPRPEQN"
FT   gene            638480..639340
FT                   /locus_tag="BMA10229_A0618"
FT   CDS_pept        638480..639340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0618"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03829"
FT                   /db_xref="GOA:A2S3U4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3U4"
FT                   /protein_id="ABN03829.1"
FT                   /translation="MGLAMRPLPPELLRSFVAVAQTGSFTAASERVSLSQSTVSQHIRR
FT                   LEELLDRPLFERDTRNVRLAPSGEALFRYAVRILALMDEAVASVCGPPLSGKVRLGLSE
FT                   DFALTHLTAALASFVQRNPEVELEIATGLSGDLFDALDAGRHDLVFAKRIAGSRRGRVI
FT                   RTEPLYWCAGPASPLTGREPVLPLALHPQPSVSRQRVLETLDAIGRPYRIAVASTSIAV
FT                   LRAAASAGLGISAFAGYVIPHGLAKLEAGLPPLGELEYVIDRPANASRPALALEATLVA
FT                   AAHEF"
FT   gene            complement(639911..640828)
FT                   /locus_tag="BMA10229_A0619"
FT   CDS_pept        complement(639911..640828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0619"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00725;
FT                   match to protein family HMM PF02737"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00975"
FT                   /db_xref="GOA:A2S3U5"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3U5"
FT                   /protein_id="ABN00975.1"
FT                   /translation="MKIQRIAVVGAGVIGASWTAFYLSKGFDVAVTDPAPGARERLDAA
FT                   LANFLGERAGTLASRVAFEPTLDAALEGADFVQENGPERLDFKRELYRRIDARLPAHVL
FT                   VASSSSGLKMSDIQTACDAHPQRCLVAHPFNPPHLIPLVELVGGAATSADAIARAKRFY
FT                   DSLGKVTIVLNKERAGHVANRLAAALFREVYYLVGEGVVSVEDADKAVSWGPGLRWGLM
FT                   GQSLVYHLGGGEGGIAHFLEHLSGPMASWWNDLGAPSFSPDVDRQLIDALREIQGAHSM
FT                   RELGAERDRLLVELIDARRNSFLP"
FT   gene            complement(641123..642988)
FT                   /gene="pckG"
FT                   /locus_tag="BMA10229_A0620"
FT   CDS_pept        complement(641123..642988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckG"
FT                   /locus_tag="BMA10229_A0620"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="identified by match to protein family HMM PF00821"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01568"
FT                   /db_xref="GOA:A2S3U6"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3U6"
FT                   /protein_id="ABN01568.1"
FT                   /translation="MTRSNVVAATRTVPIDVPEYVKHRGLIDWVARIAELTEPDRVVWC
FT                   DGSQQEYDRLCDAMVEQRTMVRLNPAKRPNSFLALSDPSDVARVEDRTFICSEHRDDAG
FT                   PTNHWVAPAEMRATLNGLFRGAMRGRTLYVVPFSMGPLGSPIAHIGVELSDSPYVVVNM
FT                   RIMTRMGRAVLDALGERGEYVPCVHSVGRPLAAGEQDVPWPCNPTKYIVHFPESREIWS
FT                   FGSGYGGNALLGKKCFALRIASTMGRDEGWLAEHMLILGVTSPEGRKYHIAAAFPSACG
FT                   KTNFAMLIPPKGFEGWRVTTIGDDIAWLKPGRDGRLYAINPEAGYFGVAPGTGEKTNPN
FT                   ALATLRENVIFTNVALTEDGDVWWEGLTDTPPARLTDWQGNAWTPEIGRETGRKAAHPN
FT                   SRFTAPASQCPSIDDDWENPGGVPIDAFIFGGRRSTTVPLVTEARDWIEGVYMAATMGS
FT                   ETTAAAAGQQGIVRRDPFAMLPFCGYNMSDYFSHWLALGEKLAAAGATLPKIYCVNWFR
FT                   KDADGRFAWPGFGENMRVLKWMLDRIDGRGEGVEHAFGVTPRYEDLHWAGLAFSPAQYA
FT                   QVTSMNPDEWRAELALHAELFDKLSARLPDALAETKARIEKRLGG"
FT   gene            643026..643163
FT                   /locus_tag="BMA10229_A0621"
FT   CDS_pept        643026..643163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0621"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01003"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3U7"
FT                   /protein_id="ABN01003.1"
FT                   /translation="MRRAMTRAAGVAALRDGWGRRPRAPRIGAVAFHVPTPKMAERSFF
FT                   "
FT   gene            643356..643556
FT                   /locus_tag="BMA10229_A0622"
FT   CDS_pept        643356..643556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0622"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01590"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3U8"
FT                   /protein_id="ABN01590.1"
FT                   /translation="MRAMRAGAGFHRGARAFGRAPGASVASVASVASGASAASGASGAA
FT                   GAAGAAGEPRPPRMLRARHRY"
FT   gene            643787..644443
FT                   /locus_tag="BMA10229_A0623"
FT   CDS_pept        643787..644443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0623"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03629"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3U9"
FT                   /protein_id="ABN03629.1"
FT                   /translation="MRPGSNVSRRRCPASALAAPRHCDAAQQRRPIALSRQVISTHALA
FT                   HARHACAHSRQCACACLSHSRAQASQMSAHSLQTSPARALRLAIAPDANRHINAQSTSS
FT                   RTQAARPDASGSRRHATAHWSHARAHASHARMHASYRSFIVRSLLSDIGTDARNPRARR
FT                   HASAIRLRRYGSDTVSTPFQHGPDTEGASRPEPFPPARGPHATRVAHARDAPPEK"
FT   gene            644607..645044
FT                   /locus_tag="BMA10229_A0624"
FT   CDS_pept        644607..645044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0624"
FT                   /product="heat shock protein, Hsp20 family"
FT                   /note="identified by match to protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01392"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3V0"
FT                   /protein_id="ABN01392.1"
FT                   /translation="MSDLYFGADLFSEFDRLHRQMANLFGGFPSSIRASRLGGFPALNV
FT                   GTTEDSIEIVVFAPGMRAADFDVSIDKGLLAISGERKAAQRAEGEVRAYAQERFSGAFR
FT                   RVVELPQNADPDKIRARYENGCLLISVGKREASKPRAITVQ"
FT   gene            645076..645477
FT                   /locus_tag="BMA10229_A0625"
FT   CDS_pept        645076..645477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0625"
FT                   /product="heat shock protein, Hsp20 family"
FT                   /note="identified by match to protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00948"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3V1"
FT                   /protein_id="ABN00948.1"
FT                   /translation="MNTRNPAAERPSAVPARRDAGDAPRALTVTPAVDVYEDKHGVTLW
FT                   ADLPGVSKERLEVKIQDGHLSIDAHAALPMPASLRAQHVEVREPHFARTFQLSPDFDTT
FT                   KIEANLQDGVLKLTIPRRDEARPRRIDVQ"
FT   gene            646176..647657
FT                   /locus_tag="BMA10229_A0626"
FT   CDS_pept        646176..647657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0626"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02010"
FT                   /db_xref="GOA:A2S3V2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3V2"
FT                   /protein_id="ABN02010.1"
FT                   /translation="MSMKRYETLARAMADDIRSGNITTGTRMPSLRQMIAQHRVSQSTV
FT                   FRAYYLLEQWGLIRARERSGYYVAHGAQASVRANGMNGMNGAHATQDGRLTRDAAPAES
FT                   RKVDISDLVFSVLEAATHPRIVPLGSAFASPHLFPLPRLAKSLAQAARLVSPWSAVVDL
FT                   PPGSEQLRRQIALRYLGIGVSQPIDEIVVTNGALEALNLCLTAVTRPGDVVAVEAPGFY
FT                   AALQAIERLDLRAVEIPVDPRTGLDLDALAAALERHDVRACWFMTNFQNPTGVTLSADK
FT                   KKALVDMLAAREVPLIEDDVYGELHHGPDYPLPARAFDKHGLVMHCSSFSKTLAPGYRI
FT                   GWAAAGRFAEKVQRLKLMTTLSASIPAQVGIADYLEHGGYDRHLRKLRGALRGQMERMN
FT                   DALMRHLPPDVHWTLPDGGYFVWLEFPDAIDAMGLHREAIRRGVSVAPGPLFSAAHAFE
