(data stored in ACNUC1104 zone)

EMBL: CP000547

ID   CP000547; SV 1; circular; genomic DNA; STD; PRO; 2352693 BP.
XX
AC   CP000547; AAHP01000000-AAHP01000408;
XX
PR   Project:PRJNA13946;
XX
DT   28-FEB-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Burkholderia mallei NCTC 10247 chromosome II, complete sequence.
XX
KW   .
XX
OS   Burkholderia mallei NCTC 10247
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; pseudomallei group.
XX
RN   [1]
RP   1-2352693
RA   DeShazer D., Woods D.E., Nierman W.C.;
RT   ;
RL   Submitted (05-JAN-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [2]
RC   Protein update by submitter
RP   1-2352693
RA   Brinkac L.M., Harkins D.M., Shrivastava S., Durkin A.S., Sutton G.;
RT   ;
RL   Submitted (21-OCT-2009) to the INSDC.
RL   The J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850,
RL   USA
XX
DR   MD5; e4edded4217a4c71488f20a1b2fbdb5f.
DR   BioSample; SAMN02604033.
DR   EnsemblGenomes-Gn; BMA10247_A0374.
DR   EnsemblGenomes-Gn; BMA10247_A0903.
DR   EnsemblGenomes-Gn; BMA10247_A0904.
DR   EnsemblGenomes-Gn; BMA10247_A0905.
DR   EnsemblGenomes-Gn; BMA10247_A0906.
DR   EnsemblGenomes-Gn; BMA10247_A0907.
DR   EnsemblGenomes-Gn; BMA10247_A0924.
DR   EnsemblGenomes-Gn; BMA10247_A1123.
DR   EnsemblGenomes-Gn; BMA10247_A1805.
DR   EnsemblGenomes-Gn; BMA10247_A1894.
DR   EnsemblGenomes-Gn; BMA10247_A1895.
DR   EnsemblGenomes-Gn; BMA10247_A1896.
DR   EnsemblGenomes-Gn; BMA10247_A1897.
DR   EnsemblGenomes-Gn; BMA10247_A1898.
DR   EnsemblGenomes-Gn; BMA10247_A2051.
DR   EnsemblGenomes-Gn; BMA10247_A2413.
DR   EnsemblGenomes-Gn; EBG00001203431.
DR   EnsemblGenomes-Gn; EBG00001203432.
DR   EnsemblGenomes-Gn; EBG00001203433.
DR   EnsemblGenomes-Gn; EBG00001203434.
DR   EnsemblGenomes-Gn; EBG00001203435.
DR   EnsemblGenomes-Gn; EBG00001203436.
DR   EnsemblGenomes-Gn; EBG00001203437.
DR   EnsemblGenomes-Gn; EBG00001203438.
DR   EnsemblGenomes-Gn; EBG00001203439.
DR   EnsemblGenomes-Gn; EBG00001203440.
DR   EnsemblGenomes-Gn; EBG00001203441.
DR   EnsemblGenomes-Gn; EBG00001203442.
DR   EnsemblGenomes-Gn; EBG00001203443.
DR   EnsemblGenomes-Gn; EBG00001203444.
DR   EnsemblGenomes-Gn; EBG00001203445.
DR   EnsemblGenomes-Gn; EBG00001203446.
DR   EnsemblGenomes-Gn; EBG00001203447.
DR   EnsemblGenomes-Gn; EBG00001203448.
DR   EnsemblGenomes-Gn; EBG00001203449.
DR   EnsemblGenomes-Gn; EBG00001203450.
DR   EnsemblGenomes-Gn; EBG00001203451.
DR   EnsemblGenomes-Gn; EBG00001203452.
DR   EnsemblGenomes-Tr; BMA10247_A0374-1.
DR   EnsemblGenomes-Tr; BMA10247_A0903-1.
DR   EnsemblGenomes-Tr; BMA10247_A0904-1.
DR   EnsemblGenomes-Tr; BMA10247_A0905-1.
DR   EnsemblGenomes-Tr; BMA10247_A0906-1.
DR   EnsemblGenomes-Tr; BMA10247_A0907-1.
DR   EnsemblGenomes-Tr; BMA10247_A0924-1.
DR   EnsemblGenomes-Tr; BMA10247_A1123-1.
DR   EnsemblGenomes-Tr; BMA10247_A1805-1.
DR   EnsemblGenomes-Tr; BMA10247_A1894-1.
DR   EnsemblGenomes-Tr; BMA10247_A1895-1.
DR   EnsemblGenomes-Tr; BMA10247_A1896-1.
DR   EnsemblGenomes-Tr; BMA10247_A1897-1.
DR   EnsemblGenomes-Tr; BMA10247_A1898-1.
DR   EnsemblGenomes-Tr; BMA10247_A2051-1.
DR   EnsemblGenomes-Tr; BMA10247_A2413-1.
DR   EnsemblGenomes-Tr; EBT00001574249.
DR   EnsemblGenomes-Tr; EBT00001574250.
DR   EnsemblGenomes-Tr; EBT00001574251.
DR   EnsemblGenomes-Tr; EBT00001574252.
DR   EnsemblGenomes-Tr; EBT00001574253.
DR   EnsemblGenomes-Tr; EBT00001574254.
DR   EnsemblGenomes-Tr; EBT00001574255.
DR   EnsemblGenomes-Tr; EBT00001574256.
DR   EnsemblGenomes-Tr; EBT00001574257.
DR   EnsemblGenomes-Tr; EBT00001574258.
DR   EnsemblGenomes-Tr; EBT00001574259.
DR   EnsemblGenomes-Tr; EBT00001574260.
DR   EnsemblGenomes-Tr; EBT00001574261.
DR   EnsemblGenomes-Tr; EBT00001574262.
DR   EnsemblGenomes-Tr; EBT00001574263.
DR   EnsemblGenomes-Tr; EBT00001574264.
DR   EnsemblGenomes-Tr; EBT00001574265.
DR   EnsemblGenomes-Tr; EBT00001574266.
DR   EnsemblGenomes-Tr; EBT00001574267.
DR   EnsemblGenomes-Tr; EBT00001574268.
DR   EnsemblGenomes-Tr; EBT00001574269.
DR   EnsemblGenomes-Tr; EBT00001574270.
DR   EuropePMC; PMC2168593; 17933898.
DR   EuropePMC; PMC2612704; 19038032.
DR   EuropePMC; PMC2945939; 20831800.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP000547.
DR   SILVA-SSU; CP000547.
DR   StrainInfo; 341638; 0.
XX
CC   Source DNA and bacteria available from David DeShazer
CC   (david.deshazer@det.amedd.army.mil).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2352693
FT                   /organism="Burkholderia mallei NCTC 10247"
FT                   /chromosome="II"
FT                   /strain="NCTC 10247"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:320389"
FT   gene            complement(1042..1167)
FT                   /locus_tag="BMA10247_A0001"
FT   CDS_pept        complement(1042..1167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0001"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03623"
FT                   /protein_id="ABO03623.1"
FT                   /translation="MDCRISSRVMVVAQKQNVSIITKYVLFDTLLVYLLFFYYLR"
FT   gene            1139..2326
FT                   /locus_tag="BMA10247_A0002"
FT   CDS_pept        1139..2326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0002"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03230"
FT                   /protein_id="ABO03230.1"
FT                   /translation="MTLDEIRQSIREELDALRVSGARRQDLSLHACKRLFFDLGIRPST
FT                   ANVRELTQTGSASDIPKDIDHFWERIRSASKVRLEGAALPKPLEEKAGALLGALYEEAL
FT                   KQARESLDGERQQASSEVAAAEQKYRDALIRQEALEAAVARSDARAEQLQSRLTDVEVQ
FT                   LASASTQGLAHQDSLQGLIRRMENENALLNQRLEAEQSQNAALRERIDALHAELRENTE
FT                   HYAQQIKDAIAEAERRVKPMLVELDSLRSMASTYQQGLRDVNRKEFDFLQQLSAAKARA
FT                   DRLDAQLREQGDELTAALNEVQILRASQGMTPEIAALIRRLANAGNLDAAAFDTIGTSL
FT                   DQHVTLPARCPKCGDGEPELSHDAHGYELLCPECEHASGTQPSRFAAAACFTRTT"
FT   gene            complement(2420..3463)
FT                   /locus_tag="BMA10247_A0003"
FT   CDS_pept        complement(2420..3463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0003"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02216"
FT                   /protein_id="ABO02216.1"
FT                   /translation="MSLPILTSPPSPPDIPSDLFDRDTSDWLNHPDTAFDAWLAAQEFR
FT                   RSSADVYRAQWGAFLGWLAKRQKNLATVDTETIALFVGELPIKKTQRVRYLRLIERVLD
FT                   HVRKNEFGSTNPARFIAQDGEATWRTARDNEPTSFLAPAERAALLAYLFSPLPAAGAAL
FT                   WKKRRDRALIAAFLGGGLKTGEARALTISCVKLGSTMLTIPAAQPEFTRETHLASFAIA
FT                   LFDAWLAERQRCGIPGELVFPASQSGRPMHKATMLRAVDAIVDAADIAQSRTARASPQT
FT                   LRNTFAAELFENGVEPEKVGQWLGFAQPISSNRLHRAWKNWRESLASALPNAESLTDEI
FT                   STEPSRA"
FT   gene            complement(3626..4006)
FT                   /locus_tag="BMA10247_A0004"
FT   CDS_pept        complement(3626..4006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0004"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01855"
FT                   /protein_id="ABO01855.1"
FT                   /translation="MTEQDLAALSFKAAAHDMETIVCHIAERYIRQGVPLTWRLLHAVE
FT                   AEALADLGFASRHDPMVRCLFDRPAELRFPETDDLVDFGQSNALPAVFSFAVAAYERAA
FT                   DARADTAAVPARSARASRAWGD"
FT   gene            complement(4086..4694)
FT                   /locus_tag="BMA10247_A0005"
FT   CDS_pept        complement(4086..4694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0005"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03871"
FT                   /protein_id="ABO03871.1"
FT                   /translation="MASSSGARRTTAPASPATGATPPRVGEQIQRLRNERKLTLDDLSR
FT                   AAGVSKSMLSEIERDKANPTIAVAWRLTNALGISLDELFAQPKAPETIRVDGPHDIPTL
FT                   AGHDAQYQLRVWGPIELAGKFEWYELTLPAHGALVSNPHEPGTREHLTVLNGAVEIEAA
FT                   GTARRLKAGDTARYAADGPHAIRNAGKSEAKALLIVIHR"
FT   gene            4862..6061
FT                   /gene="kbl"
FT                   /locus_tag="BMA10247_A0006"
FT   CDS_pept        4862..6061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="BMA10247_A0006"
FT                   /product="glycine C-acetyltransferase"
FT                   /EC_number="2.3.1.29"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00464; match to protein
FT                   family HMM TIGR01822"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03635"
FT                   /protein_id="ABO03635.1"
FT                   /translation="MRDAYLAHLRGTLEQIRADGFYKTEREIASPQAADIRLAGGTHVL
FT                   NFCANNYLGLADDSRLIAAAQAALEQDGFGMASVRFICGTQTVHKQLEAALSAFLKTDD
FT                   CILYSSCFDANGGLFETLLDENDAIISDELNHASIIDGIRLSKARRFRYKNNDLADLEA
FT                   KLREADAAGARFKLIATDGVFSMDGIIANLKGVCDLADRYGALVMVDDSHAVGFIGEHG
FT                   RGTPEYCGVEGRVDIVTGTLGKALGGASGGYVAARREIVELLRQRSRPYLFSNTLTPSI
FT                   AAASLKVLELLASDEGACLRERVRANGAHFREKMSAAGFALVPGEHPIIPVMLGDAQVA
FT                   SKMADALLAEGVYVIGFSFPVVPRGRARIRTQMSAAHTREQIDRAVDAFVRVGKTLGVI
FT                   "
FT   gene            6074..7105
FT                   /gene="tdh"
FT                   /locus_tag="BMA10247_A0007"
FT   CDS_pept        6074..7105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="BMA10247_A0007"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240; match to protein
FT                   family HMM TIGR00692"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01910"
FT                   /db_xref="GOA:A3MAC8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MAC8"
FT                   /protein_id="ABO01910.1"
FT                   /translation="MKALAKLERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIW
FT                   KWDDWAQKTIPVPMHVGHEYVGEIVEMGQEVRGFSIGDRVSGEGHITCGFCRNCRAGRR
FT                   HLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNLV
FT                   GEDVLITGAGPIGVMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVSRESLRD
FT                   VMADLHMTEGFDVGLEMSGVPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFKGL
FT                   EIKGIYGREMFETWYKMVAMLQSGLDLSPIITHRFAVDDYEKGFAAMLSGESGKVILDW
FT                   ADA"
FT   gene            7114..7395
FT                   /locus_tag="BMA10247_A0008"
FT   CDS_pept        7114..7395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03516"
FT                   /protein_id="ABO03516.1"
FT                   /translation="MRSGAMPGCTSHVAIRTANVQPPSASHTAQPLARRPMRRACEVHR
FT                   AFGLRSLLRLDASQTSMVARSVGSRARLSRKNALKNIDAARKRRCVKP"
FT   gene            complement(7440..8039)
FT                   /locus_tag="BMA10247_A0009"
FT   CDS_pept        complement(7440..8039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0009"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF04264"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02080"
FT                   /protein_id="ABO02080.1"
FT                   /translation="MAASCTPLRVVTHSVSTAEAAVPAGRYTLDPHHWSIVFDVDHFKY
FT                   SRFTMRFDRANAQLDWRPSGGLADSGVSASIDAASVDTRVPLLDKLVAGADALDAARNP
FT                   QIRFDSTRFARTSATQGTLTGNLTIRGATHPVTLAVTFNGYGRNPLTKQDTLGFSASGT
FT                   FSRAQFGVTSWYPAVGDDVRVRIEAEFVKEGEAPAQ"
FT   gene            8023..8151
FT                   /locus_tag="BMA10247_A0010"
FT   CDS_pept        8023..8151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02606"
FT                   /protein_id="ABO02606.1"
FT                   /translation="MQLAATPASAIAHAKRPAHLTGFIRPPLLPNVRENDIASIRG"
FT   gene            8183..8800
FT                   /locus_tag="BMA10247_A0011"
FT   CDS_pept        8183..8800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0011"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03167"
FT                   /protein_id="ABO03167.1"
FT                   /translation="MDTKPDLAPAAGARERLLDAAETLIYAGGIHATGVDAIVKRSGAA
FT                   RKSFYAHFESKEALVAAALERRDARWMAWFVEATKKRGKTPRARLVGMFDVLREWFEQA
FT                   DFHGCAFLNAAGEIERADDPIRVVVREHKARLLAFVREQLDAHAAQAGADRRFVARLAR
FT                   QWLVLIDGAIGVALVSGDASAARDARAAAELLLDATLPNRSS"
FT   gene            8772..9380
FT                   /locus_tag="BMA10247_A0012"
FT   CDS_pept        8772..9380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07080"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03171"
FT                   /protein_id="ABO03171.1"
FT                   /translation="MRRCRTGPAKAPPFHSTEPQYPDLPAALGEPGRPFHVLNLENTMS
FT                   DSTEIRPPVPPFTRETAIQKVRAAEDGWNTRDPERVSLAYTPQSKWRNRAEFATGRAEI
FT                   VALLRRKWTREIDYRLIKELWAFTGNRIAVRFAYEWRDDAGNWFRSYGNENWEFDENGL
FT                   MAHRHACINDMPIREADRLFHWPLGRRPDDHPGLSDLGL"
FT   gene            complement(9602..10618)
FT                   /locus_tag="BMA10247_A0013"
FT   CDS_pept        complement(9602..10618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0013"
FT                   /product="succinylglutamate desuccinylase/aspartoacylase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF04952"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03671"
FT                   /protein_id="ABO03671.1"
FT                   /translation="MTESAPVFPHYSIEVDFPDLEAHRTGNAGVDYVHRFDSGVPGPRV
FT                   MINALTHGNEVCGAIVVDALLKRGLRPRRGVLTVSFANVTAYERFDPARPDAARFVDQD
FT                   FNRVWAPAVLDDLSQHSVELDRARAIRPFVDEADWLLDLHSMHERSAPLIVAGPLAKGT
FT                   ALALRIGAPATVIRDEGHPEGKRMRDYGGFGNPASAKNALLVECGQHWEARAVAVARDS
FT                   TARFLMASGIVDERDLPADWFLPLATTMRIVQVTQPVVATSSDFRFADAYTGLEHFAEA
FT                   GAVIGWSDGKPVTTPYPDCVLVMPSLRQLHPGVTVVRLGRVEREVAQRAARGTRDEC"
FT   gene            complement(10921..12111)
FT                   /gene="ttuC"
FT                   /locus_tag="BMA10247_A0014"
FT   CDS_pept        complement(10921..12111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttuC"
FT                   /locus_tag="BMA10247_A0014"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /note="identified by match to protein family HMM PF00180;
FT                   match to protein family HMM TIGR02089"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02435"
FT                   /protein_id="ABO02435.1"
FT                   /translation="MNRRSRKLRAIAFPTPPAPGATTRARQDTKDEDLSMSEKVYRIAV
FT                   IPGDGIGVEVMPEGLRALDAVSRRFGLRFAYEPIEWASCDYYAKHGQMMPDDWKTQLSG
FT                   MDALLFGAVGWPETVPDHISLWGSLIKFRREFDQYVNLRPARLFDGVPCPLAGRKAGDI
FT                   DFMIVRENTEGEYSAVGGTMFEGTEREFVVQQAVFTRHGTERVLKFAFELAQRRAKRLT
FT                   VATKSNGIAISMPWWDARAAEMAARYPDVTWDKQHIDILCARFVMQPDRFDVVVASNLF
FT                   GDILSDLGPACTGTIGIAPSANLNPERNFPSLFEPVHGSAPDIAGKHIANPIAMIWSAA
FT                   MMVDFLGAGTGRAREAHDAIVAAIEHVLKHGPRTRDMGGRASTREVGDAIVAHLLG"
FT   gene            12175..13092
FT                   /locus_tag="BMA10247_A0015"
FT   CDS_pept        12175..13092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0015"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02852"
FT                   /protein_id="ABO02852.1"
FT                   /translation="MNNSPNLDDLRVFSVVVRLASFSAAAEQLAVSPAYVSKRVALLEK
FT                   QLGTRLLHRSTRRVAVTEAGERVYAWTEKILDDVDHLVEDVSTTRSVPRGTLRISSSFG
FT                   FGRHVLAPALLGFNERYPQLNVRLDLFDRLVDVAGEGFDLDIRIGDEIADHLIAKRLAT
FT                   NYRVLCASPGYLARYGTPRQLADLGAHQCLAIKERDHPFGVWRLTVRGETSTVKVGGAL
FT                   STNHGEVAVQWALAGRGIVLRSIWEAGPLLASGELRRVLPEASQPANVWAVYPARLAAS
FT                   AKVRVCVDFLVDAFAHLNERANGG"
FT   gene            13166..13279
FT                   /locus_tag="BMA10247_A0016"
FT   CDS_pept        13166..13279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0016"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02093"