FT                   RCVRINFGHPWSAAVDDAIRTVGELVAQPSVRKRR"
FT   gene            complement(647734..647922)
FT                   /locus_tag="BMA10229_A0627"
FT   CDS_pept        complement(647734..647922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0627"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02384"
FT                   /db_xref="GOA:A2S3V3"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3V3"
FT                   /protein_id="ABN02384.1"
FT                   /translation="MSLARMMRMVLWSFFGVRKGAGHQADLASVKLPWVPVMAILLAAC
FT                   FGGLLFGLAKVAITVIH"
FT   gene            648356..650257
FT                   /locus_tag="BMA10229_A0628"
FT   CDS_pept        648356..650257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0628"
FT                   /product="nitrite/sulfite reductase family protein"
FT                   /note="identified by match to protein family HMM PF01077;
FT                   match to protein family HMM PF03460"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03336"
FT                   /db_xref="GOA:A2S3V4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3V4"
FT                   /protein_id="ABN03336.1"
FT                   /translation="MVILAPPMRRLATDTRDRARAAPPHCPAMYRYTEFDKAFVRNRAA
FT                   QFRDQLERWRQGALSEDAFRPLRLQNGWYVQRHAPMLRVAVPYGELSSAQIRMLARIAR
FT                   DYDVPEPARYRAACDAQARLGTVRLPTRNAHFTTRTNVQFNWIPLEKAADVMDLLATVD
FT                   MHGIQTSGNCIRNISCDERASVAPDEIADPRPFAEVMRQWTTLHPEFAFLPRKFKIAIT
FT                   GAADDRAATDWHDVGLRLVRDAAGELGFRVSVGGGMGRTPMTATLVRAFVPWRHVMNYI
FT                   EAIVRVYNRYGRRDNRYKARIKILVKAEGQRYIDDVDEEFRQIVEHDGGPHTIEQAEFD
FT                   RVCASFVPPVPPPCAAGRHAKTDIDADMDAALARMRTLAGAQPAFARWLERNVAPHRDP
FT                   ARRIVTLSFKRRHQAPGDASPEQLDALAHLAERFSAGEARVTHAQNVVLPWVRAIDLHA
FT                   LWEAARDAGLASANVRLLTDMIACPGGDFCALANARSIPIADAIAERFDDLDELHDIGD
FT                   VDLHVSGCINSCGHHHSGHIGILGVDKDGDEWYQVTLGGSDGTAANGPAQPGKVIGPSF
FT                   SADEIVDVVDALVATYLRVRRTEAGRVERFIDAYRRVGPEPFKAAANAARHPETSVA"
FT   gene            650254..650661
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0629"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF06073"
FT   gene            650714..652477
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0630"
FT                   /note="putative lipoprotein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(652695..653468)
FT                   /locus_tag="BMA10229_A0631"
FT   CDS_pept        complement(652695..653468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0631"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01094"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3V7"
FT                   /protein_id="ABN01094.1"
FT                   /translation="MADHSIKGKTVIIAGGAKNLGGLIARDLAAQGAQAVAIHYNSAAS
FT                   KGAAAETVAAIEAAGARAVALQADLTAAGAVEKLFVDTVAAIGRPDIAINTVGKVLKKP
FT                   FVEITEAEYDEMAAVNSKTAFFFLKEAGRHVNDNGKIVTLVTSLLGAFTPFYAAYAGMK
FT                   APVEHFTRAAAKEFGARGISVTAVGPGPMDTPFFYPAEGADAVAYHKTAAALSPFSKTG
FT                   LTDIGDVVPFIRHLVSDGWWITGQTILINGGYTTK"
FT   gene            653719..654618
FT                   /locus_tag="BMA10229_A0632"
FT   CDS_pept        653719..654618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0632"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00641"
FT                   /db_xref="GOA:A2S3V8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3V8"
FT                   /protein_id="ABN00641.1"
FT                   /translation="MDRIDLFRVFARVVECANFTRAADTLGMPRSSVSAAIQELEGRVG
FT                   ARLLHRTTRKVTPTQDGAALYERCLRLIADVEEAENLFRHSIVGPSGTLRVDMPGRIGR
FT                   LIVAPALPEFLERYPQISVELGVTDRAVNLIEERVDCVLRVGTLSDSGLVARAIGDLPL
FT                   INVASPAYLARHGVPRTPADLERHRPVNYASPSNGRVAPWEWVEGDEVKRVALRARVTV
FT                   NSAEAYIACCLAGLGLIQIPAYDVNAHLRAGELVEVLPDHRAAPMPMTLLYPHRQHLSR
FT                   RFQVFAEWLEALLRAKVL"
FT   gene            654782..655486
FT                   /locus_tag="BMA10229_A0633"
FT   CDS_pept        654782..655486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0633"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03041"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3V9"
FT                   /protein_id="ABN03041.1"
FT                   /translation="MMTSFALPSHIAFDGYRRLAAGPLPTVALAVKRAIANDAIGGALL
FT                   IFDNATGRSIDIDTRGSDDEVAARYAPAASADIAPGAAAGAHRERAADLADAAGTSNAA
FT                   DADPLAPEPPRGRGRPKLGVVAREVTLLPRHWAWLATQPGGASVALRRLVDEARRAHAH
FT                   KDRSRRAQERAYHFMSAIAGDMPGFEEASRALFANDAARLRAQIAGWPADVRDHALALA
FT                   SPDDGAPLPEVR"
FT   gene            655508..656839
FT                   /locus_tag="BMA10229_A0635"
FT   CDS_pept        655508..656839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0635"
FT                   /product="putative carotenoid 9,10-9',10' cleavage
FT                   dioxygenase"
FT                   /note="identified by match to protein family HMM PF03055"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01201"
FT                   /db_xref="GOA:A2S3W0"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3W0"
FT                   /protein_id="ABN01201.1"
FT                   /translation="MTTIDLNAGALAPVADEIDAVDLRVTGALARELNGVLVRNGPNPL
FT                   RGRFDGGDVLSWWPQDAMLHAISFDDGRATRYRNRWARTRRWARVHDPAREPSLVDTNP
FT                   NVNVLAHAGEILALAEGGAPLAITAGLDSIGAARRHPGLAHGMAAHPKVDPHTGELIAF
FT                   RADWNRPWLRYLVADAAGAQTVDTEIALPAPSMMHDIAITATHSIVFDLNVAYDFSMLS
FT                   RGHRMPLRWHDARGARIGVVPRRGGDARWFDIAPCFIQHVVNAYDLDRPAIVLDVVRYP
FT                   WFLRVARDGRGFDDNPPGVLWRYVIDLVTGTVAEQPLDDAGIELPRIDARRTGRRHRFL
FT                   YAAEQPTPVELRGIVRYDLDGGSTQRYRVPPGDQNSEPVFVPRPGAAGEDDGWLLVCVY
FT                   RHATDTSDVVILDGRSIGDGPIATVHLPRRVPAGFHGAWLPAGA"
FT   gene            complement(656809..656973)
FT                   /locus_tag="BMA10229_A0634"
FT   CDS_pept        complement(656809..656973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0634"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03808"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3W1"
FT                   /protein_id="ABN03808.1"
FT                   /translation="MGRCAERAPQAARDSRGRRRFRFRFCVVSCRVVSARLGSPRGVFA
FT                   HAPAGSHAP"
FT   gene            complement(657058..658974)
FT                   /gene="glmS-1"
FT                   /locus_tag="BMA10229_A0636"
FT   CDS_pept        complement(657058..658974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS-1"
FT                   /locus_tag="BMA10229_A0636"
FT                   /product="glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00938"
FT                   /db_xref="GOA:A2S3W2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3W2"
FT                   /protein_id="ABN00938.1"
FT                   /translation="MCGIVGAVARRDVVPNLVDGLKRLEYRGYDSCGVVVYQDRRLVRA
FT                   RSVDRVAALQREISARALSGYTGIAHTRWATHGAPVTANAHPHFSSGVATPGVATSGAP
FT                   AASAAASGGTAQADASPEARARIALSHNGIIENYEALRADLERHGYAFASQTDSEAIAH
FT                   LVDHLYDGDLFDAVRRALARLRGSYAIAVMCRDEPHRIVGARDGMPLVVGIGDGEHFLA
FT                   SDAIALSNLTDRIAYLENGDVVDIQLHRHWIVDASGRRVERTVHTIAAHVAAADLGGYR
FT                   YYMQKEIFEQPRAVADTLLDVTSIMPELFGDRAWRALSAADSVLLLACGGSYHAALTAK
FT                   YWIESIAGLPANVEIASEFRYRDGVPNPKALVVAVSQSGETADVLGAVHAAKRLGMPNT
FT                   LAICNVPTSALVRECASSFITRAGIEVGVASTKAFTTQLVALFLLTLALAQVRARLSDE
FT                   DEKRHLHALRHLPEAMSKVLALEPRIIAWSERLARRENMLFLGRGMHYPIALEGALKMK
FT                   EISYIHAEAYAAGELKHGPLALVSDEMPVIAVAPNDRLLEKLRSNMHEVSARNGRLFVF
FT                   ADVDCAIASAPGLDVIRLTEYYGPLSPILHAVPMQLLAFHAALARGTDIDKPRNLAKSV
FT                   TVE"
FT   gene            659133..659627
FT                   /locus_tag="BMA10229_A0637"
FT   CDS_pept        659133..659627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0637"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00732"
FT                   /db_xref="GOA:A2S3W3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3W3"
FT                   /protein_id="ABN00732.1"
FT                   /translation="MAYSLDELNLRILAALQADASLSNLALAEHALSSPPTCMRRVRKL
FT                   TEAGIIERRIAVLDRGRIGTSVTAIIEIGLDRQTAEDYDAFEAYACAQPEVTQCYRVSP
FT                   GPDFVIVADLADMAAYDEFARRLFTHASNVRNVRTFFSTHRAKFEANAPVRATPGKRAG
FT                   G"
FT   gene            complement(659836..661377)
FT                   /locus_tag="BMA10229_A0638"
FT   CDS_pept        complement(659836..661377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0638"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01491"
FT                   /db_xref="GOA:A2S3W4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3W4"
FT                   /protein_id="ABN01491.1"
FT                   /translation="MARRARIIEIPSLGMLERTAGNLSRQLAQALRDAVRRGEVMPGDA
FT                   LPSTRLLAASLRIARGTVIDAYEQLIAEGFLESRGGVGTRVAPALAEPRGARRRAAAAA
FT                   RSALPPPAAEYARVAREFAPLPPAPFAISVPAGATAPDDVWRRLGNRLRARGPAAPAGY
FT                   SDPLGVRALREAIAGYVRKSRSVHCAPDQIIVTSGAQQGLYLACQVLLGAHDRAWVENP
FT                   AYRGLTAILECTGRRDAMVRVPVDAEGIDVDAGVRLARDARAAFVTPSHQYPLGMPMSM
FT                   ARRAALLAWARASGAWVVEDDYDSELRYEGYPFPSLQGLDPARVVYLGTFSKILFPSLR
FT                   LGYLIVPDELVDALRGARVLMDRHAPTADQHVLAAFIAGGHFDRHIRRVRGVYAEQRAQ
FT                   LIDTVGRLLSGDLAWLQPGDQGMHAVLWLAAGVDDLRVAAMAAQAGVAVRPVSPMFAPG
FT                   TARPGLVLGFGGFGREQMDAAARRLAEVIAAASGSAVPRAGAGRRRRDGAGGTDA"
FT   gene            661499..662137
FT                   /locus_tag="BMA10229_A0639"
FT   CDS_pept        661499..662137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0639"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF04299"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03073"
FT                   /db_xref="GOA:A2S3W5"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3W5"
FT                   /protein_id="ABN03073.1"
FT                   /translation="MYVPAHFEENRTDALHALIAQHPFGILVTHGDGGLDANHIPFELA
FT                   PGEGPLGVLRAHVARANPVWQQVSDGDEVLAVFRAGDAYISPNWYPSKHELHRQVPTWN
FT                   YVVVHAHGRIAVRDEASFVRGVVARLTRTHEAAQPVPWKIGDAPRDYIDTMLQAIVGLQ
FT                   IDITRLVGKCKLGQNKDARDIRGAGQALKARGDDAIGNRMLAKAAEKPE"
FT   gene            662171..662296
FT                   /locus_tag="BMA10229_A0640"
FT   CDS_pept        662171..662296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0640"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03807"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3W6"
FT                   /protein_id="ABN03807.1"
FT                   /translation="MRFIPRSGPSALHATPDSPPALGEPRAGDPAVRRRPIVERP"
FT   gene            complement(662530..663327)
FT                   /locus_tag="BMA10229_A0641"
FT   CDS_pept        complement(662530..663327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0641"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02135"
FT                   /db_xref="GOA:A2S3W7"
FT                   /db_xref="InterPro:IPR018688"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3W7"
FT                   /protein_id="ABN02135.1"
FT                   /translation="MLNATSPRRVFVPLAIASIVAAWGALWTWDSSPYARFLHPVDWSA
FT                   TSLAGLCRLVPAGGAIVPAALHAAAWLLMIVAMMLPTVLPLLRTFERLTAARPERNRLM
FT                   LLVVLGYLAAWSAFGLLAQAGDAGLHALARRAPWLAWHGWLVGAAVLALAGAYQFSPLK
FT                   YRCVDKCRSPLMFVSEQWRGGHPRRDSFALGLRHGLFCVGCCWMLMCVMFALGAGSVGW
FT                   MLAIGAAMAAEKNLPHGRRLSAPLGVALLGWAASIAVAGMGAA"
FT   gene            complement(663380..663982)
FT                   /locus_tag="BMA10229_A0642"
FT   CDS_pept        complement(663380..663982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0642"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07040"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03528"
FT                   /db_xref="InterPro:IPR009758"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3W8"
FT                   /protein_id="ABN03528.1"
FT                   /translation="MSYSLEGRILEVCDCKVLCPCWIGEDPDNGTCRATVAYHYDKGMI
FT                   DDVDVAGLTVAFAAFVPGNILQGNWRVIIFIDERATDAQFDALASVYRGERGGPLADFS
FT                   KLFGDIVAIERAPIDFDVRDGRGTLKVGNTTYAELEPYLGPTGEPTKLVESIFSTIPGS
FT                   PAYVGKAGTFRMRERKLGIELDLSGQNAIQGFFTFRS"
FT   gene            664311..664424
FT                   /locus_tag="BMA10229_A0643"
FT   CDS_pept        664311..664424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0643"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02750"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3W9"
FT                   /protein_id="ABN02750.1"
FT                   /translation="MPSGPGAAIAPDRRTPFARGRANVSTPISRLAGAAQN"
FT   gene            complement(664510..664656)
FT                   /locus_tag="BMA10229_A0644"
FT   CDS_pept        complement(664510..664656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0644"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01829"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3X0"
FT                   /protein_id="ABN01829.1"
FT                   /translation="MGCEDGAHGGLRNAVPGSKWEIRAGRRAASGRRAGSRAASFRCAS
FT                   CVV"
FT   gene            664669..666033
FT                   /locus_tag="BMA10229_A0645"
FT   CDS_pept        664669..666033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0645"
FT                   /product="diguanylate cyclase (GGDEF) domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01809"
FT                   /db_xref="GOA:A2S3X1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3X1"
FT                   /protein_id="ABN01809.1"
FT                   /translation="MIGTIARLYTACLLIGFALVPAFLIAYVRFFIDPRLVFENHQFHE
FT                   LAIAAATLEGLFVTYVTWRCYLASGEPLLRWLTLGFLGFALIYSLHGAFTGMAHQNIWL
FT                   FLLYGPASRLVMSILLLVGQLSYFRDADPPERRTHLSMWLPWIAGYVVVCFAVAAIAYS
FT                   PIAGHLWTRASMEGGAMIVSLVNVALLLVRRIRTPLMLVYGISVTSFALSSIAFILGKP
FT                   WNHMWWLAHAVFAGGFFMLSFGVVQALMTTRSFATVYSQQDLMARLAESMARTEGVLQE
FT                   LKRTNQKLEHLATTDPLTGASNRRKFIEQMQSEIARAKRDGTAFSLLALDLDNFKTIND
FT                   NYGHQVGDVVLRNFVRQCLAAIRPYDHIARVGGEEFMVLLPRMLADTASGIAERVRTTI
FT                   ANASFGIDGKHTPVTVSIGVSQYGRDGDTVDEILSAADKLLYRAKNEGRNRVVAS"
FT   gene            666399..667553