FT                   /protein_id="ABO02093.1"
FT                   /translation="MMTDRWLILDLYRQPHPQLTAYPVRVGTVSDGGRVKR"
FT   gene            13599..14276
FT                   /locus_tag="BMA10247_A0017"
FT   CDS_pept        13599..14276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0017"
FT                   /product="isoprenylcysteine carboxyl methyltransferase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF04140"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03844"
FT                   /protein_id="ABO03844.1"
FT                   /translation="MNSLTKRALGAQVRFVAMLAVLIFASAGSLRYWQGWIYWFVFSGA
FT                   TTWLARHFLKHDPALVERRMRVGVRAERELSQKIILGVVSVASAGLIVAMGAEWRVLRM
FT                   PFDWRPVALGNALVIAGFAICFAALRANRFASSIVEVKRDQPVISSGPYRFVRHPMYSG
FT                   AMVIFFGSPIAAQSTWAWPFAAVLAVGVVARLVDEERYLSAHLDGYRAYCERVRWRLVP
FT                   HVW"
FT   gene            14471..15094
FT                   /locus_tag="BMA10247_A0018"
FT   CDS_pept        14471..15094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0018"
FT                   /product="glutathione S-transferase"
FT                   /note="identified by match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01908"
FT                   /protein_id="ABO01908.1"
FT                   /translation="MLKLLGKAPSINVRKVLWTCAELKLAYEREDWGAGFRSTQTPEFL
FT                   ALNPNGLVPVLVDGDFVLWESNAIIRYLANRYGGAHLYPVEPHARARVDQWLDWQTTAL
FT                   NRAWSYAFLALVRDAPDHGDTARIRASCESWARHMAILDAQLGTTGAFVTGADYTLADV
FT                   ALGLSINRWLRTPFDKPDFPAVSAYFDRLAARPGFAEHVDNGLP"
FT   gene            complement(15529..16062)
FT                   /locus_tag="BMA10247_A0019"
FT   CDS_pept        complement(15529..16062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0019"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02585"
FT                   /protein_id="ABO02585.1"
FT                   /translation="MRPARAGRAFRFAVSRFAVSRFAMPIFVVLFALAALIWGAIHMFE
FT                   AIAARFGDAVAIGAATVAAVAIAAAIARSVRRRRDIAPNAREDGWTHVLQRAWGDLRIS
FT                   ATKGLLWLSQDGADGRYTLTDLSGCRAETLDGRWYLVVAVRDDRRAEWKLPMDDKRDAL
FT                   RWARVLTLAKRQRL"
FT   gene            complement(16073..17311)
FT                   /locus_tag="BMA10247_A0020"
FT   CDS_pept        complement(16073..17311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0020"
FT                   /product="phospholipase, patatin family"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02583"
FT                   /protein_id="ABO02583.1"
FT                   /translation="MKPRARTEKQAVDPADLHNEAGVPHALEHARTPFHDLPYETIALV
FT                   LQGGGALGAYQAGVFEGLHEAGIPLNWIAGISIGALNTALIAGNPPERRVERLREFWNT
FT                   ICQPAFFPALPAMFEAALFNSHEYVRTFFTASQAASAVMQGQRGFFVPRFPPPLPGSTH
FT                   PPEKVSYYDTSALRATLVKLCDFDRINSGETRVSVGAVNVGTGNFIYFDNTKTTLRPEH
FT                   FMASGALPPAFPPVEIDGEFYWDGGIVSNTPLMEVLHASPRRDTLAFQVDLWSARGPLP
FT                   ESMNEVTERTKDVQYSSRTRFVTDTLQREQRFRNVLRRVLDQVPESIRESDPWCQQAET
FT                   LSCSKRYNVQHLIYQQKAYEQHYKDYQFGASTMRDHWSAGLADIRKTLAVKNGLALPDN
FT                   DAGFVTHDIHRMR"
FT   gene            complement(17308..18093)
FT                   /gene="bdhA-1"
FT                   /locus_tag="BMA10247_A0021"
FT   CDS_pept        complement(17308..18093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdhA-1"
FT                   /locus_tag="BMA10247_A0021"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.30"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659; match to protein
FT                   family HMM TIGR01963"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03561"
FT                   /protein_id="ABO03561.1"
FT                   /translation="MSNLNGKTAIVTGAASGIGKEIALELARAGAAVAIADLNQDGANA
FT                   VAELIEQAGGRAIGVAMDVTNEDAVNAGIDKVAQTFGSVDILVSNAGIQIVNPIENYAF
FT                   ADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGL
FT                   LGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQTV
FT                   DGVFTTVEDVAKTVLFLSAFPSAALTGQSFVVSHGWFMQ"
FT   gene            complement(18140..18880)
FT                   /gene="adc"
FT                   /locus_tag="BMA10247_A0022"
FT   CDS_pept        complement(18140..18880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adc"
FT                   /locus_tag="BMA10247_A0022"
FT                   /product="acetoacetate decarboxylase"
FT                   /EC_number="4.1.1.4"
FT                   /note="identified by similarity to SP:P23670; match to
FT                   protein family HMM PF06314"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01780"
FT                   /db_xref="GOA:A3MAE3"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="InterPro:IPR023653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MAE3"
FT                   /protein_id="ABO01780.1"
FT                   /translation="MKPSQVRSKAFAMPLTSPAFPMGPYRFVNREFLIITYRTDMDRLR
FT                   EIVPEPLEVKEPLVHYEFIRMPDSTGFGDYTESGQVIPVEYKGQPGGYTLAMYLNDHPP
FT                   IAGGRELWGFPKKLAQPTLQTHIDTLLGTLDYGPVRVATGTMGYKHQELDLEEQAKRLA
FT                   GANFLLKIIPHVDGSARVCELVRYYLQDIEMKGAWTGPASLQLAPHALAPVADLPVLEI
FT                   VEARHLLADLTLGLGEVVYDYLAQ"
FT   gene            19339..19935
FT                   /locus_tag="BMA10247_A0023"
FT   CDS_pept        19339..19935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0023"
FT                   /product="PAP2 family protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02157"
FT                   /protein_id="ABO02157.1"
FT                   /translation="MQNFNLAVFSALNAGSTPPLGAVRFGVFAADWLVYAVPALLLLTW
FT                   VMGARPTRRQAIEAGVGACVALALAQVIGHFWYSPRPFVLGIGTQLIPHAPDGSFPSDH
FT                   TTFVCSVAAGLLIARATRTAGAALAVIAAVIGWGRVYVGVHWPLDIVGGALVGTAGALA
FT                   AHLYGRPVTALLDRVGESVHAVAFTRLHERPIRID"
FT   gene            complement(19958..20194)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0024"
FT                   /note="sperm-specific protein Phi-1; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            20193..20351
FT                   /locus_tag="BMA10247_A0025"
FT   CDS_pept        20193..20351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0025"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02817"
FT                   /protein_id="ABO02817.1"
FT                   /translation="MDAYPGGDARSRAVSFSFDTRKYRGARRAFPYPVTAARAPLCRHR
FT                   RRHVPST"
FT   gene            complement(20960..21787)
FT                   /locus_tag="BMA10247_A0026"
FT   CDS_pept        complement(20960..21787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0026"
FT                   /product="siderophore-interacting protein"
FT                   /note="identified by match to protein family HMM PF04954;
FT                   match to protein family HMM PF08021"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03895"
FT                   /protein_id="ABO03895.1"
FT                   /translation="MTQPTTERAVVRVRHTLKFRLLQVKRVVDVTPHLKRVTLAGDELD
FT                   DFESASFDDHVKVFFPPPGEDAPARPEFGPNGIVFPQDRPRPVARDFTPRRYDRAAREL
FT                   DLDFVLHHPGPASQWAAQARVGQTLGIGGPRGSFVIPKDFDWHLLIGDDTALPAVARRL
FT                   EELPAGTRVAAVLEVADPSAQIAFETDANLYVVWRHRGDAASGERGASRLVDALRELPL
FT                   PAGEGYVWAAGEAAAMRGVREHLCRERGVAKSRIRASAYWKHGAIAVHESLED"
FT   gene            complement(21827..22450)
FT                   /locus_tag="BMA10247_A0027"
FT   CDS_pept        complement(21827..22450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0027"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03300"
FT                   /protein_id="ABO03300.1"
FT                   /translation="MFGGHRRGGGRHGFGPFGGFGGGGPGGFGGFGDDAMPRGRQFSAD
FT                   DLQLLLLALLAEQPSHGYELIKALDTRSSGFYAPSPGMVYPALTYLEELGYVTVQAEGN
FT                   RKRYALADAGRAHLDAQRERVEMLFAKLAHLGRKMEFMRRAFAGEAPAAPEDDTRGWLP
FT                   EFVEARMALKQALFRRSGANADEQRRIAAILRRAVADIEGRAQG"
FT   gene            22436..22555
FT                   /locus_tag="BMA10247_A0028"
FT   CDS_pept        22436..22555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01905"
FT                   /protein_id="ABO01905.1"
FT                   /translation="MAAEHLTKHLERAVSERIGHAAFAARKTVSVTHVRLLCL"
FT   gene            22942..24348
FT                   /locus_tag="BMA10247_A0029"
FT   CDS_pept        22942..24348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0029"
FT                   /product="cytochrome P450-related protein"
FT                   /note="identified by match to protein family HMM PF00067"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03037"
FT                   /protein_id="ABO03037.1"
FT                   /translation="MNGLPLSLPRVDSTDSLFADPLAFLARARAQCGDVFVLREHGPIF
FT                   SRASDCSGVIAVFGEHRLRQVLTETDTFALPMSAAAKMALPKNLVNLNRGLHSMREPEH
FT                   GRHKRLLTGTANRALFDAHRSGMQTDLSRFCEMLNGDGRISVVSRMRELTAKLASRLFL
FT                   GPQCEEDAELTFLLSAYFTLRREASSPNAHDPLQYRDALIGAGRQLDRALRARIRRYRK
FT                   APAGECAGLLQRLATAGQPGSPALSEDEIVGHANVMFVSSTEPVAISLAWLLLVLSQLP
FT                   DLRRALRAESAARASSPASPYDAPLLERVINETLRLLTPNALMVRATTQAVSLQGVALP
FT                   ARCEIVVCPFLVHREANAFARPHAFLPSRWETARPSPYEYFPFGAGGHFCAGRNLALSL
FT                   IGEVLSTLLSRFDFVLDIEQFIDWRIHIMLMPKGDPTLTAHPVDERRDTPSPKWRGPVA
FT                   ELFHFAPGLS"
FT   gene            24498..24698
FT                   /locus_tag="BMA10247_A0030"
FT   CDS_pept        24498..24698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0030"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03244"
FT                   /protein_id="ABO03244.1"
FT                   /translation="MATKPKKTKGVSVSIEGKLPKMTLDMPVDAKKIKAIQKCLENGKL
FT                   TITMSKVDLAGGRMGEGYLYD"
FT   gene            24872..25723
FT                   /locus_tag="BMA10247_A0031"
FT   CDS_pept        24872..25723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01261;
FT                   match to protein family HMM PF05114"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03755"
FT                   /protein_id="ABO03755.1"
FT                   /translation="MKAFDRDAGAPRIGLAYGPGMAEFAARHAHLVDYIEVPFELLRFS
FT                   PTIAELQQTIPFVLHCASLSVAGFVPPDDSTVDAIERTAVRTGTPWIGEHLAYISADPI
FT                   GEALGGTHEPTSLSYTLCPQLSDETVRRVADNLAVLAPRFPVPLIVENSPQYFSIPGST
FT                   MGMTDFIRAIADRCDVGLLLDLSHFLITAYNTGADVHREFARLPLERVVEVHLSGMSIQ
FT                   SGAAWDDHSLPASPILFELLERLLAVARPRALTFEYNWSPYFPLSVLTSHIERARALMG
FT                   LA"
FT   gene            25720..26553
FT                   /locus_tag="BMA10247_A0032"
FT   CDS_pept        25720..26553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01691"
FT                   /protein_id="ABO01691.1"
FT                   /translation="MNARTIHALIAASTKDPQLIERWRRHPDLLRGAGIAPGDLDWRAL
FT                   EHFVGLSLKVRHNGLRGDFPLSFRLLSVVGLEIEVFAAYASDCAESGHVFAATPQERAR
FT                   DLIAFLDRWLDPAQRNHVLLWDILRHEYALACLRQAGDAPLADARPAARHRARATAGGI
FT                   PTLNGSVVQHVMRCNPDDLAAALHQKEPPLDAVPAVDTYCCYWRSAETGEIRLLRVDTL
FT                   GYFAIEAIDGRRSAADICHRLLGNRRLLPQFLSSLDQLAGIGIVRFARPLGCAAA"
FT   gene            26550..28493
FT                   /locus_tag="BMA10247_A0033"
FT   CDS_pept        26550..28493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0033"
FT                   /product="radical SAM domain/B12 binding domain protein"
FT                   /note="identified by match to protein family HMM PF02310;
FT                   match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02693"
FT                   /protein_id="ABO02693.1"
FT                   /translation="MKLLLVDNLVMPEEGSLAYLDVHPHLGLLALAAVAEADGHRVRIY
FT                   DPKRLIRDGTLAYDATLYERASRAILAERPDAVGFTALGCSFLFALNVAALLKRREPDL
FT                   PVLLGGPHATMLHRQILERFPQFDIIVRYEADEILPAVLDCLEQRTFDVIPGLSWRATG
FT                   RGAPLRFTDGKPKVEELDRLPIASYDHYPVDDLGFSMLRIEAGRGCPFACTFCSTAGFF
FT                   QRSFRLKSAERLVHELDILHRRYRVSDFKLDHDMFTVNRHKVMAFCEAVAGRGYRWRAS
FT                   ARIDCVDEALLRKMADAGCVNLYFGVETGSERMQTICRKRLDLRLVEPILAAADSFGIE
FT                   TTASFITGYPQESGQDQDDTLDMIGRCARRPSCLTQLHMLAPEPGTPLFDEHGAQIAYD
FT                   GYGGPYNTRLLGPEDEREVLDHPDIFQTYYYYPAALPRARHIFAVEAVDVLRRAGPIIL
FT                   AYALREFGGRLSRLISAWRRFADETSPGALPDAAGLEAFVAARFGRGHHLHSLFRYALR
FT                   LSAARAPADVVAEGPYEPDRPCMLAENVGLLEDIHNCEALVDRLRRSNDGAPALGDADV
FT                   GGLGAYIVRADGEAVTGYWVESGIAAILDLFRAPRSCRAAAQWLAHVTRNDGVDASIFE
FT                   LLLRRGILVPAR"
FT   gene            28507..29496
FT                   /locus_tag="BMA10247_A0034"
FT   CDS_pept        28507..29496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02936"
FT                   /protein_id="ABO02936.1"
FT                   /translation="MARRKLERWSALDLAEGLQLAHAVAALQTLGVVDAMAEPTTAQTL
FT                   SAACDLDPELLRGVLEYAASRTNLIRKTGDRFAASEHYTAQARFLLNLYAGAYADNASR
FT                   LATLLRRPALAGTTVDLVAHARAFEASEAGGGALAAIISQLHLNHVLDLGCGAGTLLHA
FT                   LVADDREFVGWGLDRNPSMCKAARMRARQAGIAARVKVFQGDGRHPGASIPPRVLARVR
FT                   NVVASQFVNEMFRGGTSRAQAWLRRMRRLLPDRLLVIADYYGRLGHGFQTPHRETLLHD
FT                   YAQLISGQGVPPPNADAWLAMYRAAGCRPLHVIEDRAATTRFVHLVAL"
FT   gene            complement(29668..30288)
FT                   /locus_tag="BMA10247_A0035"
FT   CDS_pept        complement(29668..30288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0035"
FT                   /product="LysE family protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03536"
FT                   /protein_id="ABO03536.1"
FT                   /translation="MNWIAFSHGAMLCASLIVTIGAQNAFILRQGIMRSHVGKIVLLCT
FT                   LSDMLLIGAGVGGASVLVERYPAFVHAVLYVGLAYLAWFGLSALRRAFKPGHETLDATG
FT                   AVAAPPAQRAWPIVLMTLAFTWLNPHVYLDTFLLIGTAGAREPEGARGAFAIGAMAVSA
FT                   VWFVALGYGARLLAPWFKRALAWRVLDGAIGGMVLFLAAVQLR"
FT   gene            30396..31289
FT                   /locus_tag="BMA10247_A0036"
FT   CDS_pept        30396..31289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0036"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466; match to protein
FT                   family HMM TIGR03298"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02977"
FT                   /protein_id="ABO02977.1"
FT                   /translation="MLDYALLDALAEVIRHGSFERAAKALNVSPSAVSQRVKLLEERVG
FT                   SVLVKRGQPCVATTSGALLCRHTERVRMLEAELSGHMPAFAGAQAAAWPTLRVAVNDDS
FT                   VATWFVDAVGPFCAQSGTLLDLVIDDQDYTAERIRDGSVQGAVTALAEPIQGCRSTRLG
FT                   RMRYHAVCSPAFHARYFGNGVNRDALRRAPCVMFNPKDSLQARFIRRATRVDLDPPQHW
FT                   IPHVAGYLRACEAGLGWGMCPERMVERQIAEGGLIDLSDGRSIDIELYWQSWRLSIGWL
FT                   DEFSAALKASAAQYLD"
FT   gene            complement(31336..32091)
FT                   /locus_tag="BMA10247_A0037"
FT   CDS_pept        complement(31336..32091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0037"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="identified by match to protein family HMM PF00027;
FT                   match to protein family HMM PF00325"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03392"
FT                   /protein_id="ABO03392.1"
FT                   /translation="MLTPVARPAAAAAPVHASSTWAPRQAAHCSTCAMRHLCMPQGLAP
FT                   EALARLESVICTARPVRRGETLFREGDTFDNLYAVRSGSLKTIATRHDGREQVTGLHLA
FT                   GEALGLDGICDDAHPRTAVALEDSSVCVIPYSALKTLCSEAGTIQLRMHKLMSEQIVRE