FT                   /locus_tag="BMA10229_A0646"
FT   CDS_pept        666399..667553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0646"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00894"
FT                   /db_xref="GOA:A2S3X2"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3X2"
FT                   /protein_id="ABN00894.1"
FT                   /translation="MTSPAQPTWRDTLSAFAYRHLRLPPPKLETGRFGWATRWFLDWLV
FT                   PTGASAWAAYHLAAAFVAHYRSVLPANVGHDVPLGVMSELMSLANSKPFAYTGISLVAV
FT                   LVALMFHRYLTWPAPGRWLNRRKRPVIHALPFMLGFLAGKLLAFAVPALAVAVAAYASE
FT                   GAIGAIAPLAAPIALLSAAYYFLLYDEVRPPAIVSLSFHRSRQRSAGADATHQAREPDG
FT                   AAAVGIGAWRDAHDELRDDVLAIADAAGGMCGQNVFVSHDIDDIAIAIALSIDEAHRSD
FT                   RQKRSLDAQIDRVLRKWRDRGYASGSLDDAKATRASPGAPEARRPDVAFWLPESERIVR
FT                   HGSVLLKARDGRDVRIVEESIGSVQADASAVRPRPRRMRTFEFV"
FT   gene            667916..668107
FT                   /locus_tag="BMA10229_A0647"
FT   CDS_pept        667916..668107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0647"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03106"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3X3"
FT                   /protein_id="ABN03106.1"
FT                   /translation="MRRSIAPGRQCPTSTRARRAFNGRLRRRTPSRAARSPRHARHAVY
FT                   AIFSSNAALYTPNLRAAS"
FT   gene            668295..668564
FT                   /locus_tag="BMA10229_A0648"
FT   CDS_pept        668295..668564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0648"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02235"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3X4"
FT                   /protein_id="ABN02235.1"
FT                   /translation="MLMSIRVGAGNLPHVRRLLHQVLGAALDIYTAVIDNQTGQASLQL
FT                   ELASTSVSDAMTSIMRVLPEAEFGKIRLSPRAPSARAPRMPPRG"
FT   gene            668632..669258
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0649"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(669844..669957)
FT                   /locus_tag="BMA10229_A0650"
FT   CDS_pept        complement(669844..669957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0650"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01307"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3X6"
FT                   /protein_id="ABN01307.1"
FT                   /translation="MAIEKPASAATSLMVGVMKREAEACKRFRRRDYRRRR"
FT   gene            669905..670921
FT                   /locus_tag="BMA10229_A0651"
FT   CDS_pept        669905..670921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0651"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03306"
FT                   /db_xref="GOA:A2S3X7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3X7"
FT                   /protein_id="ABN03306.1"
FT                   /translation="MTPTIKDVAALAGFSIATVSRAINAPHTVHPATLEKIRAAIGALR
FT                   FRPNPLGRQLRSDRTQLIGVVLPTLANPVFAECLQGVDELATQAGFKLIVMSTEYDAAR
FT                   ERHAIETLRAQRVEGLMLTVADADAHPLLDELDRDGPLYVLMHNDTPHRPSVAVDNRRA
FT                   AYDGVRMLIERGHRRVLMLAGSLDASDRARLRVHGYAQALDERGLEPLPALELDFNAPA
FT                   LPHAMLAHLSARATRPTALFCSNDWLAMVVIRGLRDAHLAVPDDMSVLGFDGLAVGELL
FT                   APPLASVATPNREIGRAAWRRLAERIAGKRHAQPALTLPHAVRDGATVAPPRDARIA"
FT   gene            670978..672039
FT                   /locus_tag="BMA10229_A0652"
FT   CDS_pept        670978..672039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0652"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02868"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3X8"
FT                   /protein_id="ABN02868.1"
FT                   /translation="MTVRRSLLPRSPLAAVRRACAAMLIPVASLALSLGASAAHAQDTA
FT                   ICYNCPPEWADWAAQIAAIKQRTGIRVPFDNKNSGQAIAQLIAEQKSPVADVVYLGVSS
FT                   AFQAKDKGVVAPYKPAHWSDIPANLKDPQGYWFAIHSGTLGFFVNKDALDGKPVPRTWA
FT                   DLLKPEYKGMVGYLDPSSAFVGYAGAVAVNQALGGSFDDFRPALDWFRKLKANQPIVPK
FT                   QTAYARVLSGEIPILLDYDFDAYRAKYKDHANVEFVIPKEGTISVPYVMSLVKGAPHEA
FT                   NGRKVLDFVLSDEGQKLWANAYLRPVRAQALGADVAAQFLPASEYARAKSVDFGKLAAG
FT                   QQAFGKQYLQAMQ"
FT   gene            672127..672951
FT                   /locus_tag="BMA10229_A0653"
FT   CDS_pept        672127..672951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0653"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03068"
FT                   /db_xref="GOA:A2S3X9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3X9"
FT                   /protein_id="ABN03068.1"
FT                   /translation="MSDLTLPSRWRIALLAPALAVFVAFWLLPMVSLVRVSAGGGFVDA
FT                   YLALLSNARYMKSLASTVALSAAVTLATLALSTIAGLLLARRAFAGKRALIALLTFPLA
FT                   FPGVVVGFMVIMLAGRQGLIGMLSQKLAGDRWVFAYSVSGLFVGYLYFSIPRVIVTVIA
FT                   AASKLDPSLEEAARSLGASRWHVLRDIVLPALAPGLVAAGAICFATAMGAFGTAFTLAT
FT                   DLDVLPMTIYTEFTLNANIATAAGLSIVLGIVTWAVLALARNLTGQATAASA"
FT   gene            complement(673213..673416)
FT                   /locus_tag="BMA10229_A0654"
FT   CDS_pept        complement(673213..673416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0654"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03937"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Y0"
FT                   /protein_id="ABN03937.1"
FT                   /translation="MQTITMEQCKRIHGGDNLIDGTFNLLGGTFTINSSSLSTLLTNAN
FT                   TLVVNANNWLTNPKGTLSSTKK"
FT   gene            complement(673639..673899)
FT                   /locus_tag="BMA10229_A0655"
FT   CDS_pept        complement(673639..673899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0655"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01676"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Y1"
FT                   /protein_id="ABN01676.1"
FT                   /translation="MAAMRAVPRRRGCESRACNGGALARACAICAPRGETAANPAAGGD
FT                   PRPRPHARWRASTLVAPSASSTSSASSASSASSAAIAEQFV"
FT   gene            673983..675071
FT                   /locus_tag="BMA10229_A0656"
FT   CDS_pept        673983..675071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0656"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02385"
FT                   /db_xref="GOA:A2S3Y2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Y2"
FT                   /protein_id="ABN02385.1"
FT                   /translation="MHSTRRRTTDDRRARAAQAMSRRAAHLACALPVAARGAVISSSST
FT                   PPIILVDENVYIALRTPMTPPSKDAAALARPAAAAGPHAPPAVRRARRAPLDWLAAAQW
FT                   AVTLALCAFLIVPVAMSVLAGLTVNYFRGPSSGLTLRWLGEVWAQYHGSVFLSLEVALA
FT                   TLAVTLVAGVPAGYALARSRSRVSRLIEEALVLPVALPGLASALALLSVYGGFAAFRTS
FT                   LWFIVVGHVVFTLPFMVRAVAAVAARADLRTLEEGAASLGASFATRFATIVLPNLRPGI
FT                   VAGALAVLTLSIGEFNLTWMLHTPDTKTLPVGLADTYASLRLEIGSAYTILFLLMTLPL
FT                   LVAMQRLGVEPPGARDRTCKRR"
FT   gene            675225..676253
FT                   /locus_tag="BMA10229_A0657"
FT   CDS_pept        675225..676253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0657"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02698"
FT                   /db_xref="GOA:A2S3Y3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Y3"
FT                   /protein_id="ABN02698.1"