FT                   TSQTMVLGSLNAEERVAAFLLDVSSRYMKRGYSPNEFNLRMTREDIGSYLGMTLETVSR
FT                   TLSKFHKRGLIEMQGRMVRIVDFDGLHRL"
FT   gene            complement(32241..32708)
FT                   /locus_tag="BMA10247_A0038"
FT   CDS_pept        complement(32241..32708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0038"
FT                   /product="universal stress family protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02598"
FT                   /protein_id="ABO02598.1"
FT                   /translation="MYQRILVAVDGSETARHAFDAALDIARTSGAELQPFYVVENAAIY
FT                   YNVPGYDPSILRTQLLQQGNELAKEFAEKMQAAGVKGALKIGEATSLADVPSLIVEGAK
FT                   AFGADLLVLGTHGRRGFKRLVLGSVAEQCVRHSALPVLLIPAAAHPEDRES"
FT   gene            complement(32774..32911)
FT                   /locus_tag="BMA10247_A0039"
FT   CDS_pept        complement(32774..32911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0039"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03254"
FT                   /protein_id="ABO03254.1"
FT                   /translation="MPAGQADTPVARKKSGASARNRKNPAPRLLRRVGSLHLRQSSFTL
FT                   "
FT   gene            33132..33362
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0040"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(33455..33730)
FT                   /locus_tag="BMA10247_A0041"
FT   CDS_pept        complement(33455..33730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03761"
FT                   /protein_id="ABO03761.1"
FT                   /translation="MSIDRRHHARRRRFPAQVAGASRGKTPRPGRSNLDTEIGDGAPPR
FT                   AAPSACACRIAATVVSRSSARACRAPLVRRRIVTPRAQRRAMHSLE"
FT   gene            33738..35708
FT                   /locus_tag="BMA10247_A0042"
FT   CDS_pept        33738..35708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0042"
FT                   /product="aldehyde dehydrogenase (NADP) family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01616"
FT                   /protein_id="ABO01616.1"
FT                   /translation="MWLFGFKSIVARARAEADIPSWALNRRLAFATIAIPAGNAACSHS
FT                   FAGRRACAQDMATGAGTRAPVGMRGARVAVCHDNGMRARRGGAIRRTGRSPRLVQFDPF
FT                   DPFVRRRRTPHREAHRPRPGFQFGGSMQITGEMLIGAAAVRGSEGTMRAYAPAQGVELE
FT                   PTFGAGGAADVDRACRLANAAFDPFRQAPLETRARFLEAIAERIVGLGDPLIERAHAES
FT                   ALPVARLEGERARTVGQLRLFAAIVRDGRWLSATLDSAQPERKPLPRADLRLQKIPVGP
FT                   VAVFGASNFPLAFSVAGGDTASAFAAGCPVVAKAHPAHLGTSELVGRAIRQAVADCGLH
FT                   EGVFSLVVGVGNAIGEALVAHPAIRAVGFTGSRAGGLALMGVAARRHEPIPVFAEMSSI
FT                   NPFFVLPGALRARGAQIAQGFVESLTLGVGQFCTNPGLVVALEGPDLKAFVDAAAQALS
FT                   QKGAQTMLTSGIASSYESAVAARRAAAGVSEVARGARSDARNAALPALFTTTHTQFVQN
FT                   PQLEAEIFGPTSLVVACRDIDEMIALAEHVEGQLSATLHLEDDDVDLARKLLPTLERRA
FT                   GRIVANGYPTGVEVAYAMVHGGPFPATSDPRSTSVGALAIERFLRPVCYQDLPAALLPE
FT                   ALADANPLGLWRLRDGQLGKA"
FT   gene            35705..36100
FT                   /locus_tag="BMA10247_A0043"
FT   CDS_pept        35705..36100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0043"
FT                   /product="gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02444"
FT                   /protein_id="ABO02444.1"
FT                   /translation="MSAMSEIGSRRYPDPAVRVLDPRFGALRLPSASVECLFQGARWSE
FT                   GPVWFGDGRYLLWSDIPNNRMLRWDEQSGTVGVFRQPSNNANGNTRDRAGRLVTCEHLT
FT                   RRVTRTEYDGSITVLAERFAGKRFNSP"
FT   gene            complement(36145..36978)
FT                   /locus_tag="BMA10247_A0044"
FT   CDS_pept        complement(36145..36978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0044"
FT                   /product="A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02001"
FT                   /protein_id="ABO02001.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(37002..37265)
FT                   /locus_tag="BMA10247_A0045"
FT   CDS_pept        complement(37002..37265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0045"
FT                   /product="transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01643"
FT                   /protein_id="ABO01643.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            37344..37895
FT                   /locus_tag="BMA10247_A0046"
FT   CDS_pept        37344..37895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0046"
FT                   /product="gluconolactonase"
FT                   /note="identified by match to protein family HMM PF08450"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03178"
FT                   /protein_id="ABO03178.1"
FT                   /translation="MIVKSDGSIWFSDPDFGIQSFYEGEKQASEMPERVYRIDPQTGAV
FT                   DIVVDGVLGPNGLAFSPDEAMLYVVESKGRPRTIRAYDVAADGRTLRNERVLIDAAQGT
FT                   PDGFRIDVNGNLWCGWGMGTDELDGVRVFTPEGDAIGHIALPERCANVCFGGRHRNRLF
FT                   MAASHGLYSLYVNTQGVPGG"
FT   gene            complement(37944..38210)
FT                   /locus_tag="BMA10247_A0047"
FT   CDS_pept        complement(37944..38210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0047"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01561"
FT                   /protein_id="ABO01561.1"
FT                   /translation="MRRAHRAHRREVDATPSLRAVREIGTGPNVDIVTRSRRQAAALIA
FT                   RARGATAATLERRSRDMHRHRPAADMSRRHTAQHARRRARLTE"
FT   gene            38162..38278
FT                   /locus_tag="BMA10247_A0048"
FT   CDS_pept        38162..38278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03524"
FT                   /protein_id="ABO03524.1"
FT                   /translation="MALRRPRGDALDARVAWPVGALEQFNVGDDAPHDRMTA"
FT   gene            complement(38721..39137)
FT                   /locus_tag="BMA10247_A0049"
FT   CDS_pept        complement(38721..39137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01654"
FT                   /protein_id="ABO01654.1"
FT                   /translation="MTAMNPFERKTSAAGGRARPRSIELYNDATHDSTVDTDGKNREAA
FT                   RIASGGPISPDQMTTSNASLVNAMPETPDGFAGFDSRPGGNRPQFALRAGYAVVDKGFD
FT                   AAALRDAQMADAFSPPYRPPRRPGRIVELAPVAR"
FT   gene            39404..39640
FT                   /locus_tag="BMA10247_A0050"
FT   CDS_pept        39404..39640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0050"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02114"
FT                   /protein_id="ABO02114.1"
FT                   /translation="MHSTTTAFTHRGYLLNCAPARASDGSFQPYVVISRSSDGELVANR
FT                   FFPSDLHFNDEDSAIAHARDWAVRWIDASSLTI"
FT   gene            39764..40687
FT                   /locus_tag="BMA10247_A0051"
FT   CDS_pept        39764..40687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0051"
FT                   /product="putative serine O-acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02704"
FT                   /protein_id="ABO02704.1"
FT                   /translation="MSKSARNWGLEQIVAELRESREKLHRTRHPRGIRELPSRDAVCTI
FT                   VSGLRASMFPTHYGAPDLTDETVDYYVGHTLESTLRLLAEQIRRALRFLPEHAQTPLAV
FT                   LEERAFEIAREFGTQLPRIRALLVSDIQAAYTGDPAAQHITEILLCYPGVLAMMHHRLA
FT                   HALYRLGVPLLARFINEIAHSATGIDIHPGAQIGPSFFIDHGTGVVIGETAIIGERVRV
FT                   YQAVTLGAKSFPADGDGMLVKGNARHPIVEDDVVIYAGATILGRVTIGKGSVIGGNVWL
FT                   THSVPPGSSVAQGKIRESDKDQAEKD"
FT   gene            complement(40967..41770)
FT                   /locus_tag="BMA10247_A0052"
FT   CDS_pept        complement(40967..41770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0052"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03198"
FT                   /protein_id="ABO03198.1"
FT                   /translation="MQSSAKPATLPVVLVTGAARRAGRAFALRFAARGYRVAVHYDRSA
FT                   DAAQAVVREIESSGGEAVALQADLAHADAITQLVDAVYTRFGRLDVLVNNASVFWQDHL
FT                   PSFDLAAFDNAWAINCRAPILLTRAYYERAKAALAQGVVINVVDQKIKENFHRDHFSYT
FT                   VAKAALGNLTQMLALSASPVLRVNAVFPGLMLPSDDQTPADFEHASRASTPLARIAGPN
FT                   DVADAILLLTGPAYNGADFVVDAGQNLIRVDQDVLYKHRSPDGKQ"
FT   gene            complement(41771..42649)
FT                   /gene="folE"
FT                   /locus_tag="BMA10247_A0053"
FT   CDS_pept        complement(41771..42649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="BMA10247_A0053"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227;
FT                   match to protein family HMM TIGR00063"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03694"
FT                   /protein_id="ABO03694.1"
FT                   /translation="MAEVTANGGRARRMGQRAAAVRKASHGARSRRKHETMIGRPQPSR
FT                   PSWSSMHMAKGMTAGKAAAPAARQAARRTSNKASKTASSAATHEPAGAPANRPSRDEAE
FT                   AAVRVLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEPRDILARTFSEVDGYDEMI
FT                   VLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQIQEKMTVQI
FT                   ADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPATRREFLSIV
FT                   ANPSSVNLTNT"
FT   gene            complement(42637..43560)
FT                   /locus_tag="BMA10247_A0054"
FT   CDS_pept        complement(42637..43560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0054"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01832"
FT                   /protein_id="ABO01832.1"
FT                   /translation="MPDLDLNLIPYLVALNEARNVSRAGELLGVSQPRVSAALGRLREH
FT                   FGDPLFVRTSRGMEPTPRALALIPAARDALASIERGLGAPHEFDPAKSARTFSIALSDV
FT                   GEIVFLPRLLQAFAQHAPHANLRSASLSHAEVAHALEDGGVDLAVGYFPDLGGTNFFQQ
FT                   RLFTHRFICLLRRGHPLAERPLTLERFLACGHAVVRAEGRSQEVLEQYLTKRRLTRRAV
FT                   LETPHFMSLPFILSRTDLIATVPHAIGYAYAAEHASITLVEPPLPLPRFDLKQHWHRKF
FT                   HNDPSITWLRGVVAQLFNDALDEWPK"
FT   gene            43659..44900
FT                   /gene="pobA"
FT                   /locus_tag="BMA10247_A0055"
FT   CDS_pept        43659..44900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="BMA10247_A0055"
FT                   /product="4-hydroxybenzoate 3-monooxygenase"
FT                   /EC_number="1.14.13.2"
FT                   /note="identified by match to protein family HMM PF01494"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02313"
FT                   /protein_id="ABO02313.1"
FT                   /translation="MFRRRTMRTQVAIIGAGPSGLLLSHLLRLQGVDSVVLETRSREYC
FT                   ENWIRAGVLEQGTVDTLNDAGLGARMRREGLVHRGIELLFDGRRHRIDFGELTPGRAIT
FT                   VYSQHEVVRDLIEAALEHGQPIHFDVRDVALHDVATERPSVTFMHADGRPDRIDCDYVA
FT                   GCDGFHGVARQAIPAERRRTFERVYPYAWLGILADAAPSLDELVYAHHARGFALFSMRS
FT                   PTVTRLYLQCRPDENLAEWPDARIWEELGTRFENDGGWTPTPGRITQKSVTPMRSFVSE
FT                   TMQHGRLFLAGDAAHIVPPTGAKGMNLAVADVRALSRALVARYRHGRGDLLDAYSSTCL
FT                   ERIWRAEHFSYSMTNMLHPCADDSPFVNRLKLAELKYVTRSRAAAQSLAENYVGLPFDE
FT                   TAGDAPSFGEAAAA"
FT   gene            44973..45821
FT                   /gene="pcaI"
FT                   /locus_tag="BMA10247_A0056"
FT   CDS_pept        44973..45821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaI"
FT                   /locus_tag="BMA10247_A0056"
FT                   /product="3-oxoadipate CoA-transferase, A subunit"
FT                   /EC_number="2.8.3.6"
FT                   /note="identified by similarity to SP:Q01103; match to
FT                   protein family HMM PF01144; match to protein family HMM
FT                   TIGR02429"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01789"
FT                   /protein_id="ABO01789.1"
FT                   /translation="MIGKTFANRICVRYSNQSDRRAKRAALRANACRGGRRARIRIGRD
FT                   MVNKIFDSLQSAVADVHDGATIMIGGFGTAGMPAELIDALIAQGARDLTIVNNNAGNGE
FT                   TGLAALLKARRVRKIICSFPRQADSQVFDALYRAGEIELELVPQGNLAERIRAAGAGIG
FT                   GFFSPTGYGTKLAEGKETRVIDGKHYVFETPIHADFALVKAYRGDRWGNLVYRKTARNF
FT                   GPVMAMAAKTSIVQVSQVVPLGALNPEHIVTPGIFVQRIVEVPQAAHAAELAAERAASA
FT                   A"
FT   gene            45840..46496
FT                   /gene="pcaJ"
FT                   /locus_tag="BMA10247_A0057"
FT   CDS_pept        45840..46496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaJ"
FT                   /locus_tag="BMA10247_A0057"
FT                   /product="3-oxoadipate CoA-transferase subunit B"
FT                   /EC_number="2.8.3.6"
FT                   /note="identified by similarity to SP:P0A102; match to
FT                   protein family HMM PF01144; match to protein family HMM
FT                   TIGR02428"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02605"
FT                   /protein_id="ABO02605.1"
FT                   /translation="MKRLTRDDMAKRVAQDIPEGAYVNLGIGVPTLVANHLDPSREIFL
FT                   HSENGLLGMGPAPAPGAEDDELINAGKQHVTLLTGGAYFHHADSFAMMRGGHLDYCVLG
FT                   AFQVSAHGDLANWHTGAPDAIPAVGGAMDLAIGAKHVFVMMEHLTKQGESKIVAECSYP
FT                   VTGVRCVDRIYTDLAVLDVISDGLAVREICAGLSFDELQQLTGVPLIDATQKAAA"
FT   gene            46632..47990
FT                   /gene="pcaB"
FT                   /locus_tag="BMA10247_A0058"
FT   CDS_pept        46632..47990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="BMA10247_A0058"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /EC_number="5.5.1.2"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR02426"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02141"
FT                   /protein_id="ABO02141.1"
FT                   /translation="MLEDSARLTALVCGSEPLNRIWSPHATLQRMLDVEAALARALAAN
FT                   GVIPANAVRPIEAACAASELDAQALMRDAALGGNLAIPLVRQLTARVKVRDAEAAKYVH
FT                   WGATSQDIIDTAAVLQLRDTLDWLDPLLRDTCTALATLAAAHRTTPMIGRTWLQQALPI
FT                   TLGLKFAQWLDALLRHRERIVALRERALALQFGGAAGTLASLRDAAPAVARSLADDLRL
FT                   ALPAVPWHTQRDRIAETAACFGMLIGTLGKIARDISLSMQTEIGELAEPAAAGKGGSST
FT                   MPHKRNPVGCAAVLTAAVRAPGLVSTVLAGMVQEHERALGGWQAEWDALPELARLAGGA
FT                   LAQVAQIVEGLNVDVARLADNLDATRGLVLGEAVMLALGDRIGRLDAHHLVERASKQAV
FT                   RSGRPLYDVLAADPDVAAHLTPQALRQLLDPAHYVGEAHAYVDAVLALHASRH"
FT   gene            48003..48788
FT                   /locus_tag="BMA10247_A0059"
FT   CDS_pept        48003..48788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0059"
FT                   /product="3-oxoadipate enol-lactone
FT                   hydrolase/4-carboxymuconolactone decarboxylase"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR02427"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03417"
FT                   /protein_id="ABO03417.1"
FT                   /translation="MPFASVDGVRLHYRIDRAARADAPWLVFSNSLGADLSMWAPQIGP
FT                   MTAHFNLLRYDTRGHGHSDAPAGSYTIEQLAGDVIGLLDHVGVARAHFCGISMGGLTGA
FT                   ALAARHAKRVDRVVLSNTSAKIGSPEIWAPRARKARAEGMAALADAVLPRWFTAAFFER
FT                   EPRLIDVIRDTFNHTDKDGYAANCDALNAADLRDEAKGIAVPTLVVTGAHDLSTPPEQG
FT                   RALAASIAGAKHVEFDCAHISNIECADGFNRTLIDFLTA"
FT   gene            48804..49190
FT                   /gene="pcaC"
FT                   /locus_tag="BMA10247_A0060"
FT   CDS_pept        48804..49190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="BMA10247_A0060"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="identified by match to protein family HMM PF02627;
FT                   match to protein family HMM TIGR02425"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02886"
FT                   /protein_id="ABO02886.1"
FT                   /translation="MNDDQRYEAGMNVRRAVLGDAHVDRSLANRTDLTDEFQHLITRYA
FT                   WGEIWTRDGLPRHTRSLLTIAMMVALNRGEELALHLRAAKNNGVTRDEIKEVLLQTAIY
FT                   CGVPAANSAFHLAQRIFGEEDSAS"
FT   gene            49358..50713
FT                   /gene="pcaK_1"
FT                   /locus_tag="BMA10247_A0061"
FT   CDS_pept        49358..50713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaK_1"
FT                   /locus_tag="BMA10247_A0061"
FT                   /product="4-hydroxybenzoate transporter"
FT                   /note="identified by similarity to SP:Q51955; match to
FT                   protein family HMM PF00083; match to protein family HMM
FT                   PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02409"
FT                   /protein_id="ABO02409.1"
FT                   /translation="MTDLARQLDVQQFIDERRFSPYQWLILILCFLIVAADGFDTAAIG
FT                   FVAPALAQQWHVTKAALGPVMSAALVGLALGALAAGPLADRIGRKRVLVGSVVLFGLFS
FT                   IGCAFTQSVTELAVLRLLTGLGLGAAMPNATTLMAEYAPHAKRSFLVNTMFCGFTLGSS
FT                   AGGLVAAALIPEHGWRSVFIVGGIVPLALGALLIALPESIRFMVLRGAPHERIAAVLRR
FT                   IAPDAAFDGVRFVLPDDRGEQRRSGAAVVLSPRYRAGTAMLWLTYFMGLLVYYLMTSWL
FT                   PTLIRDTGFTVRDAALVTALFPLGGGIGAIACGWLMDRIEPHRVIAFAYALTALFVWMI
FT                   GLQAGHLALLATVVFVAGVCMNGAQSSLPALAAAFYPTSGRATGVAWMLGVGRFGGILG
FT                   AFSGGLLLQAQLGFGTIFSMLAVPALIAAGALMVKRSAASRETQPDAPTRAA"
FT   gene            complement(50781..51029)
FT                   /locus_tag="BMA10247_A0062"
FT   CDS_pept        complement(50781..51029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0062"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03724"
FT                   /protein_id="ABO03724.1"
FT                   /translation="MKPLLKAGDRIEGLHWVAEYRHRARLIRVLRERVEVGTYGAPSAL
FT                   FGDEEEMGASTPADHRGREAALRAYLRHFAKVHDAEE"
FT   gene            complement(51130..51747)
FT                   /locus_tag="BMA10247_A0063"
FT   CDS_pept        complement(51130..51747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0063"
FT                   /product="translocator protein, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03146"
FT                   /protein_id="ABO03146.1"
FT                   /translation="MNYLTLSALPAGMLFALVTSITPGPNNTMLLASGVNFGFRRTLPH
FT                   MFGISAGVAILMLSVGFGLGEAFKRIPILYTLLETASVVYLLYLAWRIGTSGEVRAHNG
FT                   KSRPMTFVEAIAFQWVNPKAWMMVLTAATTIQLSADYGRNAVWMALVFVFVGLPCISVW
FT                   AAFGQGLRGFLSNPRWLRVFNLTMATLLVLSLYPMFAKVSGH"
FT   gene            complement(51942..53198)
FT                   /locus_tag="BMA10247_A0064"
FT   CDS_pept        complement(51942..53198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0064"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03665"
FT                   /protein_id="ABO03665.1"
FT                   /translation="MHASSGRFSASLAGRIPPAGADKTAALVLASRGMRGFCDGFIAVL
FT                   LPAYLLALGFSQLDVGLVSTVTLLGSALATIAVGMLAGRVAHRRMLMLAATLMAATGIG
FT                   FASLSTLWALIAVAFVGTLNPSAGDVSLFLPLEQSRLAEAAAGDARTALFARYSLIGAL
FT                   SAAAGSLAAGLPLWLAAHTSIPLPGAMRGMFVVYAGAGVAVWLLYRHLPLPEAHAPAAP
FT                   PPLGPSRRIVTRLAMLFSVDAFAGGLVVNSLLSLWLMQRFGLSVAAAGRFFFCAGLLSA
FT                   GSQLAATPLSRRIGLLNTMVFTHIPSSVCLIGAAFAPSLPLTLALLLLRSALSQMDVPT
FT                   RTAFVMAVVTPAERPAAAGLTSVPRSLAAAIAPALAGGLLGLGWLGAPLVACGALKIGY
FT                   DLTLLASFRHVEPDGGPGR"
FT   gene            complement(53185..53802)
FT                   /locus_tag="BMA10247_A0065"
FT   CDS_pept        complement(53185..53802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0065"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03153"
FT                   /protein_id="ABO03153.1"
FT                   /translation="MEIGRRTTNDTSRPAVSLRAGAGNGAARRRAVPERLGRRRRRRRL
FT                   MHDIIRKVSSASAHWRNAMKWITRERPKIDRIACPWLIARFVDKAAEFLYVPDADVLRI
FT                   AKETGAIPFDVPDVELGHHGELCSFDAFLEKYALHDPALLKLAAIVRGADTGRYDLAPE
FT                   ASGLHAISVGLSGNFRDDLEQLRHGMVMYDALYAWCRRDARL"
FT   gene            complement(53842..54030)
FT                   /locus_tag="BMA10247_A0066"
FT   CDS_pept        complement(53842..54030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0066"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02736"
FT                   /protein_id="ABO02736.1"
FT                   /translation="MAASLRRAPPNRENIVRISGGRFIGIGLAAVPTSRAHCRARRKGW
FT                   PANGATRRSVCRGPRLR"
FT   gene            complement(54015..54578)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0067"
FT                   /note="chromate transport protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF02417"
FT   gene            complement(54639..55205)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0068"
FT                   /note="chromate transport protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF02417"
FT   gene            complement(55202..56179)
FT                   /locus_tag="BMA10247_A0069"
FT   CDS_pept        complement(55202..56179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0069"
FT                   /product="chromate resistance protein ChrB"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03591"
FT                   /protein_id="ABO03591.2"
FT                   /translation="MKIASTWSLLVLTLPTENATARMRFWRALKAKGCAVLRDGVYLLP
FT                   HTEAREGMLRELADAIAESGGAAHLLRVPSLDASQEAEFRALFDREEDYAGFVRDLAQA
FT                   RKTLASQSAAELARLLRRLRKDFEAIRAIDYFPDDAATRAELAWQDFVSLVDTVLSPGE
FT                   PHAAERAIRRLAIDDYQGRTWATRQRMWVDRVASAWLIRRFIDTRARFIWLASPSECPD
FT                   GALGFDYDGAAFTHVGERVTFEVLLASFGLDQDPALLRLGTIVHALDVGGPGAPETVGF
FT                   EAVMAGARRRAENDERLLEQMSDVLDSLYAYFATNETDKTGSRS"
FT   gene            complement(56398..56916)
FT                   /locus_tag="BMA10247_A0070"
FT   CDS_pept        complement(56398..56916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02765"
FT                   /protein_id="ABO02765.1"
FT                   /translation="MRRFLRRFLRRFLRRFLRRFLRRFVRSSQGGMIMAGMCRFAATRI
FT                   RHWNASIVAGLAFVASVAAAQCGLPAVDEMPPALPGALPWKFRAAAIAMQAVPWAVIGL
FT                   LFGYLAARSGIPGRRDAGVGFRPAPISTTASPTAAAFLAPARAGRLPGFANASRGIDCS
FT                   VGRARANRR"
FT   gene            57193..57732
FT                   /locus_tag="BMA10247_A0071"
FT   CDS_pept        57193..57732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02218"
FT                   /protein_id="ABO02218.1"
FT                   /translation="MHTLSFAALLSALPLAAHAQDAQLTDPQIAAIVVTANQVDIDAGK
FT                   LAQGRTHTKQVKDFANLMVTDHTSVNEAAVALATKLSLKPEDNATSGALKRGGDDNIAT
FT                   LRTLRGHEFDKAYIGHEVAYHQQVLDAMDKALIPAAKNGELKALLVKVRPAFAAHLEHA
FT                   RDLQSKLGGDRDRKAD"
FT   gene            57737..58087
FT                   /locus_tag="BMA10247_A0072"
FT   CDS_pept        57737..58087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00127"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02002"
FT                   /protein_id="ABO02002.1"
FT                   /translation="MRPSARWRAACRTILVLAAAVAAVGPAAAGATHTVSIEGMRFNPD
FT                   SLTVERGDKIVWVNKDLVAHTATATAAHAFDSHEIAPNASWAYVARSPGRFAYVCALHP
FT                   TMKANLIVKSKR"
FT   gene            58084..58791
FT                   /locus_tag="BMA10247_A0073"
FT   CDS_pept        58084..58791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0073"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03886"
FT                   /protein_id="ABO03886.1"
FT                   /translation="MTRTMTTEPRSGDMQPSRVDDRALAARVAGGDHAAFEQLMRRYNR
FT                   RLYRLARATLRDDAQAEDVLQEAYLAAFRTIGRFRGDALLSTWLSRLVLNACFTRQRRG
FT                   ARRDNIAPMVNTSSIAGFERTTMDADLTSSPDHALMRTELRALLERKLDALPEAFRLVF
FT                   VLRCVEELSVEETAQCLGIPEATVRSRHFRAKRLLRESLAREIDSAGRDVFSFAGERCD
FT                   RIVRGVLARLISP"
FT   gene            59268..65180
FT                   /gene="uvrA_2"
FT                   /locus_tag="BMA10247_A0074"
FT   CDS_pept        59268..65180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA_2"
FT                   /locus_tag="BMA10247_A0074"
FT                   /product="excinuclease ABC, A subunit"
FT                   /EC_number="3.1.25.-"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03170"
FT                   /protein_id="ABO03170.1"
FT                   /translation="MSSSNLIRIRGARQHNLKHIDLDLRTGEMTVVTGPSGSGKSSLVF
FT                   DTLYAEGQRRYVETFSAYARQFLDRMDRPQVERVDGVPPAIAIDQTNPVRSSRSTVGTM
FT                   TELNDHLKLLYARAAELFDRRTARLVRHDTPETIYADLFARTQAHDPRIAITFAVELPE
FT                   NASDEEVEQWLSASGYTRVQARRDVASPTGPRKVLDVVADRFRLHQIDKARAIEAIEAS
FT                   LKRGGGRVSIYVLAQAPEGADGGAAQSQVWRYSTGLHDPDSDLRYADPQAALFSFNSAY
FT                   GACETCRGFGRVIGVDLGLVIPDARKTLRGGAVKPMQTPAWKECQDDLMRYAAKANIRR
FT                   DTPWAELTPAEQDWVINGSSDWNGKWQSQWYGVKRFFGYLESKAYKMHIRVLLSKYRSY
FT                   TPCAVCGGARLKTEALLWRLGTKANADAVLASADRFMPRGVDWTRAQLEALPGLTVHDL
FT                   MLLPIERIRRFFDDISLPSALLDDALKLLLAEVRTRLKYLCDVGLGYLTLDRQSRTLSG
FT                   GEVQRINLTTALGTSLTKTLFVLDEPSIGLHPRDLNRIVEAMRRLRDAGNTLVVVEHDP
FT                   SVMLAADRLIDMGPGPGERGGTIVYDGTPGAIRSARTLTGEYLGGRKHVAHASNWARRP
FT                   VDARTPRIVLEGASEHNLRDVTVEIPLQRLVCVTGVSGSGKSTLLQDVLYPAMARHFGK
FT                   ATESPGAYRRLAGAEQVGDVVFVDQSPIGKTTRSNPASYVGAFDEIRKLFAKAPLALQR
FT                   GYSAGTFSFNSGDGRCPSCGGSGFEHIEMQFLSDVYLRCPDCDGSRYRAEILEVRIERG
FT                   GRALSVADVLDLTVSEAAACFAADADVLRVLQPIVDVGLEYVKLGQPVPTLSGGEAQRL
FT                   KLAGFLAESAKARDGRRVVTEEARVARARLFMFDEPTTGLHFDDIAKLMQAFGKLLASG
FT                   HSLIVIEHNLDVIRAADWLIDLGPEGGDGGGLVLCAGTPDDVKACAGSHTGAALLQYER
FT                   AMNVGADADASGDAGVPLQAALNAARARRAIEGENVVRIVNAREHNLKALDVDIPHGKF
FT                   NVVTGVSGSGKSTLAFDILFHEGQRRYLESLNAYARSIVQPAGRPEVDAVYGIPPTVAI
FT                   EQRLSRGGRKSTVATTSEVWHFLRLLYVKLGLQHCIHDGTPVTSQTVESIAAQLLRDHR
FT                   GEHVGLLAPLVVNRKGVYTDLAKWAKARGNTHLRVDGEFVTVDPWPKLDRFREHTIELP
FT                   VADLVVSPDNEAELRQRLDETLELGKGVMHLLAPLDGLRHAMDNRLCTAGVGAIKVLSV
FT                   KRACPVCGTSYPELDPRMFSYNSKHGWCTTCVGTGLALTREQRAAYDDTVLAEDGRGRE
FT                   QTLPSDEQEPEGVGDEPCPDCGGTRLNPSARAVTFGRHSIVDVAQWTVTDTRRWIEGLQ
FT                   LAGRDAQIARDIVGEIGSRLAFLEEVGLGYLSLDRAAPSLSGGEAQRIRLAAQLGSNLQ
FT                   GVCYVLDEPTIGLHPRDNQILLSALRKLGDKGNTLVVEHDEDTIRRADHIIDIGPGAGR
FT                   RGGTLVAQGGVADLSAQSASVTGRLLAQPMTHPLQPRRSVNPPGKRNGHAVPQAWLTVH
FT                   RARLHNLRDVTVGMPLARLVAVTGVSGSGKSTLARDVLMTNLLDAVGRSVLSSPAARRA
FT                   RKAAQQDAPRAAKSRASVLARSAPRPVLNVTHAWQGCESISGWEHIDRVLEVDQTPIGK
FT                   TPRSCPATYIGVWDAIRRLFADTLEARARGYTASRFSFNTGEGRCPACEGQGVRTIGMS
FT                   FLPDVKVPCDVCHGQRFNPETLAVTWRGRNIGDVLTMEIDEAVEFFAPLSNIAHPLQLM
FT                   KDVGLGYLTLGQPSPTLSGGEAQRIKLVTELSKVRDDVTRRGQKAPHTLYVLDEPTVGL
FT                   HMADVAKLIRVLHRLVDAGHSVVVIEHDLDVIAEADWIVDLGPEGGAGGGTIVAAAPPE
FT                   GLVEVSASHTGRALGAVLARTGADRDEPLRSGTARAG"
FT   gene            65857..66060
FT                   /locus_tag="BMA10247_A0075"
FT   CDS_pept        65857..66060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0075"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03658"
FT                   /protein_id="ABO03658.1"
FT                   /translation="MEQAKQYGGYQKAAEQIESNRLAIVNSTRYSASVRRQVSDDLSID
FT                   VAALECWAAACVDKPDNPACRF"
FT   gene            complement(66214..66474)
FT                   /locus_tag="BMA10247_A0076"
FT   CDS_pept        complement(66214..66474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03693"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03122"
FT                   /protein_id="ABO03122.1"
FT                   /translation="MRTTRTLSISLPYEMADYIRAKVSTGEFATESEVIRDALRTLIAR
FT                   DRVVEAWLRDAVNSGEFALDPDAEWAADKDEAKPARPRRRP"
FT   gene            66770..66916
FT                   /locus_tag="BMA10247_A0077"
FT   CDS_pept        66770..66916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0077"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02670"
FT                   /protein_id="ABO02670.1"
FT                   /translation="MPSLTNSPMACVAAMSGRPACARSRMKTVRHTAKLGMGIIAGANS
FT                   KVV"
FT   gene            66920..67120
FT                   /locus_tag="BMA10247_A0078"
FT   CDS_pept        66920..67120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0078"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01859"
FT                   /protein_id="ABO01859.1"
FT                   /translation="MPYRLTSARNDCCGEDRRVGGSSLPAGDRMAVVFIFVPACRERRL
FT                   LFADWGCIDPLRELFSQSCGA"
FT   gene            67165..67389
FT                   /locus_tag="BMA10247_A0079"
FT   CDS_pept        67165..67389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03617"
FT                   /protein_id="ABO03617.2"
FT                   /translation="MNTILEDLKTRLEAGRMPIGARGVAMERVEVTAAQTTDILAARHG
FT                   DGNAEEEYFQRNDDAWQWRWRAPDYYEIV"
FT   gene            complement(67396..67527)
FT                   /locus_tag="BMA10247_A0080"
FT   CDS_pept        complement(67396..67527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02961"
FT                   /protein_id="ABO02961.1"
FT                   /translation="MRRLTTRPRRYFRTGLDKLDKDSLYDSGSLVEIRKVALRFKFI"
FT   gene            complement(67672..67971)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0081"
FT                   /note="H-NS histone family protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00816"
FT   gene            complement(68004..68192)
FT                   /locus_tag="BMA10247_A0082"
FT   CDS_pept        complement(68004..68192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0082"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01627"
FT                   /protein_id="ABO01627.1"
FT                   /translation="MYRASCLNARSRNPIAPRRRALHEHRAIPKMDPREVQCASPAGEN
FT                   SMSGPTIFLKISYYPLY"
FT   gene            68509..69861
FT                   /gene="kgtP"
FT                   /locus_tag="BMA10247_A0083"
FT   CDS_pept        68509..69861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgtP"
FT                   /locus_tag="BMA10247_A0083"
FT                   /product="alpha-ketoglutarate permease"
FT                   /note="identified by similarity to SP:P0AEX3; match to
FT                   protein family HMM PF00083; match to protein family HMM
FT                   PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02182"
FT                   /protein_id="ABO02182.1"
FT                   /translation="MEPTFTETGARASEPHATTLAGRAASSGDKLQRLKSIFSASAGNL
FT                   IEWYDWYVYSAFALYFAHSFFPAGNQTAQLLNTAAVFAVGFLARPVGGWLMGIYADRYG
FT                   RRPALLVSVVLMCVGSLIIALCPGYDVIGTAAPVLLVVARLLQGLSVGGEYGTSATYLS
FT                   EVATARDRGFYSSFQYVTLVAGQLVALALLIVLQQFVLTTQQLESWGWRIPFFIGAACA
FT                   LAAMRLRSSMEETGEFKRTLNARDKRGTLAELSKHPRAVLTVVGLTMGGTIAFYTYSIY
FT                   MQKFLVNTVGMSKHDATLVSAASLALFAILQPIVGSISDRIGRRPVLIAFGVLGTLFTV
FT                   PIMTAISRTHDVWTAFFLNMAALVIVSGYTSINAVVKAELFPAKIRALGVGFPYALTVS
FT                   IFGGTAEYLALWLKQAGHESLFYWYVTAAIFCSLLVYVCMRDTGKHSLIKD"
FT   gene            69914..71834
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0085"
FT                   /note="C4-dicarboxylate transport sensor protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error"
FT   gene            71818..73164
FT                   /locus_tag="BMA10247_A0086"