FT                   /translation="MKLDSVPITLTRCAKTFHGTRVLEPLDLAIGAGETLVLLGPSGCG
FT                   KTTTLRLIAGLDTPDAGGAIAFGADDVTALPIEKRGVGMVFQNYALFPNLSVRGNVGYG
FT                   LRIRRTEPRVLRERVDALLAMMRLTAHADKPIDALSGDQRQRVALARALAARPRVLLLD
FT                   EPLTALDAQLRDALRREMNALLRELGVTTVYVTHDQAEAMALGDRIVVMSAGAIEQIGT
FT                   PRDVYYRPASRAVARFIGTLNRLEGVWRDGALVTEGGALAVASPANELFFRPEDARLVD
FT                   PSDAPLRGAVAHCAFLGERTRVTIEHAAPDPLVIDVPGRVDLARGTAVGVAIAAEGLIA
FT                   LA"
FT   gene            676253..676486
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0658"
FT                   /note="Ser/Thr protein phosphatase family protein; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            676483..677310
FT                   /locus_tag="BMA10229_A0659"
FT   CDS_pept        676483..677310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0659"
FT                   /product="3',5'-cyclic-nucleotide phosphodiesterase"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01249"
FT                   /db_xref="GOA:A2S3Y5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR042281"
FT                   /db_xref="InterPro:IPR042283"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Y5"
FT                   /protein_id="ABN01249.1"
FT                   /translation="MMLLAHISDLHIKRPGALAYRRVDTAAHLARCVARLNALEPRPDA
FT                   VLVTGDLTDFGDDDEYAHLKALLAPLAMPYYLLVGNHDDRAALRRAFPARVELQSGEFV
FT                   QYALDLGPLRVIALDSQIPGASGGTLCDARLAWLADQLDAARDRPVIVALHHPPFACGI
FT                   GHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGGTIASAVPAPAHQVTF
FT                   DLRDGGPSSFSMEPPAFAVHRHAPGAGLASHHVYVDASDGPHPFFEPTGTLID"
FT   gene            complement(677666..678076)
FT                   /locus_tag="BMA10229_A0660"
FT   CDS_pept        complement(677666..678076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01909"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Y6"
FT                   /protein_id="ABN01909.1"
FT                   /translation="MIKRKLIAFAAAPALALAAFGIGTVSPAGVAPSMAEAATVSKLGD
FT                   LSPFRAIAVDVAQRVDKGDLAGAKARIKDLETSWDDAEPSLKPRAAADWHAVDHAIDRA
FT                   LTALRADRPQAGACRQALADLLAVIDRPGGAR"
FT   gene            complement(678214..679002)
FT                   /locus_tag="BMA10229_A0661"
FT   CDS_pept        complement(678214..679002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0661"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03988"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02107"
FT                   /db_xref="GOA:A2S3Y7"
FT                   /db_xref="InterPro:IPR007136"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Y7"
FT                   /protein_id="ABN02107.1"
FT                   /translation="MNQPARSPAVAGMLNKVPEVTLAFWIVKIMSTTVGETGADYLAVH
FT                   VGLGAAVTGALTACLLVGALALQWRARAYVPWIYWLNIVLVSVAGTQITDALTDGLGVS
FT                   LHVSTPLFAAALAATFALWYRSERTLSIHTIVTPRREGFYWAAILLTFALGTAAGDLAT
FT                   EALGLGFRLGIVAFGGAIALVAAAALGGMNRVLAFWLAYILTRPLGASLGDFLSQAQAY
FT                   GGLGLGTIRTSAVFLAVIVALVAGLSVAAARAGRLGARGR"
FT   gene            679281..680477
FT                   /locus_tag="BMA10229_A0662"
FT   CDS_pept        679281..680477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0662"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03785"
FT                   /db_xref="GOA:A2S3Y8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Y8"
FT                   /protein_id="ABN03785.1"
FT                   /translation="MSSQPRHSAGTPGHYSRSLLLLLATIAGVSVANIYYNQPLLDAFR
FT                   ASFPGSASWIGVVPTATQLGYATGMLVLAPLGDRFDRRTLILLQIAGLSAALVVAAAAP
FT                   TLGVLAAASLAIGILATIAQQAVPFAAEIAPPAARGQAVGTVMSGLLLGILLARTAAGF
FT                   VAEYFGWRAVFAASVAALAALAAVIVARLPRSSPTSTLPYGKLLASMWQLVRELRGLRE
FT                   ASMTGGAIFAAFSAFWPVLTLLLAGAPFHLGPQAAGLFGIVGAAGALAAPYAGRFADKR
FT                   GPRAIISLAIALIAASFAIFALSGASLIGLVIGVIVLDVGVQAAQISNQSRIYALKPDA
FT                   RSRVNTVFMVCYFIGGAIGSSAGVAAWRATGWLGMCAVGLLFSIVAAIVHFRGGAGAR"
FT   gene            complement(680832..681767)
FT                   /locus_tag="BMA10229_A0663"
FT   CDS_pept        complement(680832..681767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0663"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03030"
FT                   /db_xref="GOA:A2S3Y9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Y9"
FT                   /protein_id="ABN03030.1"
FT                   /translation="MTPFDRFLAFVARHPPRLPQSRSGRVALALVFIYFAWGSTYLALH
FT                   VALESFPPLLLSGLRNLLAGVGLFVFAMRRRPVRPTLVEIRNAALVGTMLVTMSSGLIA
FT                   LGMRTVSSGSAAVMVATVPLFATVIASVAGRRVTGGEWGAVALGMVGIVVLNSGGPSSP
FT                   GSTLGSITVLAGALFWAGGAHLAARLALPHDLFLSTALQIGLGGAASTCIAWVLGERIG
FT                   HVAWVPGAAFVYLMLAGTMAAYVAYGYLIRHTSPIIASSCMYVNPVVAVALGALLLGEP
FT                   VTAATVIATIAILGSVGLSFVFDPARRRAQ"
FT   gene            complement(681771..681905)
FT                   /locus_tag="BMA10229_A0664"
FT   CDS_pept        complement(681771..681905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0664"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01405"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Z0"
FT                   /protein_id="ABN01405.1"
FT                   /translation="MFAAARSDLSFRTPPSPVIPVFPAPLAGGRIARRSTARRFTRAG"
FT   gene            complement(681990..682190)
FT                   /locus_tag="BMA10229_A0665"
FT   CDS_pept        complement(681990..682190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0665"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00712"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Z1"
FT                   /protein_id="ABN00712.1"
FT                   /translation="MAPSRVRATRAARRAGFAARRCASRFLAASARRSKKRKPRLAECR
FT                   MSRRNVTARAIDSNRHSFSIP"
FT   gene            complement(682221..683012)
FT                   /locus_tag="BMA10229_A0666"
FT   CDS_pept        complement(682221..683012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0666"
FT                   /product="oxidoreductase, molybdopterin-binding protein"
FT                   /note="identified by match to protein family HMM PF00174"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03327"
FT                   /db_xref="GOA:A2S3Z2"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Z2"
FT                   /protein_id="ABN03327.1"
FT                   /translation="MSENDRKKRENDIARIDRASLLIDVRKSLALPSRRLFGKRMLTLG
FT                   GLAMLTGCTLRDDASVDDFLEKVSRANDRVQAWLFGPTRLAPTYAEADITRPFPFNAFY
FT                   GIDDVPRVDADGFRLAVSGLVTGQRSWSLPALYALPHAEQITRHICVEGWSAIGRWGGT
FT                   PFREFLRRVGADTSAKYVGFKCADDYYESIDMATALHPQTLLAFEYDGKRLPPEYGFPM
FT                   KLRMPTKLGYKNPKHIVEIFVTNAYPGGYWVDQGYNWFGGS"
FT   gene            complement(683028..684128)
FT                   /locus_tag="BMA10229_A0667"
FT   CDS_pept        complement(683028..684128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0667"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02586"
FT                   /db_xref="GOA:A2S3Z3"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Z3"