FT   CDS_pept        71818..73164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0086"
FT                   /product="C4-dicarboxylate transport transcriptional
FT                   regulatory protein"
FT                   /note="identified by similarity to SP:P13632; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00158; match to protein family HMM PF02954; match to
FT                   protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03881"
FT                   /protein_id="ABO03881.1"
FT                   /translation="MMNADNAYGREAVYVIEDDAAVRLGCSQALALEGIGVREFEDAES
FT                   ALAALKRDPPAAIVSDVRLPGMGGLALLDSMKAHPRHADIPVILMTGHGDVAMAVGAMR
FT                   CGAYDFIEKPFHSDRLVDTVRRALEHRKLVIENRSLRAQLSGERPLLGSAPAMQRVHAL
FT                   IDAIGPTSADVLIIGETGTGKEVLARALHAASRRTGPFVALNCAALPEAVFESEIFGHE
FT                   PGAFTGAQQRRIGKFEYASGGTLFLDELESMPLSLQAKLLRALQERSIERLGSNVSVAV
FT                   DVRVIAAVKQDLKQLAADGLFRSDLYFRLNVASIELPPLRRRTDDIPELFSHFLRAAAV
FT                   RFEKPEPVWTQEDMMRWQLYDWPGNVRELKNTAERFCLGLEDGLPRSPAGFDSLASRMV
FT                   SAERAYIEEALRNAGGQVAKAAELLGLPRKTLYDKITRHGIDMTAFRCT"
FT   gene            complement(73598..73717)
FT                   /locus_tag="BMA10247_A0087"
FT   CDS_pept        complement(73598..73717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0087"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03644"
FT                   /protein_id="ABO03644.1"
FT                   /translation="MFDAGNRRSCSKTRISGAALLGATSGPDNGRSRSFVSST"
FT   gene            74293..74442
FT                   /locus_tag="BMA10247_A0088"
FT   CDS_pept        74293..74442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0088"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01785"
FT                   /protein_id="ABO01785.1"
FT                   /translation="MVNDFLSGESKAVSIDLVFIFEFYMPGRRLFRKAVAQACIGLRNI
FT                   VRLG"
FT   gene            complement(74625..75098)
FT                   /locus_tag="BMA10247_A0089"
FT   CDS_pept        complement(74625..75098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_438278.1"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01875"
FT                   /protein_id="ABO01875.1"
FT                   /translation="MQGAENAERRHATPGRGACIPARDRPESHYNPTFVPMTAPRTMLL
FT                   LRHAILTALAATACAIAIVTGVGGAATNLREYLAARERDRYRYLADHPLDCRVSEDGRA
FT                   SGCTGLAYLRRERVSVYDDGDDTVQNVVARVDLDHGTYPAIIAVQKRDVRCEQ"
FT   gene            complement(75195..75428)
FT                   /locus_tag="BMA10247_A0090"
FT   CDS_pept        complement(75195..75428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02551"
FT                   /protein_id="ABO02551.1"
FT                   /translation="MDASRFDHAGALLNMAIIPVNDRSARFATSVIGQIFVVTAGAARS
FT                   LSCVRRAVNVHATKAPPPGIGGRRAPRFDEGA"
FT   gene            75432..77357
FT                   /locus_tag="BMA10247_A0091"
FT   CDS_pept        75432..77357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03266"
FT                   /protein_id="ABO03266.1"
FT                   /translation="MLLAAAITAITAIAAIAPAGHAQNATDWLANTYGTLAAHVGNTAR
FT                   SMWVAPEGVIYTASMWDEYEGGVAIYQNGKSVGSIGSHAEFQGGAITGNAASVFVALQY
FT                   DKSHGSGAVGRYNRVTKARELSIQVSASTDQPRVDVVTGLATVGSLLYASDFYGNRVRL
FT                   FTTDGVWQRDIGVAGPGALAVDRAGNVWVARKRAGEIVEFSAAGALLNTLRMPGGSQPS
FT                   ALYFDAPSGQLMVGDEGPDMNIKRYAVTGAPALVGTFGIQGGYLDTTTGIKGQVGARRF
FT                   TRVAGIGKDAAGNLYVLNNPWGGSWDLGRNGATDIHAYDSAGNLQWTLQSLNFEGIAAA
FT                   DPATDGALFYGGTHIYAGSAGGTFVANTVDPFSYPSDPRIDMNDTQRDEHFGQLVAVGA
FT                   NRILVASGQNPPIFYFFHFNKANGYVAIPDASLPGAAFNTAQRVTSGFCIDSEGGVWAG
FT                   LEKTGAIYHYPLAGFDASGKPTWGAGVPTRIPASIQPLTRIVYLAESDTMILAQGIVGS
FT                   ADWTSIGTRIEVYHGWRAGNTAAPDPVITLANAGAKSIDAAGNHLFVGYWFGGGGPARP
FT                   NVDAFNLATGKLDATLVNTSRATVDASSAVDSMYGVRAYQRSTGEYVVTKNNVKGNSIT
FT                   VYRWKP"
FT   gene            77608..78114
FT                   /locus_tag="BMA10247_A0092"
FT   CDS_pept        77608..78114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0092"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03716"
FT                   /protein_id="ABO03716.1"
FT                   /translation="MPRQAFSIRVRLRGRLPKARFRAPDNRLRLPTSSLPRRLALANNE
FT                   AHAQALGQLDREMARLNLDGSALADRVRAELTLTESGYPSLARLASKLFLSERTPKRRL
FT                   QAHGTPYRNMLEAARYRDACRLLTRTDRCVADVSTRLGYVNPSAFTRAFRRWAGIAPSR
FT                   YRDDR"
FT   gene            complement(78148..78261)
FT                   /locus_tag="BMA10247_A0093"
FT   CDS_pept        complement(78148..78261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0093"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01575"
FT                   /protein_id="ABO01575.1"
FT                   /translation="MGAAAAAVGEAAVGAAAIGEAAGGSGAHRTLIDSARR"
FT   gene            complement(78336..78452)
FT                   /locus_tag="BMA10247_A0094"
FT   CDS_pept        complement(78336..78452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0094"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02651"
FT                   /protein_id="ABO02651.1"
FT                   /translation="MNRRCAHAPARTATAAAALHIEPPPRLGNSQAECKVSA"
FT   gene            78486..80681
FT                   /gene="plcN"
FT                   /locus_tag="BMA10247_A0095"
FT   CDS_pept        78486..80681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcN"
FT                   /locus_tag="BMA10247_A0095"
FT                   /product="non-hemolytic phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /note="identified by match to protein family HMM PF04185;
FT                   match to protein family HMM PF05506; match to protein
FT                   family HMM TIGR03396"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01675"
FT                   /protein_id="ABO01675.1"
FT                   /translation="MNARRRFLQGTATTGIAAATLAAFPLSIRRALAIPANNRTGTIRD
FT                   VEHIVILMQENRSFDNYFGTLRGVRGFGDRFGIPLPNALTVWQQRNATGALVLPYHLDG
FT                   SKGNAQRVSGTPHSWDDGQNAWDGGRMYQWPRYKNTASMGYFRESELPFQFALANAFTI
FT                   CDAYHCSMHAGTNSNRMFMWTGTNGPTGAGVASVVNEWDDIGPSTFGYEWKTYPERLQE
FT                   AGVSWKVYQNMPDNFTDNALAGFRQYRRANEASGKPVSNSDKVVSPAYDPASDDVRNPL
FT                   YKGIANTMPDGGFLGAFKEDIRAGKLPQVSWVVAPAAYSEHPGPSSPVQGAWYIQEVLD
FT                   ALTATPDVWSKTVLLVNFDENDGYFDHVPSPSAPSLNPDGSPAGKTTLPEADIAFERFT
FT                   HPKPPGTKSQPQPDARVYGPGVRVPMYVISPWSRGGWVNSQVFDHTSTLRFIEARFGVR
FT                   EPNISAFRRAVCGDLTSAFNFVRPNNEPLPTLAGRKTRAQADALRAAQQQMPQIVPPAN
FT                   GLLPRQETGTRPSRALPYELHVNAVARTLDGTLRLVFANTGQAAAVFHVYDKLNLGRLP
FT                   RRYMVEAGKQLDDVWAAMTDNGGKYDLWVLGPNGLHRHFTGDMNRLRAGGAPVPEVRVE
FT                   YDRQHGNVQLLLRNEGARECVFTVRAKAYRDDGPWTFKVKGGAERKHHWKLDGSGNWYD
FT                   FVVTCDADTGYSRRFAGRVETGEHSVSDPAMGFGDRF"
FT   gene            complement(80905..81060)
FT                   /locus_tag="BMA10247_A0096"
FT   CDS_pept        complement(80905..81060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0096"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02179"
FT                   /protein_id="ABO02179.1"
FT                   /translation="MAGWLELFVHSRAGAATVDRRFSVGTSGLGLDAGDAGGAAAVLCA
FT                   DQSIFR"
FT   gene            81245..81865
FT                   /locus_tag="BMA10247_A0097"
FT   CDS_pept        81245..81865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0097"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02020"
FT                   /protein_id="ABO02020.1"
FT                   /translation="MKYRYRVYAIGYNWLQSNEKSARDVIEGMDFDDKKTDKKMRLMGI
FT                   KEIIAENDSGKAIILIHSMGGLVACMAIAMHSAADLMHGVFHNVLPATGAPIAAKRFRT
FT                   GGGSEGGLNGFINGALLGSNADEFVVMAANAPGALELLPMPDYHNGVDLPPTNRASRSL
FT                   VKFVFGEEDEHEEALYGTANHRVSEGSRGRYAGQGTVQEAWVQ"
FT   gene            81765..82028
FT                   /locus_tag="BMA10247_A0098"
FT   CDS_pept        81765..82028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0098"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03885"
FT                   /protein_id="ABO03885.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            82052..82885
FT                   /locus_tag="BMA10247_A0099"
FT   CDS_pept        82052..82885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0099"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02149"
FT                   /protein_id="ABO02149.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            82963..83220
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0100"
FT                   /note="ISBma2, transposase, truncation; comparison of this
FT                   gene to its homologs suggests this gene has been truncated"
FT   gene            complement(83364..85646)
FT                   /locus_tag="BMA10247_A0101"
FT   CDS_pept        complement(83364..85646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0101"
FT                   /product="putative exopolysaccharide tyrosine-protein
FT                   kinase"
FT                   /note="identified by match to protein family HMM PF02706"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01941"
FT                   /protein_id="ABO01941.1"
FT                   /translation="MRHRRLFATIVGVFFALGVLYALLATPQYRAEALLRIQTKPGASI
FT                   SALSDVSGTISNGPSANDESEVLTSRAIVGAAIEQIGANLEIRTLDHFPLIGRLLASGH
FT                   ANDDKLASPLLGLSGFAWGGEKLKLGEFSLPDAALGEKFRLVAGDDGQWSLYDKKDRLL
FT                   ARGALGESVPFAVALDGERAQPGRIRVDTLRARSGIAFSIVKEPTQLVYDDVMKKMKTV
FT                   VSNRDSTLEEPSMMKLVYQADTPQRVQEMVNAIVRVYLDQDIKYRAEKAQRNLDSLHAR
FT                   LPGLKKDLEKAEDALNRYRTTTGTIDVDQQGIALINRLNSLSEHQTVLQLALDNVKARF
FT                   LPGSTTYQTVQTQLDQVKKEIQQTTTAANKLPTAQREFVRLSRQVSVATQLYTSVLTNA
FT                   QQLEIAVASTTPGVSVVDWANKPYKKAWPQRGIVVLGALLGGLFAGLAAAYLLARHRDE
FT                   LSGPQSIADVSDIPCVAVVAPSAESLALGDDRPGNARARVKPLAAQRPNDPGIEALRAL
FT                   RTSLRAALAHEGRGGGKVLVFAGPTARVGGSFVASNLAYLFADSNASVLFVDADMRGGS
FT                   HNPLGVGRNGGAIGLANVLEGGQPLEKAIVKLGKGKLSVMTPGTLTGSNPGELFERAEF
FT                   PQLLAALRTRYDFVIVDAPPILPYSDTLSIAAQDCDALLLVSRGRTTRASELETALQRL
FT                   DSVGAKIAGHVFNAYVAPPRPPRTSLRDDWREIVARWMKPRRPARPAQAKQTFRLAKGM
FT                   AAKASRN"
FT   gene            85749..85868
FT                   /locus_tag="BMA10247_A0103"
FT   CDS_pept        85749..85868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03818"
FT                   /protein_id="ABO03818.1"
FT                   /translation="MTVAVRGRRNPLSQSSSSSVERIRLRAVMKPGTALMLRS"
FT   gene            complement(85852..87180)
FT                   /locus_tag="BMA10247_A0102"
FT   CDS_pept        complement(85852..87180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02951"
FT                   /protein_id="ABO02951.1"
FT                   /translation="MKRSTPNPRRRLLVALAGTMLTAPGLPRAATRIVLDAARTNADAT
FT                   RGYIDLPGFAASRKNTGIAVHAIDDTSLLDAVKDAGFSFVRADLFWEAVDTPHGWDFSR
FT                   YDTLVAELSERGLGALFILGGIHRVHSPNRPPTTPAQLAAFRRYVFNAAQRYKGKPVRF
FT                   EVWNEQDHKTYWHGEPSPVAYRNVLKLAVQAVKAADPDAIVATGGVQQVNRTFIRAVGD
FT                   IASPAQPAPDAVSVHPYRQTEPETVFADYAALRRDLSSYRRPPQIWATEWSYPSYGYNY
FT                   VADIGDGHSSVARARQANYAVRLLLANWISQIGLTSYYDIRDDGRDRTNMEHNFGLLDA
FT                   DDAPLPAYIAVRRLFAFTADAVRARYFLDPDARYVVLKLSAARATKYALWCYGDGNAIS
FT                   VDLSRLPAGATVTNMYGAALDAGNRRRLDVPEARGPVFITIEA"
FT   gene            complement(87212..88423)
FT                   /locus_tag="BMA10247_A0104"
FT   CDS_pept        complement(87212..88423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0104"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03337"
FT                   /protein_id="ABO03337.1"
FT                   /translation="MLSGAIRYYTSLAGVAALGYLPKALMVACLGLAIVQRPKASHVLV
FT                   AAYLAAQTCVSLANGVSLSAVGFWIWTIAPMLFAIAMPPQALDALESPRMLGAFVALAL
FT                   LCIGGVLLNYFVKLPWVGGSVDIGGVSVQLAKSSYVGTSSRLPGFGRSSATTGLMIGLL
FT                   TTWIFPRLRSRLALAALLALAAAGIWATTNKTTLVALALVVALHCLLRTPSLRTVCIWT
FT                   SAVTIALPIAGWIVTLASTQDVGSSGSLSSMQDRFINTWPLLIEGLLREHLIWFGIGPG
FT                   GFGSAVGYYTADFGFNVGYADNMALYTVANFGLIGAALIVAAFARLILALPANDRPVWL
FT                   MLCFLLVSGVTTDICETIGCLLFLGLTLRSINLHAPRRARVGSARIAFERLRYGAGVIA
FT                   PNAR"
FT   gene            complement(88820..89359)
FT                   /locus_tag="BMA10247_A0105"
FT   CDS_pept        complement(88820..89359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0105"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02165"
FT                   /protein_id="ABO02165.1"
FT                   /translation="MPRSVSRLTTHDSRLTTHDSRRGARRGARRGRTPAFRRLPAAHAR
FT                   GVAGRRAIGRARTRSGRARTERRRSRRMRAAHFEAAAWRDCLSGKPASLPFLTFARPAH
FT                   TKRRYTEASSRRHGAAPPARLPTPPAWLRPANGRTRDASAPPRSRGLPPSARRLPSPSP
FT                   IFTAVDADSPLPARSA"
FT   gene            complement(89359..90642)
FT                   /locus_tag="BMA10247_A0106"
FT   CDS_pept        complement(89359..90642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0106"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01665"
FT                   /protein_id="ABO01665.1"
FT                   /translation="MQSTLDTVANAQERPPRSATPFSIGLAGIAAGLLTLWASRGAAAL
FT                   TGTERSLLACAAIIATIGAYELFVARVHLRPSAGLANRALRPLSVARVSLRLAALASVY
FT                   AGIALVYWLLPEYHGAFYQPFWSLVGMLAPYVALAAPFYFGWMDRRMRDVDDAYLCWGR
FT                   WLLRGQRPADWRPIREMLAGWAVKAFFLPLMIVYLSTDADHIGASFASAASAPFSLATF
FT                   RFMYDLSYTMDLMFGALGYLCTFRLLDSHVRSTEPTTLGWLAALICYQPFWSLIGNNYI
FT                   HYEGSMFWDNWLLSVPAIRFAWGVVIVALLLCYALSTISFGLRFSNLTNRGIITSGPYR
FT                   FTKHPAYLAKNLSYWMISVPFVEPLGWRLAIMHSAALVAVNLLYWLRAKTEERHLMRDP
FT                   DYRAYAEWIARHGMFARLGRMLGRERRA"
FT   gene            complement(90733..91743)
FT                   /locus_tag="BMA10247_A0107"
FT   CDS_pept        complement(90733..91743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0107"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03126"
FT                   /protein_id="ABO03126.1"
FT                   /translation="MPGVNGATTTNLGNAVSSLGNGVQTLGNGTAAGLGTLGTSTNPLG
FT                   PTLTSTSGVVSNVGNAVSSLGGVVTSIGTGPLAPVTSPLGGAVGTLGSTVTQVGSGLNN
FT                   VLTSAPVQQLETGVSSIINPISNVVSGTTQTIGTATGLGAPVNNLLTTVGNGLNAAGAK
FT                   VSGSTNNQVVQAVGGVVSQLGNTVTSVGGLLTGGTTNPLAPITGIAGSLSGTLGANAGL
FT                   NAGATQPGTTTNPLAPVTGLLGGLSGSAGGNAAAGLTAVLAPITNVVGSLTAGVNGTVA
FT                   APSPAPTTGSTTTAPATGVVGSLTGGTTASGTSTTNLLAPVTNLIGGLLGGVSGK"
FT   gene            91759..91881
FT                   /locus_tag="BMA10247_A0108"
FT   CDS_pept        91759..91881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03650"
FT                   /protein_id="ABO03650.1"
FT                   /translation="MVAGGGDDGARRGDQVAGLREDVAERGGGGAGRARRTGSA"
FT   gene            91856..92539
FT                   /locus_tag="BMA10247_A0109"
FT   CDS_pept        91856..92539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0109"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01738"
FT                   /protein_id="ABO01738.1"
FT                   /translation="MPDVPEVPDVPEVPDVPEVPEVPEVPDVPEVPDVPEVPDVPEVPD
FT                   VPEVPDVPDVPDVPDVPDVPDVPDVPDVPDVPEVPDVPEVPDVPDVPEVPDVPEVPDVP
FT                   EVPDVPEVPEVPDVPDVPDVPEVPDVPDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPVL
FT                   PTVAGLTPLADSDGPSTEPQPDRTRRVEMPIAMADLLNSFCMTSSQINLTMPVVDAIFV
FT                   PFIIS"
FT   gene            complement(93158..93313)
FT                   /locus_tag="BMA10247_A0110"
FT   CDS_pept        complement(93158..93313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02196"
FT                   /protein_id="ABO02196.1"
FT                   /translation="MRGGVRAHRAARGLAGKSASPARAAAARNAFAMKFGVTGECGGLR
FT                   DLRLEA"
FT   gene            complement(93347..95743)
FT                   /locus_tag="BMA10247_A0111"
FT   CDS_pept        complement(93347..95743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0111"
FT                   /product="serine protease, subtilase family protein"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF09286"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03424"
FT                   /protein_id="ABO03424.1"
FT                   /translation="MARLASCIRRPAPFRPPHETRDRSRAPLRRGCVKEIVLSAVFVRR
FT                   VVRNRNDTRPDATPCGSRNGLRRIERGLFARHMNGIPKHLTRGGRMCRVRSARTPGETA
FT                   PRRRRPSKGENHVTVNARLAASPCIGCTPRVPIRRSASSHLSSSFSWGFKMQRTQHVNR
FT                   LFSKRFALSPLPLAIAVALSPLLAHAAPDWVPTRTDAFLIARAPAAAASQTLAKTAPSY
FT                   ALNMIGTPELADTNVTPLELSQPLRVTIVLKSRNEAQLDSLVREVNQPGSANYRKYLTP
FT                   EQFKARFAPTDAQVRAVVAHLKANGFGDITVSANNKLIFAQGNASNAERGFHTTLKRFS
FT                   YRGKAVYANDSAALVPASLSPVVESVLGLQSAAVPHRLIHRGTPADARIQTDAITKNAT
FT                   ASGTQTGHQPTDFAQIYNASGLPAATNTTVGIITWGDMTQTIADLNTFTRNAGLPNVNT
FT                   AVVAGSSGTLADDGDPGEWDLDSQTIIGTSGGVKQLIFYAAVNGDSNDSGLTNATLTAA
FT                   YNKAVTDNVAKVINVSLGEDEAAANSDGSLAANDAVFKQAVAQGQIFSVSSGDAGVYQW
FT                   STSPYGAPGYVGTYSGGKVTTKINLAKYSVSSPASSPYVVAVGGTTLSTSGTTTWAGET
FT                   VWNEGLAYADVSSSGQPLDNAVRLWATGGGVSGYEAAPSWQTAALGSSVTKRVVPDVAF
FT                   DAAQSTGAYLVINGQPNQLVGGTSLASPIFVGGWARVESANGNGLGLPTSAFYQGLPGN
FT                   PSLVHDVTSGNNGYNSYGYSAKSGWDDDTGFGSLDFAKVSASSVK"
FT   gene            95721..95915
FT                   /locus_tag="BMA10247_A0112"
FT   CDS_pept        95721..95915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0112"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03803"
FT                   /protein_id="ABO03803.1"
FT                   /translation="MHEASRATDGATPCRHARRSSSAPARYPRSGPAASPEYPISKSVL
FT                   LNERFPVFTICDEWHWIAD"
FT   gene            complement(95923..96057)
FT                   /locus_tag="BMA10247_A0113"
FT   CDS_pept        complement(95923..96057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0113"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01940"
FT                   /protein_id="ABO01940.1"
FT                   /translation="MPRRRAAQAIPDINLTEFFQFNYVIDEGRHSNLAETAANFRAID"
FT   gene            complement(96217..96666)
FT                   /locus_tag="BMA10247_A0114"
FT   CDS_pept        complement(96217..96666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0114"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02460"
FT                   /protein_id="ABO02460.1"
FT                   /translation="MRVGRPVPALPQPVCDYCGAKALLARFGDDAYPYREDHGELWICP
FT                   PCDAWIGVFPRSRRHVPLGRLANAELRHAKSELHAALEPLVAAKMRRDGCNAFEARAKG
FT                   IRWLATQLGLDAASSTIHTLDLDACRNALRLVEQFMSRKSPPAHS"
FT   gene            complement(96826..98289)
FT                   /locus_tag="BMA10247_A0115"
FT   CDS_pept        complement(96826..98289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0115"
FT                   /product="diguanylate cyclase"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03700"
FT                   /protein_id="ABO03700.1"
FT                   /translation="MSPTGVIVCGMLLLTLIWLFCARVLYQSHRDAYLHAVDNAHNLVL
FT                   LLERDIARNVELYDLSLQAVVDGVNDPRIMALDPAIRAKVLFDRAATGKYLGTISVMNE
FT                   HGDIVLDSHFPHPPAVANFSYRDYFVYQRDHPKGGLYIGEPYAARLRHGAPTIALSRRI
FT                   TRADGSFGGVVVGTLGIDYFRSLLDGLSVGPDGTAAVFETNGLMITRLPFDPKMVGRSI
FT                   ADSALYAHVREHDAGVFTGVASIDGVRRLYMYKRLQGLPIVVNVSPAERHVFMQWRIRA
FT                   QRLGVLMLVFGIAIVGGTALLARELRWRRHAEMRLQRLARTDALTGLGNRRAFDENLRS
FT                   EWARALRTGRPLSLLFVDIDQFKDYNDHYGHQAGDDVLREVGGCLAVNVRRAADDVARY
FT                   GGEEFVITLPDTDAKSAAAIAEYIRRAVYDLDIEHVRSPYARVTVSIGLVTSHEHIAHS
FT                   DATLVKMADAALYQAKSTGRNRVCGAQHA"
FT   gene            98342..98854
FT                   /locus_tag="BMA10247_A0116"
FT   CDS_pept        98342..98854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0116"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01841"
FT                   /protein_id="ABO01841.1"
FT                   /translation="MRMTSESLSGGRIEAAAGCGRRFTGPSFHPPLRARVGSGERGGYS
FT                   GYRATPHFLEHSRVAQGQFPRRKRRRRAARPRLGGRAGARVTRVLAAVEARGDFPFDYR
FT                   DRRARIRATNVRRRCKLDVRSRPGMRVRRIVAPLRGVRFAVPVRRPASRAGSRMPQSIR
FT                   CRAASSP"
FT   gene            98854..99030
FT                   /locus_tag="BMA10247_A0117"
FT   CDS_pept        98854..99030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0117"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02360"
FT                   /protein_id="ABO02360.1"
FT                   /translation="MTRRSAGPDSLRAQRDARSMHRGGTSATGAMSATGAMSDTTIRRF
FT                   HEKRAARMAARSA"
FT   gene            complement(99092..100072)
FT                   /locus_tag="BMA10247_A0118"
FT   CDS_pept        complement(99092..100072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0118"
FT                   /product="alpha/beta hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02895"
FT                   /protein_id="ABO02895.1"
FT                   /translation="MIAKLFHFLVYAFVALFAFTQYTAYRIRKMFPPEGKFVDVGADRL
FT                   HYVEYGEGPPIVFVHGLCGQLRNFAYLDLQRLAKSHRVILVDRPGSGRSTRGPRSSANV
FT                   YAQARTIAMFIATLGLDKPVVVGHSLGGAISLALALALNHPQSVSRIALIAPLTHTETE
FT                   PPGPFRGLALRSSLVRRFVSLTLGLPVAMLQNRKAVELVFAPEAVPHDFGVKGGGLLGL
FT                   QPHAFYSASSDLVAAPEDLPDMESRYASLSVPVDVLYGRGDEILNWQRHGEALKKRLDA
FT                   VNLTVVDGGHMLPVTQPAQTTDWLLDVAGKPAAAEPEHTAESVES"
FT   gene            complement(100078..101676)
FT                   /locus_tag="BMA10247_A0119"
FT   CDS_pept        complement(100078..101676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0119"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02836"
FT                   /protein_id="ABO02836.1"
FT                   /translation="MSSTTDWNAARALDERAPQAAAGGHARAKTDFDVLIVGAGLSGIG
FT                   AAYYLRERCPDATYAILEGRETMGGTWDLFRYPGVRSDSDMFTLGFSFRPWHSDKAISD
FT                   GQTILDYIRDTARAYGIDKTIRFGHKVTAASWDSTSARWTVRVQRATGDARHDEAVYTC
FT                   RFLYMCSGYYDYEEGHAPSWPDMDAYQGRIVHPQHWPSDLDYKDKRVVVIGSGATAVTL
FT                   VPSMAADARHVTMLQRSPTYIVSLPARDAIANALRRWLPSGLAHRLVRLKNVLLTMYFY
FT                   NLARRRPDATKKFIVRAAGKQLGPQFDVNKHLTPRYKPWDQRVCLVPNGDLFKAIRAGR
FT                   ASIATDEIERFTPGGLRLKSGQRLEADVIVTATGLKLKMLGGAAVTVDGKPVDLSQTVS
FT                   YKGMMYSGVPNLASSFGYTNASWTLKAELIAQYVCRLLEHMRTHGYDVCVPRLAPGSME
FT                   LEPVVDLTSGYIQRAAGVLPKQGTKKPWKSYQNYARDFATFRFGPLADGAMQFERRRPA
FT                   LAERDDTRQPAYEGR"
FT   gene            complement(101673..102581)
FT                   /locus_tag="BMA10247_A0120"
FT   CDS_pept        complement(101673..102581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0120"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03371"
FT                   /protein_id="ABO03371.1"
FT                   /translation="MRNFSGKVAAITGAGSGMGRSLAVELARRGCHLALGDVNERGLAQ
FT                   TAAICAAHGVKITSQRLDVASRDAVFDWARRTRDAHGKVNLVFNNAGVSLAAPAETARI
FT                   EDFEWIMGINFWGVVHGTQAFLPYLRESGDGHVINTSSLFGLVAMPTQSAYNATKFAVR
FT                   GFTEALRMELELEGAPVSVTCVHPGGVATNIATASRIDSSIAGLSGQDIETHRRAANRL
FT                   INVTTPEAAARQIIAGVERNARRVLVGADARRIDKLARLFGSAYQVFVLRFVRKSRERN
FT                   LARQPAAARPTPPSSISKDPA"
FT   gene            102684..103334
FT                   /locus_tag="BMA10247_A0121"
FT   CDS_pept        102684..103334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0121"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02728"
FT                   /protein_id="ABO02728.1"
FT                   /translation="MENSLELDKKGRPYGGIAPEARAAERRDALIRAGTRIFGTVGFRR
FT                   ATVRAICQEAKLNDRYFYAAFDGTEALLRCTYEHHAEQLRASVKRAVDALGGSRDGLEA
FT                   RVDAGLAAFFAFLRDACAARVLLLEVMGVSAETDATYQQNLREFGRMIISLAGGVSEDA
FT                   DTRADQRIIGIALVGALTNAGAAWLLTGYRDPEEKMVRNCRKVLLGTLQFLSG"
FT   gene            complement(103548..104453)
FT                   /locus_tag="BMA10247_A0122"
FT   CDS_pept        complement(103548..104453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0122"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03262"
FT                   /protein_id="ABO03262.1"
FT                   /translation="MADIRDVNLNRLAIFVAVVEAGSLTAAAERLGLAKTMVSAHVQRL
FT                   EAEVGASLVVRTTRRLNVTEAGRAFYDACRDILRATETALAAVAGDAGPLRGTLRVSAP
FT                   VDYGALVVAPALVALRDAHPALEIELQCDDRVVDLVRDNLDVAIRLGRLADSNHRAAKL
FT                   GGFERWLVASPAFVARHGAPASPEALGALPYVMLSTVPRTTLELANAHGERASVRCRRA
FT                   FASNTATACRAAVLAGGGFGVATSFSSADDIAAGRLVRLLPGWSFPPGDIHAVFPSASH
FT                   PSAKVRALIDMLKTRLAAPC"
FT   gene            complement(104548..105381)
FT                   /locus_tag="BMA10247_A0123"
FT   CDS_pept        complement(104548..105381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0123"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01944"
FT                   /protein_id="ABO01944.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(105405..105668)
FT                   /locus_tag="BMA10247_A0124"
FT   CDS_pept        complement(105405..105668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0124"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02308"
FT                   /protein_id="ABO02308.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            105811..106611
FT                   /gene="gst-2"
FT                   /locus_tag="BMA10247_A0125"
FT   CDS_pept        105811..106611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst-2"
FT                   /locus_tag="BMA10247_A0125"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="identified by match to protein family HMM PF00043;
FT                   match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02822"
FT                   /protein_id="ABO02822.1"
FT                   /translation="MRRAEAVLRRGVSTPCAAVPPQRRVVTFLASSVVGGSSVVLRVHP
FT                   SFEECRSMSAHRPPAAPIRLHRSPLSGHCHRVELFLSLLGVPVEFVEVDMRGGAHRRPE
FT                   FLALNPFGQVPVIEDGECVLFDSNAILVYLAKRYGDPSWLPDDPQGAAAVQRWLSLAAG
FT                   PIAYGAAAARLVTLFGAPLDHAGAIGIARRLFDVIEPQLAGKRFATGEHPTIADVAAYA
FT                   YIAHAPEGGVSLDRYPNLRAWLARIEALPGFVPMPRSHAGPRAA"
FT   gene            106618..106743
FT                   /locus_tag="BMA10247_A0126"
FT   CDS_pept        106618..106743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0126"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03472"
FT                   /protein_id="ABO03472.1"
FT                   /translation="MMLRDVAGCRVMRPDMTRCDLTWLRAALPGAATVPLRRRTT"
FT   gene            106740..106958
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0127"
FT                   /note="pyridoxamine 5'-phosphate oxidase family; this gene
FT                   contains a premature stop which may be the result of a
FT                   sequencing error"
FT   gene            106995..107981
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0128"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF01243"
FT   gene            108506..109780
FT                   /locus_tag="BMA10247_A0129"
FT   CDS_pept        108506..109780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0129"
FT                   /product="nucleoside transporter"
FT                   /note="identified by match to protein family HMM PF01773;
FT                   match to protein family HMM PF07662; match to protein
FT                   family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02197"
FT                   /protein_id="ABO02197.1"
FT                   /translation="MDILRSLCGIVVLLGVGYALSVNRRAISARTVVAALATQLAIGAL
FT                   VLFVPVGRDALAGTAHAVNSVLEMGQHGVAFLFGGLVGDKMFALFGDGGFAFALRVLLM
FT                   IVFVTSLIAVLYYIGVMKWLIRIVGTAMAKLLGVSRIEACSAVATIFLGQSEMPAFVKP
FT                   FVRRMSGTEVFAVMSSGMASVAGSVLAGYAGLGVKMEYLLAASFMAIPGGLLFGKMLCP
FT                   TTEPSRVAVDSLEFDEKRAANVIEAAASGAGVGMRIAVNVGTMLIAFIGLIALLNAMVG
FT                   LVAGWLGFAGVTLQSLLGALFSPLAWLIGVPWRDAPVAGSFIGQKLILNEFVAYGALSP
FT                   YLKDAAQVVAAGLPVLAPKTIAIVSFALCGFANFSSIAILTGGFTAVEPGMRSEVARYG
FT                   LRALAAATLSNLMSATIAGLFLSLS"
FT   gene            109794..110576
FT                   /gene="deoC"
FT                   /locus_tag="BMA10247_A0130"
FT   CDS_pept        109794..110576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="BMA10247_A0130"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="identified by match to protein family HMM PF01791;
FT                   match to protein family HMM TIGR00126"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01669"
FT                   /protein_id="ABO01669.1"
FT                   /translation="MELSLNRNQLTEAALKALHLIDLTSLNDDDTEERIASLAASADTP
FT                   VGTPAALCVYPRFVGAAHAALARHGLVLPVATVTNFPHGAADPDAAARETADALARGAD
FT                   EIDVVFPYRALIDGDERVGRELVAQCRAAAGAQCLKVILETGELRDAAAIRRASEIAIE
FT                   EGADFLKTSTGKVAVNATLDAAAAMLATIRVAGRMVGFKAAGGVRTAQDAAQYLSLAQR
FT                   ELGPGYLTSATFRFGASGLLGNLLETLGHRAGATRGAY"
FT   gene            complement(110617..110862)
FT                   /locus_tag="BMA10247_A0131"
FT   CDS_pept        complement(110617..110862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0131"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03856"
FT                   /protein_id="ABO03856.1"
FT                   /translation="MRSDLSRGRPRLLARLAARASRPAGRRPRLLAPAARLRALLNALL
FT                   GAPLDALARASAPPSPRLIPIERRAARDRTRRERFD"
FT   gene            complement(110876..111055)
FT                   /locus_tag="BMA10247_A0132"
FT   CDS_pept        complement(110876..111055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0132"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03342"
FT                   /protein_id="ABO03342.1"
FT                   /translation="MLYAILTPKAEAPLGYYDSSVTPTPEDMADFLAKTMGFDDRDEWI
FT                   EAYGVEKLGYAPVH"
FT   gene            complement(111099..111386)
FT                   /locus_tag="BMA10247_A0133"
FT   CDS_pept        complement(111099..111386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0133"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02520"
FT                   /protein_id="ABO02520.1"
FT                   /translation="MHGKARVPFRFVHRFSVSDRNRAPAVPLPGRRGHLFGAKRRMPGP
FT                   IARTPANVGNRRCLAPLNNEIANSRKTLVRLSPAPGNSAYHSNWGFSLSR"
FT   gene            111385..111504
FT                   /locus_tag="BMA10247_A0134"
FT   CDS_pept        111385..111504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01991"
FT                   /protein_id="ABO01991.1"
FT                   /translation="MCFEDRYDPPHSPGQCRTVSPVNRPAARSASNAKYVRAA"