FT                   /protein_id="ABN02586.1"
FT                   /translation="MRLNDARAIDQRTRVSPMSATPTTSASTTAMAGARASGAADAPAR
FT                   APTGADIDAGATAWAEANANATADATTDAMANVTTDAATRVTANPPIHETANVPASTAA
FT                   AATTEAVAGARAGAALDAAHPGATQTMSQTMAQTMAQTMTQAGTEAASPAGTDAAASGA
FT                   CITRATRARRPIHPLWVRASHWLNALAAVTMALSGWRIYNASPIYAGFVFPRGATLGGW
FT                   LGGALQWHFAAMWLLFFNGVFYLTMGVATGRFTRKLLPLSASGVARDLRDALRGRLSHD
FT                   DLSVYNALQRAAYVAAIADLALLVLSGLVIWKSVQFPLLREWLGGYDRARVVHFWAMAF
FT                   LVAFFVVHVAMAALVPRSLLAMLRGH"
FT   gene            complement(684119..684943)
FT                   /locus_tag="BMA10229_A0668"
FT   CDS_pept        complement(684119..684943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0668"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06764"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02455"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Z4"
FT                   /protein_id="ABN02455.1"
FT                   /translation="MSTDMSISFSVSLRAVAAALSLAAAGAAQAAADGACMARSPDGRQ
FT                   ALVELYTSEGCSSCPPADDWLARLAARRAALRVVPLALHVDYWDGLGWADRFAQHRFTE
FT                   RQHALAARGGGRFVYTPEVAVDGRELRDWRDADAFGRRVVATAAEPARVGIALAAKRRA
FT                   GALDVALSVTPRVGAPRALDAYLALYENGVESQVRAGENRGATLRHERVVRQWIGPLAA
FT                   TADAHASLDVRRALPLPANLRAADAARYGVAAFVEDPATGDVLQALDLPLCG"
FT   gene            complement(685104..685409)
FT                   /locus_tag="BMA10229_A0669"
FT   CDS_pept        complement(685104..685409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0669"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02953"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01510"
FT                   /db_xref="InterPro:IPR014299"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Z5"
FT                   /protein_id="ABN01510.1"
FT                   /translation="MKRNLIAFACVAGFALAAPFAHAQNDAMSKDGMGMSKDAMSKGAM
FT                   SGDAMSKDAMSKDAMSKDRMGKRHDHMAKGGMKAGPMSKDAMKEPMSSDKMSPMSN"
FT   gene            686059..687990
FT                   /gene="thiC"
FT                   /locus_tag="BMA10229_A0670"
FT   CDS_pept        686059..687990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="BMA10229_A0670"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01047"
FT                   /db_xref="GOA:A2S3Z6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2S3Z6"
FT                   /protein_id="ABN01047.1"
FT                   /translation="MNANPKFLSADARVDAAAVAPLPNSRKVYVTGSQPDIRVPMREIT
FT                   QADTPTSFGGEKNPPIYVYDTSGPYTDPDAKIDIRAGLPALRQRWIDARGDTETLSGLT
FT                   SDYGRERAADPATAELRFPGLHRHPRRAKAGKNVTQMHYARQGIITPEMEYIAIRENQR
FT                   RAEYLESLKASGPNGAKLAAMMGRQHAGQAFGAAAFGANAPAEITPEFVRDEVARGRAI
FT                   IPANINHPETEPMIIGRNFLVKINANIGNSAVTSSIGEEVDKMTWAIRWGGDTVMDLST
FT                   GKHIHETREWIIRNSPVPIGTVPIYQALEKVNGKAEDLTWEIFRDTLIEQAEQGVDYFT
FT                   IHAGVRLQYVPLTANRMTGIVSRGGSIMAKWCLAHHKESFLYEHFEEICEIMKAYDVSF
FT                   SLGDGLRPGSIYDANDEAQLGELKTLGELTQIAWKHDVQVMIEGPGHVPMQLIKENMDL
FT                   QLDWCKEAPFYTLGPLTTDIAPGYDHITSGIGAAMIGWFGTAMLCYVTPKEHLGLPNKD
FT                   DVKEGIITYKLAAHAADLAKGHPGAQVRDNALSKARFEFRWQDQFNLGLDPDKAREFHD
FT                   ETLPKDSAKVAHFCSMCGPHFCSMKITQDVREFAAQQGVSENDALKKGMEVKAVEFVKS
FT                   GSEIYHRQ"
FT   gene            complement(688129..688962)
FT                   /locus_tag="BMA10229_A0671"
FT   CDS_pept        complement(688129..688962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0671"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03430"
FT                   /db_xref="GOA:A2RVW6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVW6"
FT                   /protein_id="ABN03430.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(688986..689249)
FT                   /locus_tag="BMA10229_A0672"
FT   CDS_pept        complement(688986..689249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0672"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03153"
FT                   /db_xref="GOA:A2RW24"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RW24"
FT                   /protein_id="ABN03153.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            689454..689666
FT                   /locus_tag="BMA10229_A0673"
FT   CDS_pept        689454..689666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0673"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02055"
FT                   /db_xref="GOA:A2S3Z9"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:A2S3Z9"
FT                   /protein_id="ABN02055.1"
FT                   /translation="MKSIRRIGVCAMLIATMASLSACDTMTTRQRNAAIGAGIGGVAGA
FT                   AIGGNALSTIGGAAAGGLVGSQVGK"
FT   gene            689918..690142
FT                   /locus_tag="BMA10229_A0674"
FT   CDS_pept        689918..690142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0674"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02064"
FT                   /db_xref="UniProtKB/TrEMBL:A2S400"
FT                   /protein_id="ABN02064.1"
FT                   /translation="MNKTLVAAALASVALAGCYYPYGYYPASGYYAAPVQTAPVYVAPA
FT                   YPAYYYPAPSLSLNFGYWSGGGRGYWRHH"
FT   gene            690413..691345
FT                   /locus_tag="BMA10229_A0675"
FT   CDS_pept        690413..691345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0675"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01556"
FT                   /db_xref="GOA:A2S401"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A2S401"
FT                   /protein_id="ABN01556.1"
FT                   /translation="MNLKNALLLIVLAALWGASFLFIRVGVAAFGVAPLMALRVDIGAL
FT                   FLVALMLTRYAPRELIALLRQHAWPLFVVGLLNSAAPFCLFAFAELTLSAGVTSVINAT
FT                   TPLWGALVAYLWLKDSLSLPRALGLVIGFAGVLTLVWDQVFSPHGANPASPATAALAAA
FT                   AALGATLLYGIAANFTKRKLTGVDPLVSATGSMVGATILLLPFALATWPAAPVSAHAWG
FT                   SVLALGIACTGVAYFIFFHLIAHIGPARAITVTFVIPVFGILWGALFLGERVSFAMLEG
FT                   CVIVLLGTALATGAIRRIPGVRPQRNETA"
FT   gene            691453..692208
FT                   /locus_tag="BMA10229_A0676"
FT   CDS_pept        691453..692208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0676"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03574"
FT                   /db_xref="UniProtKB/TrEMBL:A2S402"
FT                   /protein_id="ABN03574.1"
FT                   /translation="MRRIGEWSAPGGPQRRAADAIGRCRSCASRCELANGIRPPALQRL
FT                   SRRRSPHTRQTPFQREPLRTCERHSAASAATFVAPAFAAYARRRAAGHVTEHETARGRR
FT                   RRRQARRGRSPFSCRRPLDRATSRRERRSTPTTTTKSAANAPRRFTRSEPTGESASRRS
FT                   MQPAPHRKKREASLVSVCAAGPPGHDAARPAPWTHTARRAGRRPRGAPHPHRPRRDSAT
FT                   LRTEFKRIPDAHDASTFVTLDSIPHRTQK"
FT   gene            692380..693828
FT                   /pseudo
FT                   /locus_tag="BMA10229_A0677"
FT                   /note="cyclic diguanylate phosphodiesterase (EAL) domain
FT                   protein; this gene contains a frame shift which may be the
FT                   result of a sequencing error; identified by match to
FT                   protein family HMM PF00563"