FT   gene            complement(111611..111739)
FT                   /locus_tag="BMA10247_A0135"
FT   CDS_pept        complement(111611..111739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0135"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02467"
FT                   /protein_id="ABO02467.1"
FT                   /translation="MHKRLIFNGAIAFEMHSKRRMPSTICTGGPAVSETARPGEIP"
FT   gene            111743..113065
FT                   /gene="deoA"
FT                   /locus_tag="BMA10247_A0136"
FT   CDS_pept        111743..113065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoA"
FT                   /locus_tag="BMA10247_A0136"
FT                   /product="thymidine phosphorylase"
FT                   /EC_number="2.4.2.4"
FT                   /note="identified by match to protein family HMM PF00591;
FT                   match to protein family HMM PF02885; match to protein
FT                   family HMM PF07831; match to protein family HMM TIGR02643;
FT                   match to protein family HMM TIGR02644"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01892"
FT                   /db_xref="GOA:A3MAQ6"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013465"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MAQ6"
FT                   /protein_id="ABO01892.1"
FT                   /translation="MTFLPQEFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAFAM
FT                   AVYFNELPLSARIALTLAQRDSGDVLDWRGARLNGPVVDKHSTGGVGDLTSLVIGPMVA
FT                   ACGGYVPMISGRGLGHTGGTLDKLEAIPGYDVAPSVDMLRRVVRDAGLAIVGQTAQLAP
FT                   ADKRIYAVRDVTATVESISLITASILSKKLAAGVGALAMDVKVGSGAFMPSAEQSAELA
FT                   RSIVDVGNGAGMRTAATLTDMNQALAPCAGNAIEVRCAIDFLTGAARPARLEAVSFALA
FT                   AQMLTMGGLAADAHDARRRLRAVLESGAAAERFARMVAALGGPADLVERPERHLPRAAA
FT                   AAPVAAARAGWIERIDARALGLAVVGLGGGRAKIGDTLDYSVGLSALAELGERVEAGQP
FT                   LATVHARDADSAAQATDAVRRAYRIGAEPPAQTRVVHAVIE"
FT   gene            113182..113337
FT                   /locus_tag="BMA10247_A0137"
FT   CDS_pept        113182..113337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0137"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01868"
FT                   /protein_id="ABO01868.1"
FT                   /translation="MRKGGRAAGGSRRARGTRIPRRHASPAFAARKRITGHRITQHRIT
FT                   ERGHTT"
FT   gene            113334..113726
FT                   /gene="cdd"
FT                   /locus_tag="BMA10247_A0139"
FT   CDS_pept        113334..113726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdd"
FT                   /locus_tag="BMA10247_A0139"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM TIGR01354"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03216"
FT                   /protein_id="ABO03216.1"
FT                   /translation="MTHHALIEAAKAAREKAYAPYSNFKVGAALVTNDGKVFHGCNVEN
FT                   ASYGLCNCAERTALFSALAAGYRPGEFAAIAVVGETHGPIAPCGACRQVMIELGKPTLE
FT                   VVLTNMQGDVRVTSAGDLLPDAFYLA"
FT   gene            complement(113714..114178)
FT                   /locus_tag="BMA10247_A0138"
FT   CDS_pept        complement(113714..114178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02581"
FT                   /protein_id="ABO02581.1"
FT                   /translation="MQTSIAHYAVRTLMRVNEGKMTDECAAWRSRDVDGRGDAEKGRPR
FT                   SARRPSGRRRTGGKRRQRKRAARSGVRRKARGPCREKRDGGNDERHGGRHGEDRGEKCV
FT                   GMQKNREVGEVGEVGEAAAAGEAAEAAEAGGIRVGAHRARPDGAAPRHAR"
FT   gene            114177..114890
FT                   /locus_tag="BMA10247_A0140"
FT   CDS_pept        114177..114890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0140"
FT                   /product="putative phospholipid-binding protein"
FT                   /note="identified by match to protein family HMM PF04972"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03876"
FT                   /protein_id="ABO03876.1"
FT                   /translation="MRRRARLTAGGRLSKPVGEETTMKSDAALKQDVEQELYWDPSLDA
FT                   RQIDVSVRDRIVTLRGFVPSWAQKYAAQKAAQRVAGARALVLELKVLPSEAPRDDEVLA
FT                   AAIVSALAWQEGLAGQEIHVDVDEGCVTLTGEVAFGYQRQAAETVVSRMRGVIGVVNRI
FT                   DVRSRDAGATVRERVADALARRAQREAAHIEVDERDGIVTLTGTVDSLIERRAACGAAW
FT                   SVKGVREVIDHLSVA"
FT   gene            114905..116254
FT                   /gene="pfk"
FT                   /locus_tag="BMA10247_A0142"
FT   CDS_pept        114905..116254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfk"
FT                   /locus_tag="BMA10247_A0142"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="identified by match to protein family HMM PF00294;
FT                   match to protein family HMM TIGR03168"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02274"
FT                   /protein_id="ABO02274.1"
FT                   /translation="MRGACASRAMFDTGGKRQAASGKRQAASGKRQAASGKRQAASGKR
FT                   QAASGKRQAASGKRQAASSKQQAASSKQQAASSKQQAASSSRPAPVLMVRRRIERKHCG
FT                   ACPPRSTREPRTRASRCVVFPSRIPTLKPNVTMPEIVTLTPNPAIDVATCVERVTDTRK
FT                   LRCGPARRDPGGGGINVARVLTRLGADCSAVYLAGGGTGLALRGLLADEGVRAHGIDIA
FT                   GETRENFSVLETSTGREFRFVLPGPALAAHEWPRCVEALGRLADASRYLVMSGSLPPGM
FT                   PDDCYARLARRASARGVRTVVDTSGPALAAALDAGVYLVKPSLGELRALTGLPLEDDGA
FT                   RLAAARAIVAGGRAQIVALTLGDAGALVVSRDDAVRLPGVKVAVRSAIGAGDSFVAGLV
FT                   AALNRGANVADAARHALAAASASLLSTGTALGTKEDIARIYRELPGTIDA"
FT   gene            complement(116221..116409)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0141"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            116412..116582
FT                   /locus_tag="BMA10247_A0143"
FT   CDS_pept        116412..116582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0143"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01581"
FT                   /protein_id="ABO01581.1"
FT                   /translation="MLVSRAHGPKLRRRRARARRQSPAAILPRDLLQLRPLRARPLSAP
FT                   ADAARVATDDR"
FT   gene            complement(116887..118065)
FT                   /gene="ackA"
FT                   /locus_tag="BMA10247_A0144"
FT   CDS_pept        complement(116887..118065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="BMA10247_A0144"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="identified by match to protein family HMM PF00871;
FT                   match to protein family HMM TIGR00016"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02246"
FT                   /protein_id="ABO02246.1"
FT                   /translation="MSEPLLLTFNAGSSTLKIGLYSVANGEPAPLGRGKIDFNRAPLQF
FT                   EYANGGEAHAVPLAAPVTDDLHAVLDEALGWIDAHLSVHELVSVGHRVVHGGDTFDGPV
FT                   RIDERTLDAIAALVPLAPLHQPQSVRLIRALRHVRPHLPQVASFDTAFHRTQSDLVRRF
FT                   ALPRALFDAGIKRYGFHGLSYRYVAGRLRERHPSIARGKVVAAHLGSGASLCALDAGVS
FT                   RDTSMGFSTLDGIPMATRCGALDAGVVLHLQKTLGRTLDDVEQMLYHRSGLLGVSGVSG
FT                   DARALLADPSAGARDALELFAFRIAGETARLAATLGGLDALVFTAGIGEHQPQTRAAVC
FT                   ERLRWLSVELDAHANARNAETVSRDGSRVAVLVVPTDEEQVIARDAASVLHA"
FT   gene            complement(118062..119465)
FT                   /locus_tag="BMA10247_A0145"
FT   CDS_pept        complement(118062..119465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0145"
FT                   /product="phosphate acetyl/butyryltransferase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01515;
FT                   match to protein family HMM PF01575"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02879"
FT                   /protein_id="ABO02879.1"
FT                   /translation="MDREILQNRPFDSLAIGDSASLVRTASRDDIDLFAAMSGDVNPAH
FT                   LDAAFAAHDLFGHVVVHGMWTGALVSAVLGTKLPGPGTIYLDQTLEFRHPVAPGDTITA
FT                   TVTVAEKRPEKRIVLLDTRCTNQDGHVVLRGTATVIAPDTPITWERVPGPEVAVRRHDR
FT                   YETFVRDAREQPPLRTAIVHPCSPDALRAAIDARDANLIEPILIGPQAKIRAIADAAGV
FT                   DLAGVPIEAVEHSHAAAARAVEMGGAGEVAALMKGSLHTDELLAAVIGPASRLRTERRI
FT                   SHVYAMDVPAYPKPLLITDAAINIAPTLEQKRDICQNAVDLLHVLGVERPRVAVLAAVE
FT                   TVNPKMPSTLDAAALTVMAARGQIAGAIVDGPLAFDNAVSAVAAMSKGIASPVAGDADV
FT                   LLVPDLEAGNMLAKQLMYFAGADAAGLVLGTRLPIILTSRADSLRVRIASAALAKLVAE
FT                   RTRAGALAS"
FT   gene            complement(119476..121416)
FT                   /gene="phbC-1"
FT                   /locus_tag="BMA10247_A0146"
FT   CDS_pept        complement(119476..121416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbC-1"
FT                   /locus_tag="BMA10247_A0146"
FT                   /product="poly-beta-hydroxybutyrate polymerase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM PF07167"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03389"
FT                   /protein_id="ABO03389.1"
FT                   /translation="MAVSVIVDACDRSAREAATPASRLRARPAASAAVPRHALARAAPA
FT                   EGSPMDTRHAPESGAPDAPLPAHPPASYAPESPYRIFDLAKEASVAKLTSGLSPASLQL
FT                   ALADWLIHLAAAPGKRAELATLALRHAALLGQYLLEAATGRTPAAPAQPSPGDRRFRAG
FT                   AWQLEPYRFWHQSFLLAEQWWRAATRDVPGVSPHHEDVVAFSARQMLDTFAPANYVATN
FT                   PEIAQRTALTGGANLAQGVWNYLDDVRRLITKQPPAGAEQFELGRNLATTPGRVVFRNH
FT                   LIELLQYSPTTPDVYAQPVLIVPAWIMKYYILDLSAHNSLIRYLVGEGHTVFCISWRNV
FT                   DASDRDLSLDDYRKLGVMDALDTIGAIVPGEKIHATGYCLGGTLLSIAAAAMANTGDDR
FT                   LASITLLAAQTDFAEPGELQLFIDDSEIHFLESMMWERGYLGAHQMAGSFQLLMSNDLI
FT                   WSRVIHDYLLGERTPMIDLMAWNADSTRMPYRMHSEYLRHLFLDNDLATNRYVIDGQTV
FT                   SVHNIRAPFFVVGTEHDHIAPWRSVYKIHYLSGSDVTFVLTAGGHNAGIVSEPGHAKRH
FT                   YRMKMTAAAAPSISPDEWLAGATDFEGSWWPAWHAWLARHSSPQRVAPPPLGKPGAHTL
FT                   GDAPGTYVFQK"
FT   gene            121630..123234
FT                   /gene="atpD"
FT                   /locus_tag="BMA10247_A0147"
FT   CDS_pept        121630..123234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="BMA10247_A0147"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02130"
FT                   /db_xref="GOA:A3MAR7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MAR7"
FT                   /protein_id="ABO02130.1"
FT                   /translation="MADPQATNGTGAVCAERDASDVGDVSDVGDARDEGAGRVVAVRGA
FT                   VVDVAFDGGALPALNEALTIPVDGAAPILAEVHAHLSDAAVRALALGPTGGLRRGAAVR
FT                   ATGGPIRVPVGDAVLGRLLSVTGAPGDDGAALAADVERRPIHRGAPLLAEQKSANALFA
FT                   TGIKVIDLLAPLAQGGKAAMFGGAGVGKTVFVMELIHAMVERYRGISVFAGIGERSREG
FT                   HEMLLDMRGSGVLGRTVLVYGQMNEPPGARWRVPLTALAIAEYFRDERAQNVLLLMDNV
FT                   FRFVQAGAEVSGLLGRLPSRVGYQPTLASEVAALQERIASVEGAAVTAIEAVYVPADDF
FT                   TDPAVTAIAAHVDSMVVLSRAMAAEGMYPAIDPVASSSILLDPLVVGEAHVEVAIEVRR
FT                   VIEHYRELQDVIALLGIDELGADDRRLVGRARRLQRFLTQPFAVTEAFTGQAGASVEIA
FT                   DTIAGCRAILRGDCDDWRESSLYMVGTLDDARRKEAAAREADARREAAAAASGAGPGTT
FT                   SDPASGSAEPQGARHGR"
FT   gene            123224..123679
FT                   /gene="atpC-2"
FT                   /locus_tag="BMA10247_A0148"
FT   CDS_pept        123224..123679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC-2"
FT                   /locus_tag="BMA10247_A0148"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF02823;
FT                   match to protein family HMM TIGR03166"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02652"
FT                   /protein_id="ABO02652.1"
FT                   /translation="MGAELRVTIATPARVCVDDLPIVSLRAEDASGAFGIRAGHVDFVT
FT                   LLRASVVRWRTADGATHYAALDGGVLRVTRGARIEIACRDAVLGESLAELEAVVRGVRA
FT                   TQLDEKRRARVDETRLHAQAVRRLLTYLRPEHAKDGVHAPLKPETLE"
FT   gene            123676..124167
FT                   /locus_tag="BMA10247_A0149"
FT   CDS_pept        123676..124167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0149"
FT                   /product="putative F0F1-ATPase subunit"
FT                   /note="identified by match to protein family HMM PF09527;
FT                   match to protein family HMM TIGR02230"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02222"
FT                   /protein_id="ABO02222.1"
FT                   /translation="MMKRRPPEVKREARDDAARGDARHAGAGAAPDDPRGAARRDPSPG
FT                   SRAARGGATHPAARAAEPAAPKPAADRVERAAHTAAARAARGARDPEPSLGRRLAQIGV
FT                   LGWTIVAPTLAALALGRWLDRMFATRVFFSAPLLMLGAALGLWLAWRWMKAQQHGDRDD
FT                   "
FT   gene            124160..124468
FT                   /locus_tag="BMA10247_A0150"
FT   CDS_pept        124160..124468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0150"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM TIGR03165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02816"
FT                   /protein_id="ABO02816.1"
FT                   /translation="MIEMWETARASFDGIAAAIGLALGFAAGACHFVSLGWNSRLFVAG
FT                   RAGVALALQFARVALAVAVLVVLARAGFGMLVAGSAGFFAARAIAVRRAAALTGARR"
FT   gene            124465..125166
FT                   /gene="atpB_2"
FT                   /locus_tag="BMA10247_A0151"
FT   CDS_pept        124465..125166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB_2"
FT                   /locus_tag="BMA10247_A0151"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:Q05364; match to
FT                   protein family HMM PF00119; match to protein family HMM
FT                   TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03684"
FT                   /protein_id="ABO03684.1"
FT                   /translation="MNASPLSTVPLFSVGPVGISAPVLATWAIMAVLVALALVARRRLS
FT                   VDAPSRLQSVLELFVATVDAQIADTMQTPPARYRALIGTIFVLVFCANGASLVPGVEPP
FT                   TAHLETDAALALVVLAATLYYGVRARGVRGYLATFAEPTWVMIPLNVVEQLTRTFSLIV
FT                   RLFGNVMSGVFVIGIVLSLAGLFVPIPLMALDLLTGTVQAYIFMVLSMVFIGAAVSGDE
FT                   TSAPRRGQENT"
FT   gene            125163..125411
FT                   /gene="atpE_2"
FT                   /locus_tag="BMA10247_A0152"
FT   CDS_pept        125163..125411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE_2"
FT                   /locus_tag="BMA10247_A0152"
FT                   /product="ATP synthase F0, C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00137;
FT                   match to protein family HMM TIGR01260"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01743"
FT                   /protein_id="ABO01743.1"
FT                   /translation="MNNLIEVVSIAAAALAVSFGAIGPALAEGRAVGAAMDAIARQPDA
FT                   SGTVSRTLFVGLAMIETMAIYCLVVALLLLFANPFVK"
FT   gene            125425..126174
FT                   /locus_tag="BMA10247_A0153"
FT   CDS_pept        125425..126174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0153"
FT                   /product="ATP synthase F0, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00430"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02611"
FT                   /protein_id="ABO02611.1"
FT                   /translation="MRIDWSTLALQTVNVVVLVWLLSRFLFRPVSDIIAKRQAAARKLI
FT                   DDASRERDAAHAERERARAERASLAAARDDALKDALAQAAAERERLIAAARADAQALRD
FT                   AARAQADADAVQRAKALDARATRLAIDIAAKLLARLPDSARVAGFVDGVAASLARLPAD
FT                   VRASLADEDAQVRLVAPRALTAQEAAACRAAFAASVGRPLEPDVRVDPALIAGLELESK
FT                   YANVRNSLRQDLATIEAALLNEDDADA"
FT   gene            126158..128170
FT                   /gene="atpA-2"
FT                   /locus_tag="BMA10247_A0154"
FT   CDS_pept        126158..128170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA-2"
FT                   /locus_tag="BMA10247_A0154"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF02874; match to protein