FT   gene            complement(694064..694468)
FT                   /locus_tag="BMA10229_A0678"
FT   CDS_pept        complement(694064..694468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0678"
FT                   /product="peptidyl-tRNA hydrolase domain protein"
FT                   /note="identified by match to protein family HMM PF00472"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00893"
FT                   /db_xref="GOA:A2S404"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A2S404"
FT                   /protein_id="ABN00893.1"
FT                   /translation="MTLRYAFSPDEVELTAVRAQGAGGQNVNKVSSAIHLRFDIRASSL
FT                   PDDVKARLFARADQRITREGVIVIKAQEYRTQEKNRAAALARLDTLIRSAGVTPRKRVA
FT                   TRPTRASKERRLAEKGRRSEVKSGRGRVVE"
FT   gene            complement(694465..697161)
FT                   /gene="recD"
FT                   /locus_tag="BMA10229_A0679"
FT   CDS_pept        complement(694465..697161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="BMA10229_A0679"
FT                   /product="exodeoxyribonuclease V, alpha subunit"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01818"
FT                   /db_xref="GOA:A2S405"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:A2S405"
FT                   /protein_id="ABN01818.1"
FT                   /translation="MSVVDERFAWTGGLADRLPEPADFGLALAEGFARRIGMLSRRVGA
FT                   SAAAARWAARAAFAASRATAAGHVCVALRALAQRDDEPYDDVRAALAASGVTAFDGIVR
FT                   GGECPLVVDRDGRLYLARYFEYETRLANALVERSRCGGAPAGGADALSPDALGERLVRY
FT                   FGPQKERGVDWQRVAALIALTGRVTIVSGGPGTGKTTTVVGVIACLLDAHPDLRIALAA
FT                   PTGKAAQRMQEALHARAGSLPAELAARLPRTSCTLHRLLGGGPGGRFAHHRDNPLPYDL
FT                   VVVDEASMIDVALAAHLLDALAPNARLVLLGDKDQLAAVEAGAVFAELSARPAFSPATC
FT                   ATIARTLGVGEAEFVAALPDGFVVQAGGAERVADARAAAADMDAAARGTAGAAAAAART
FT                   TAAAAARMTTAAAAATGAAPESAAQRAPAPHAGRRGGGRASNRTVDDAQGSLFAFDDDA
FT                   FGGGTSGGEPGAGAQGAGRRDGGAPSLDGPHAGHRDGGASPGVAHSRRDAFDARARSGS
FT                   ADVSDLENAARAYAPAGAAGPADSPADASFVEPAAWIEADELAWLDNAVFSFSEGASAN
FT                   AEADGRRSAAATATDAGARTAPPVAREATAPTPRETARSDGSAVAPLTDCVVWLERNYR
FT                   FGLDSPIGRLSLAIRRGAVQDALDALSTQDDAAARFSDDGGATLSAATVEQLARGFAGY
FT                   AAALRDALATPEPDALPLFDVLNRFRVLCATRTGARGAEEVNARMAAEVRRAVRVPLAL
FT                   GAHWFAGRPVMVTRNDYALGLFNGDIGIALPGARGALRVWFRGADGRARAVSPAALPPH
FT                   DTAFALTVHKSQGSEFDDAALILPASFNRVLSRELVYTAITRARARVQVIGSRAVLALA
FT                   IATRTARDSGLAARIADALRARQEGAR"
FT   gene            complement(697158..700970)
FT                   /gene="recB"
FT                   /locus_tag="BMA10229_A0680"
FT   CDS_pept        complement(697158..700970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /locus_tag="BMA10229_A0680"
FT                   /product="exodeoxyribonuclease V, beta subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="identified by match to protein family HMM PF00580;
FT                   match to protein family HMM TIGR00609"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02680"
FT                   /db_xref="GOA:A2S406"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A2S406"
FT                   /protein_id="ABN02680.1"
FT                   /translation="MSHVAPSGPSASELDVFACPLDGVNQIEASAGTGKTWNICALYVR
FT                   LLLEKDLGADEILVVTFTKAATAELHERIRARLAQLAHALDTGDDGGDPFIARLFETTL
FT                   APERGLDPQTAAKRVRRALRAFDQAAIHTIHAFCQRALQEAPFAAAMPFAFEMEADDGA
FT                   LRFELAADFWRTRVEPVAAAYPAFAEWLVEYGAGPAALDAQLARRLKKPLARLRWDGLH
FT                   AADDGAESAARAHFDTAAAIWRDERGVLGTLLADAQPSLNQRSHKPEAVSEALDAWARY
FT                   FEQASAVAALPRAALKLTQSALEKATKKGGATPRHAFFDVAQALEAAVAALEAAQRARW
FT                   LSLVEQWLDAAPAELAQRKRTRRVVSFDDLLANLYRALDAHPWLRETLRARYPAALIDE
FT                   FQDTDPLQFAIFDTIFAPAGPLFLVGDPKQAIYSFRAADLHTYLAARARASARYTLAVN
FT                   QRSTPAIVDACNRVFGANPRAFVLDGLDYEPVRAGSRVRAPLVDATDPLAGAGDFRIWT
FT                   LPAGDDVLTKRDAQRHAAHACAAEIARLMRGARERAVTLGGEPLAASGIAVLVQTHRQG
FT                   SLVKRVLAAWGIGSVELAQASVFATIDAEQLERVLAAIDAPGDLRRLRSALASDWFGLD
FT                   AAALWRLEQGDAEQDGIDAAARGASGNGGGARAASAGAPAPSPADADAMGWVERFSRYR
FT                   LLWRERGFAVMWRTLAGELRIAERLMAGADGERRVTDVNHLAELTQARASAQPGIAPTL
FT                   RWLAAQRLEGGGDDAQLRLESDRNLVQIVTVHKSKGLEYAIVFCPFLNDGGLREPAGSG
FT                   LPDAREYHDESGCAVLHYGCDDEAAERASREAVREQAAERARLVYVALTRAVYRCYLVA
FT                   GTYQSSRSTKEARRSVLNWLVAGAGRDFDAWLKEPPEDAELAERWQALAGGPVTLGALP
FT                   VPAHREPLAAGHDAQATRAARRATRGLRDAWRIASFSSLASAIARDESGIARAADDEMR
FT                   PDHDALAAALGADALEPPDAAAAIAPAPAAAPRELAEDDILAFPRGAAAGECLHRLLEL
FT                   SNFADASTWPPAALRALHERPVEAELALAERLPAMMTRLVADLAATELVPGMRLAALDP
FT                   ARRLTEMEFLFPAPALDFNALRRLLAAHGYPDVALEAGTLAGFVKGFIDMIVEHDGRFW
FT                   IVDWKSNHLGTTPEAYGERALDAAMAHHAYHLQALLYMVALHRYLRVRMRGYDYDAHIA
FT                   GYLYVFVRGVRPDWRNGGASAGVHARRPARALIEALDALMREGDA"
FT   gene            complement(700967..704311)
FT                   /gene="recC"
FT                   /locus_tag="BMA10229_A0681"
FT   CDS_pept        complement(700967..704311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recC"
FT                   /locus_tag="BMA10229_A0681"
FT                   /product="exodeoxyribonuclease V, gamma subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="identified by match to protein family HMM PF04257;
FT                   match to protein family HMM TIGR01450"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03657"
FT                   /db_xref="GOA:A2S407"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:A2S407"
FT                   /protein_id="ABN03657.1"
FT                   /translation="MLHLFYSNRHETLADALLDDLAFASDGAGPWAAQQVIVPSAALRR
FT                   RLELDLAKRHGVCANVRFSYLAQWLWAQIGEVLTVPAHSPFAPDRLVWRCYRLLSDHGA
FT                   APWRASPRLAAYLAAADAPMRHELAHRIATVFDHYLTYRPEWLAQWQDGESIFALEGAP
FT                   RHGGEAARDDEAWQAALWRALLAELSDSGMPPAHRFLREARAFDPDVIARARAKWPDAV
FT                   SVFALPTMPPLHIALLRELSRWIDVRIYALNPCREFWFDIVTAARAESLDAADRLDYQE
FT                   VGHPLLAEWGRQTQAQLHMLHELTESAAASDASRYADNPAPTWLARVQNAILDLQPEAA
FT                   LGEPPAERGVEVHVCHSLARQLEVLHDRLLAWFDADPSLAPSDVLVAMPDLATAGPLID
FT                   AVFGTPAGADAARIPYRITGLPPSQANPVARVLLDWLALPERDVGAPELVEWLRADAVA
FT                   ARYGIDATALETVQAWLAASGARRGLAPDAAEPPNPAVPAPRHTFADALTRLFLGYAMP
FT                   DGAAPVSTWLPIAGAEGGEAELLGRLARFTDDLDGFARRIARDLTPQGWGDVFADALAR
FT                   FFDSGPAFADALSGVRDALDAMLAAMAEGAAGAALPAAVVRAGLAAALDDPARGGVPWG
FT                   GVTFSSLTSLRGLPYRIVCLIGMDDGVLPSLARADEFDLMAVFAKLGDRQRRDDERNLF
FT                   LDLLLAARERLLIAYTGRSIRDNAPLPPAALVDELLDHLAAASAGPDAPPDAVDAARRA
FT                   FVIEHPLQPFSAEYFAPGGALFTYDASRATLARLLAEGARAQARPFFAAPLPAEPEQPV
FT                   AFADFERFWRHPARSLLRARLGIVLLDAQAELVDTEPFELDYAGSDALAERVLPLLIET
FT                   ADAAAFEHALRVADASPEVPGGATGAVRRDHALDALAQLAGNVRRALADGATRVPFAFD
FT                   VAPAWPAASDARWFGEHDAALAAAATREPLRLHGALARLTAAGQVIYRYARPGARDYLA
FT                   AWLAHLVYCAIDPGGPRRTLWFGSGDTFEFAPVAAPLEQLAPLAALFRAGRRMPLAFFP
FT                   RSAWALVSESESKAAGVWINDRVAGEADDASLALAWRGANPSLDEPFGALAHLVFDPLV
FT                   EHLRRAS"
FT   gene            704372..704614
FT                   /locus_tag="BMA10229_A0682"
FT   CDS_pept        704372..704614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0682"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01594"
FT                   /db_xref="UniProtKB/TrEMBL:A2S408"
FT                   /protein_id="ABN01594.1"
FT                   /translation="MTGARTWLIGRALARRDLAATVATRGSLRRPGRVRRAARGDGNAR
FT                   PGRLRAWPRRTAASHHSAACENGTMRRNREARSPR"
FT   gene            705020..707296
FT                   /locus_tag="BMA10229_A0683"
FT   CDS_pept        705020..707296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0683"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF05976"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABN00675"
FT                   /db_xref="GOA:A2S409"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:A2S409"
FT                   /protein_id="ABN00675.1"
FT                   /translation="MRYSVEIRKFFYSQYFFGGLRIALGVSLPAVLSLAVLHDRELGFT
FT                   IATGALGACVVDMPGPLKYKHNEMLACSVIGFFSALATGLATPNIFALWLTIVPLTFVL
FT                   SLIVVYGNRWPQISFATLFMMVMTLEEKFTPLQALVNASWILAGGLWYTYWATIVSRWQ
FT                   ARRIEQQALAESLFACASYLLARADFYDLDADLDECYRNLVARQITAVETQETARDIVL
FT                   RNLPKLRRGKLDPGRTMMFNLFINSVDLHEMFVGAHTDYPLVRSTFGGSDLMIFYRDLI
FT                   RKASADLEEIGFAVLENRLPHSRISVKAELRAIEYEIELMRKKQFAATHPEAYAAVLAT
FT                   FRRIWSATRLIDKMRRNLSGSADAQRTELKIDKALTRFLQKRRMSPLLIFSNLNMGSPS
FT                   LRHALRVTIAVAVGFWLGRLLPLTNAYWIVMTSIIILKPGYSLTKQRNAQRIVGTLIGC
FT                   AASLALIYTVHEPHVLIAIMFGSMVISYSLLLFNYAASVVFTSSYVLLLFHLLAPGNMR
FT                   IIGERAIDTVVGCMIAIAASRLFPYWEYRAIGKLVADALATTRKYFEATWRAGRGKAAP
FT                   AVPAADGAAAVPAVAAVVDAVAPGLDGDYQYRLARKNVHIAFANLGQAFQRMMLEPKAH
FT                   QKFVPELNDLLVQTHVLGAQITAAAPLLRHACEQGNPPALERGMAAVREHLEQAEAGVP
FT                   PPANQAETSKQLTRELDSMVVDAERSDAGADLAHDLKVLAHQCKQMLASSLLIRKDASV
FT                   IRLPE"
FT   gene            707293..707484
FT                   /locus_tag="BMA10229_A0684"
FT   CDS_pept        707293..707484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0684"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01366"
FT                   /db_xref="UniProtKB/TrEMBL:A2S410"
FT                   /protein_id="ABN01366.1"
FT                   /translation="MSRPPPPFLSTVSRRARTQGFPDYCPRASIGMIYPAPSCLYNFSS
FT                   ASAGPHRPADDTNHSETR"
FT   gene            707481..708845
FT                   /locus_tag="BMA10229_A0685"
FT   CDS_pept        707481..708845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0685"
FT                   /product="amino acid transporter, AAT family"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03782"
FT                   /db_xref="GOA:A2S411"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A2S411"
FT                   /protein_id="ABN03782.1"
FT                   /translation="MKNLQRHLSARHIRFLALGSAIGTGLFYGSASAIRLAGPAVILAY
FT                   IVGGAAVYMVMRALGEMAVREPVPGSFGHYATENLGPFAGFVTGWTYTLEMVIVAIADI
FT                   TAFGIYMGFWFPHVPQWIWVLAIVAIICGLNLCHVKVFGELEFWLSIVKVGAIVAMIGG
FT                   GAAILFTGMRLGSGGAPSLANLWSHGGFLPNGVGGLVASLSVVIFAYGGIEVIGMSAGE
FT                   AKEPERVIPRAINAVPMRILLFYVLTMIVLMSIFPWTGVGANGSPFVQIFSALGVRSAA
FT                   EILNLVVISAAISAINSDIFGAGRMMYAMALQGQAPRALAAMSARGVPWVTVLVMAGAL
FT                   LVGVVLNYLMPKDVFLMVAASATFATVWVWLMILLSQVAMRRRLGAAEVAALKFKVPFW
FT                   PVGPALTIAFMAFVIAMLGYFDDTRVALFVGAAWLAILALVFYTRIRPRLAAVAR"
FT   gene            complement(708987..709166)
FT                   /locus_tag="BMA10229_A0686"
FT   CDS_pept        complement(708987..709166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0686"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02428"
FT                   /db_xref="GOA:A2S412"
FT                   /db_xref="UniProtKB/TrEMBL:A2S412"
FT                   /protein_id="ABN02428.1"
FT                   /translation="MNDPRSKKNPVFGVAILIVVVIALVIGTILYNAISQKHEYDEAHP
FT                   HAASAASAASAQHG"
FT   gene            complement(709163..709282)
FT                   /locus_tag="BMA10229_A0687"
FT   CDS_pept        complement(709163..709282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0687"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABN02128"
FT                   /db_xref="UniProtKB/TrEMBL:A2S413"
FT                   /protein_id="ABN02128.1"
FT                   /translation="MRIARKKTDESRRAQRTAVRMRLRVECRLDEFLMERDRR"
FT   gene            709406..710461
FT                   /locus_tag="BMA10229_A0688"
FT   CDS_pept        709406..710461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0688"
FT                   /product="ferric iron uptake ABC transporter (FeT) family,
FT                   periplasmic iron-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABN03679"
FT                   /db_xref="GOA:A2S414"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A2S414"
FT                   /protein_id="ABN03679.1"
FT                   /translation="MFVKQARPLLRTLLRPLAFAFALAAVAPAAHAANEVNLYTTREPK
FT                   LIQPLVDAFTKQSGIAVNTVFVKDGLLERVKAEGARSPADVLMTVDIGNLLDLVDGGLT
FT                   QPVRSASLDGAIPANLRGAGGNWYALSLRDRVLYVDKNMQLDAITYESLADPKWKGKVC
FT                   VRSGQHPYNTALVAAMIAHDGEAAAEQWLRGVKANLARKATGGDRDVARDILGGICDIG
FT                   LANAYYAGHMKHAQPGTDARKWGDAIKVVRPTFANAKSGGTHVNVSGAAVAKHAPNRDN
FT                   AVKLLEYLASPPAQALYAQANYEYPVRAGVALDPVIAGFGPLKADPLPLVEIAKYRKRA
FT                   SQLVDKVGFDN"
FT   gene            710451..712163
FT                   /locus_tag="BMA10229_A0689"
FT   CDS_pept        710451..712163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10229_A0689"
FT                   /product="ferric iron uptake ABC transporter (FeT) family,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10229_A0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABN01674"
FT                   /db_xref="GOA:A2S415"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2S415"
FT                   /protein_id="ABN01674.1"
FT                   /translation="MTTEADARVARRAHAPVWARAGGRARLSRIAAHGWLAGAAAIAAV
FT                   VGTPLVALACAALGADLSHWRHLAEFVLPQAAANTLALLAGVGAIVTCVGTGAAWLVTA
FT                   YDFPGRRTLAWALLLPLAVPSYIVAFAYLDLLHPIGPVQSALRWALGFDSPREFRLPEL
FT                   RSLPGAIVVLGFVLYPYVYLCTRAMFVTQSASLVEAARTLGAGRIETFVRVVLPLARPA
FT                   IAVGASLALLETLNDVGASEFLGVQTLTVSVYTTWVTRSDLASAAQIALAMLAIVLGAL
FT                   ALERYGRRRERYAHGRRMRAIAPRRLRGAAAAGAAVLGWLPVAVGFGAPAAYLVHETAQ
FT                   RVHLVGGVSAQLLASLGNTLAVALTATVVTLGGGIVVAWATRRTRDSARFQPGRVCARL
FT                   ASVGYAVPGTVLAIGLLAPLALADRAIAAVLGRDALVLMGSAAALVIAYAIRFLAIPAG
FT                   GIEAGLARIPASLEQASRTLGESAGMTLRRVHLPLLRPALGASALLVFVDAMKELPATL
FT                   LLRPLNFDTLATWLYAEAARGTYEEGAVAALAIVAAGLAPVIVLARTQLKSGS"
FT   gene            712174..712944
FT                   /locus_tag="BMA10229_A0690"
FT   CDS_pept        712174..712944
FT                   /codon_start=1
FT                   /transl_table=1