FT                   family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03273"
FT                   /db_xref="GOA:A3MAS4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MAS4"
FT                   /protein_id="ABO03273.1"
FT                   /translation="MTPTPDAPAAADAATGAGWLARRRGALARVALAPIAQAIGRVERV
FT                   ADGIAFVSGLEDTMLNEVLRFEGGVTGFAHTLDEDLISVVLLDPDAGVRAQTAVARTGA
FT                   VLEVPAGPQLLGRVVDPLGRPLDGGAPLDAAHTLPIERAAPAIIERDLVSEPLDTGVLI
FT                   VDALFTIGRGQRELIIGDRATGKTSLAIDAIVNQRHSDVICVYVAIGQRASAVRRVIDA
FT                   VRRYGAPERCVFVVAPAACAPGLQWIAPFAGFSIAEYFRDRGQHALVVVDDLTKHAATH
FT                   RELALLTREPPGREAYPGDIFYVHARLLERAAKLSAALGGGSLSALPIAETDAGNLAAY
FT                   IPTNLISITDGQIVLDSALFAANQRPAVDVGLSVSRVGGKAQHPALRAASGRLRLDYAQ
FT                   FLELEAFTRFGGLTDARLRAQITRGERIRALITQPRFRALRTLDEVVLLKALAAGTLDA
FT                   MSPDLVAPLRERLPAWLDARIAALTPALAPPRDWLADDAALDALAESVGELIERIAADA
FT                   ARRATAGMPAEDAAGDIGGAFGGEQARGDADRDADHGANREVSREVSPEASREVSREVS
FT                   REVSHEADRDAAADAARVAGRAPGRAEPDRAVPRAMPDGPPRAQADGDRASASRPPPDA
FT                   RGDAARTAPSPQGGADANVNADANVDAEAEARHKR"
FT   gene            128167..129015
FT                   /locus_tag="BMA10247_A0155"
FT   CDS_pept        128167..129015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0155"
FT                   /product="putative ATP synthase F1, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03899"
FT                   /protein_id="ABO03899.1"
FT                   /translation="MSDKLAAIEARTDTARQLQTVIGAMQGVAAARAHEAQQRLPGIRA
FT                   SAATVGAAIGDALSAGARSGETAAGARAAPRARFVVVLCSEQGFVGAYNAQLIEHATRP
FT                   GPSVSREYMMVGSRGAMLADAGGVPLVWRTPMAARADDVVHLANRITDALYAHLAKRGA
FT                   QPVSIVHAMPGGAARLEVTERRLLPFDYARFDTAPRAQPPLVHLPPATLLAELAQAYVF
FT                   VELCEAAMLAFAAENEARTRAMIAARESVERALGDLLQAYRIARQDEITADIVELAASG
FT                   L"
FT   gene            129038..129160
FT                   /locus_tag="BMA10247_A0156"
FT   CDS_pept        129038..129160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0156"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03377"
FT                   /protein_id="ABO03377.1"
FT                   /translation="MRRCAARRAESRARIARRFACGFAADARIVNAIAPRAGRG"
FT   gene            129230..130255
FT                   /locus_tag="BMA10247_A0157"
FT   CDS_pept        129230..130255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0157"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03384"
FT                   /protein_id="ABO03384.1"
FT                   /translation="MAQYMKAAVVHAFGEPLRIEEVPVPTPGAGQILVNVKASGVCHTD
FT                   LHAADGDWPVKPTLPFIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQT
FT                   GWETLCHEQQNTGYSVNGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRV
FT                   TDTRPGQWIAISGIGGLGHVAVQYAKAMGLHVVAVDVAPQKLELARKLGATFVVDASKD
FT                   DPAAVIQKEIGGVHGVLVTAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLN
FT                   GITVRGSIVGTRRDLQESLDFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTG
FT                   Q"
FT   gene            130320..130835
FT                   /locus_tag="BMA10247_A0158"
FT   CDS_pept        130320..130835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02867"
FT                   /protein_id="ABO02867.1"
FT                   /translation="MRRAMRGAGRASPSRARRYENVSKEPNTHREAGAPVHRYRLQVRN
FT                   MNGECRTYELRLSSLDDGYTLEIDEWLNFPDTHLGDVTPVHVSRPVQFAVPAHEFYRRR
FT                   RAFRTELIESVAAALRAGEVVRMRDSPDEYPGGHAGNPWVNWIRADLRANPGGRPPPVG
FT                   DDMQDLIH"
FT   gene            complement(130893..131402)
FT                   /locus_tag="BMA10247_A0159"
FT   CDS_pept        complement(130893..131402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02674"
FT                   /protein_id="ABO02674.1"
FT                   /translation="MRRIYFLLPDADTARAIVDELLLKRIEWRHIHVVANDRVPLENLP
FT                   EASIAQSSDLLPALARGTAADGVTGALAGLAAIAFPPAGLTIAGGAVVAFAIAGAGFGA
FT                   WVSTMIGVSVPNTRLKHFEDAVDNGELLMMIDVHRDRVEEIEALVKQHHPNAHLEGTDP
FT                   TIPAFP"
FT   gene            131663..131788
FT                   /locus_tag="BMA10247_A0160"
FT   CDS_pept        131663..131788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01870"
FT                   /protein_id="ABO01870.1"
FT                   /translation="MRRANERSNRRGRRAQLLASARAGEAASSRAASIASAASLA"
FT   gene            132051..133508
FT                   /locus_tag="BMA10247_A0161"
FT   CDS_pept        132051..133508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0161"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF08269"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03741"
FT                   /protein_id="ABO03741.1"
FT                   /translation="MEERRNDLTNVAHVGLSIVREYAALAQRGVLTDAQARKEALERLR
FT                   SVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHYLTFASVAQSPQGGF
FT                   VDYVFAHPNAHPAKAVDKLGYVIRYAPWDWIISTGAYIDDIQAAFAKSLCLSAGVFALL
FT                   AALLALSVVYTNRGIERMIGGDPRIAAHMAGVIASGDLATPFATRREDRSSLMFAISQM
FT                   RDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRD
FT                   TADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNI
FT                   LALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVE
FT                   ATGATIGEAQHAICRVTGIVQDIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHAA
FT                   IAAQSLNEQSRCLQDAVAAFRTEALGC"
FT   gene            complement(133679..133825)
FT                   /locus_tag="BMA10247_A0162"
FT   CDS_pept        complement(133679..133825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03537"
FT                   /protein_id="ABO03537.1"
FT                   /translation="MAMAMAMAMLPAAKRSSGRFACRACAAFTRRGDSPRFRQTVGHAF
FT                   VAP"
FT   gene            complement(133852..135687)
FT                   /gene="cckA"
FT                   /locus_tag="BMA10247_A0163"
FT   CDS_pept        complement(133852..135687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cckA"
FT                   /locus_tag="BMA10247_A0163"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518; match to protein family HMM PF08448;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01921"
FT                   /protein_id="ABO01921.1"
FT                   /translation="MHVEVFAQHPSCPGWHGEMARRIRAFDWSATELGPLERWPASLVA
FT                   AVRTVLASPVPLVMLWGASGYMLYNDAYAAFAGGRHPYLLGQPVELGWPEVADFNRNVM
FT                   RTCLAGGALSYRDKALVLLRNGRPEEVWMDLYYSPLAGDDGAPAGVLVVVVETTERVLA
FT                   ARHRDRAKAALHETNAELRRLTETLEQRVADAITERASIEEQLRQAQKMEAIGSLTGGI
FT                   AHDFNNVLQVVSSNLQMLSAELGEDARAQRRIASAANAVARGAQLASHLLAFARRQPLA
FT                   PAVLDPRGLIDGMREMLHRALGESVHVDADLRDDVWNVLADRHQFENALLNLAINARDA
FT                   MRGEGTLKITACNIVLEAGRHARRNGLPPGEYVAFDIADNGVGMTPDILERVFEPFFTT
FT                   KPDGQGTGLGLSMVFGFVKQSGGHTSIESAPGRGTTVRLLLPRCREAPAGEPAAQRRLP
FT                   AEGGRETILVVEDDADVRLAVVDMLAQLGYKVITASDGKAGLLALESGAPIDLLFTDVI
FT                   MPGRIKGGELARRAAQRVPPVPVLFTSGYTRDEIFHAGRLDPGVMLLGKPYRRDELAHK
FT                   VRSVLDAHASARRAHGARHAQADPRAKTAAARVQR"
FT   gene            complement(135837..136961)
FT                   /locus_tag="BMA10247_A0164"
FT   CDS_pept        complement(135837..136961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0164"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03915"
FT                   /protein_id="ABO03915.1"
FT                   /translation="MRRLAIIYRLGVKELWSLVRDPILLVLIAYTFTASIYSAATARPD
FT                   TLHMAPIAIIDEDASPLSARIASAFFPPQFALPRMVTLAEADRGMDAGDFTFALDIPPN
FT                   FQRDVLAGRPAQIQLNVDATRMSQAFTGNGYVQQIVSGEIDDFARRYRANTAPPVDIAM
FT                   HMRFNPNLDQTWFGSLMEVINNVTLLSMVLTGAALIREREHGTIEHLLVMPVTPGEIML
FT                   AKVWSMGLVVACAAAFSLAFVVRGALHVPIEGSVALFVIGMAIHLFATTSMGIFLATLV
FT                   RSMPQFGMLLVLVLLPLQLLSGSLTPRESMPFAVQNIMLAAPTTHFVEIGQAILYRGAG
FT                   IETVWRQFLILAVIGTALFLLSLKRFRKTIGQMA"
FT   gene            complement(136964..140203)
FT                   /locus_tag="BMA10247_A0165"
FT   CDS_pept        complement(136964..140203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0165"
FT                   /product="RND efflux system, cytoplasmic membrane extrusion
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03252"
FT                   /protein_id="ABO03252.1"
FT                   /translation="MSAPSVVRFSDVSLRYGKTVALERITLEIPAGLTIGLIGPDGVGK
FT                   SSLLALAAGARALQTGAVDALGGDMRSRRHRERVCRRIAYMPQGLGKNLYPTLSVEENL
FT                   QFFARLFGHDADERRRRIDALTRSTGLFAFLSRPAGKLSGGMKQKLGLCCALIHDPDLL
FT                   ILDEPTTGVDPLARAQFWDLIARIRSERPAMSVIVATAYMDEAQRFDWLIAMDAGRVLA
FT                   TGAPAELLARTGCDSLEAAFIALLPEDERRGHKPVTLEPLRADAQTGTAIEARGLTMRF
FT                   GDFTAVDHVSFRIRRGEIFGFLGSNGCGKSTTMKMLTGLLPATEGTAQLFGKTVDPKDI
FT                   NTRRRVGYMSQAFSLYSELTVRQNLVLHARLFGVPAAEIDARVDEMARRFGLADIYDML
FT                   PDSLPLGMRQRLSLAVAMVHKPELLILDEPTSGVDPVARDSFWQLMIDLARRDRVTIFI
FT                   STHFMNEAQRCDRISLMHAGRVLASDAPAALVRARGAATLEEAFIGYLVDASAQEAQEA
FT                   QGGAGERPGAGERAAGESVAGRGAATDGDADGAHARPAAYANGAAQHRAPDADAAGTDV
FT                   AAETGARDDARTAHAAGHSAGNDVRATVGSEVGSEVGSDVGSEVASEAGLAASAESGSE
FT                   RGVAHGAERAREPAADAGAAIDVEPGASAESATAAVAPARHAESAATSPRAGNAPAGTP
FT                   FAAAPAEPPHRAFSAQRALSYMWREMLELRRDPVRATLALIGSLVLMCVIGIGISLDVE
FT                   DLTYAVLDRDQTELSHDYALNLSGSRYFVERPPIADYAALDRRMRDGELSLAIEIPPNF
FT                   ARDVERGAPAQIGMWIDGAMPQRAETIRGYAIGMHTMWLADKARHRLGVTLAPRAEVVT
FT                   RYRYNPDVKSLPAMIPAVMPLLLLMLPAMLTALAVVRERELGSILNLYVTPVTRTEFLI
FT                   GKQVPYVVLAMLNFLLMTMLARIAFDVPVKGSFMTLLLAVLIFNVVATGIGLLASTFTR
FT                   SQVAAIVMTIIGTMIPTVQFAGLLTPLSSLEGTGRLIGLVYPATYMLSISRGVFNKALS
FT                   LHELYSQFWPLAACVPVILGATILLLKKQER"
FT   gene            complement(140200..140685)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0166"
FT                   /note="type I antifreeze protein:HlyD family secretion
FT                   protein; this gene contains a frame shift which may be the
FT                   result of a sequencing error"
FT   gene            complement(140682..141269)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0167"
FT                   /note="type I antifreeze protein:HlyD family secretion
FT                   protein; this gene contains a frame shift which may be the
FT                   result of a sequencing error"
FT   gene            complement(141266..142792)
FT                   /locus_tag="BMA10247_A0168"
FT   CDS_pept        complement(141266..142792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0168"
FT                   /product="efflux transporter, outer membrane factor (OMF)
FT                   lipoprotein, NodT family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01750"
FT                   /protein_id="ABO01750.1"
FT                   /translation="MTMRNDARHDERHQRRRGIARRAARHAAALALCAAVSGCLSLAPD
FT                   YARKPPPVPAAYPAYPGEPGAGSRTLEQLGWRAYFVDPRLQALIETALANNRDLRIAAQ
FT                   RVEQARAAYGIRRADQYPTIAANAAYLRFREPGGLLLPSPIIGELYSASLSEVQWEIDF
FT                   WGRVRSLKAAALDTFLASDASRRAVTVSLIGQVADAYLALCAYDERLALTNETIASRRD
FT                   SLRIFRRRYEEGAISKLDLTQSEILLQQAQTLGSQLQQARDVQQHALDLLVGTNAAART
FT                   PASLDDASIAPDLAPGLPSELLANRPDVVAAEYQLRAAHANIGAARAAFFPRIALTSSI
FT                   GTGSTELHNLFASGTAAWNFIPNLSVPIFDAGRNIGNLKLANARRDEALAQYEKTIQTA
FT                   FRDVADALAARHWLADQVRIAQETLATQAERARLAKLRYDSGAARFLEVLDAQRDLLNA
FT                   QQQLVQTRRALLASRVALYAALGGRLDEPARDGAAPRPSPEPSAKQGPLS"
FT   gene            142960..143925
FT                   /locus_tag="BMA10247_A0169"
FT   CDS_pept        142960..143925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0169"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02438"
FT                   /protein_id="ABO02438.1"
FT                   /translation="MPDAGAPAARASRIEKRTTSRTAARRAAKRRQSMRNRNGDEQAAT
FT                   ARHEAPARPPRCRLPADIRINQILDAALAEFSASGFAGARIDDIAARAGMSKGGVYTHF
FT                   GSKDEIFEALLARTLMPPLPAASSAVRAARRARRAGAGPAARTSGARRAAQASTNGAGD
FT                   ADERPGPGEPREPGAIREPGAAGSNAAAEFPDAPPPVPDSLAAIVDLLTGDLYTWATSE
FT                   PVIAMLRLLIAESRRAPRAVERWRKHVEQAFATAVGRLVRQGVDAGELRDGIAARAPLL
FT                   LVAPLTQACLRRALRAAPPSRREVAASRRDYARFIEALLT"
FT   gene            144009..144611
FT                   /locus_tag="BMA10247_A0170"
FT   CDS_pept        144009..144611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0170"
FT                   /product="universal stress family protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02518"
FT                   /protein_id="ABO02518.1"
FT                   /translation="MFSAPRTIRCNGKRIRCAKRFSEARGNAAEPGRRNDIDLNQEVGM
FT                   YQKIMVALDGSDISKRGLAEAIKIAKATRGRVHAVYVVDKSVVFSYAGHFDPNALLEGF
FT                   RDDGRKALAEAEQALAAAQVPGDAELFETAGIGEEVAQALERCAKSNGADLVVLGTHGR
FT                   RGVRRVVLGSVAERFLRASHCPVLLVRGDEAEHQVQV"
FT   gene            144608..144895
FT                   /locus_tag="BMA10247_A0171"
FT   CDS_pept        144608..144895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0171"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02441"
FT                   /protein_id="ABO02441.1"
FT                   /translation="MSAARPENKENDMTHPDRKAIASTVAVFASQIGLIAAVRGLFVAD
FT                   GSAPYFVLFAIVAGVLGFVDLYYRPIFAPAFARQRVAFVHRRRGAARDVS"
FT   gene            144892..146028
FT                   /locus_tag="BMA10247_A0172"
FT   CDS_pept        144892..146028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0172"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01711"
FT                   /protein_id="ABO01711.1"
FT                   /translation="MNGILRLAFKLLVNDSAKFTALLVGITFAVFLMVEMTSLFAGILD
FT                   KSSSTVINVGAKMWVMDPGVQTIASSIGMPAYVLDAVRSVDGVKYAVPIYSGGALVKLA
FT                   DGTYQAVTVIGLDDASLLGRPTMKAGRIEDIYAENGFIAIDDAEFPKLKNPALGTTFEL
FT                   NDHRGVIVGIAKVASSGLFGTPTLYTTYARATRYIPSTRYTTSYILVEPKSQRDIARIK
FT                   REVAALGYRAYTKEEFMRRISDFYKYETGVGTNILLMTAISFIVGLSISGQTFYAFIIE
FT                   NLEKFGALKAIGAKNRELVAMILFQATFTALTGYGLGVGLCSALISVARLRLPSYAALI
FT                   TYGNLALAFGMVVVIAGLSSYLGVRRVLRIEPFDIFRG"
FT   gene            146025..146729
FT                   /locus_tag="BMA10247_A0173"
FT   CDS_pept        146025..146729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0173"
FT                   /product="efflux ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03482"
FT                   /protein_id="ABO03482.1"
FT                   /translation="MTMAGLAIDARGLTKWFGEGEARTRALADVSVQARFGEMLLIVGP
FT                   SGSGKTTLLSVMSGILRPDAGSVIVDGVDLWAQDNDAIAEFRLNRIGFVFQDYHLFASL
FT                   TTAENVAIPLILKRRDWNRALADAHEYLDVVGLRNRASLPPVKLSGGEQQRVAIARAIV
FT                   SQPDILILDEPTASLDGDTGRTIIDFVKHKVLNDKRCIVIVTHDSRIFDYADRILRMED
FT                   GKLTAIERGGGL"
FT   gene            146726..147811
FT                   /locus_tag="BMA10247_A0174"
FT   CDS_pept        146726..147811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0174"
FT                   /product="auxiliary transport protein, membrane fusion
FT                   protein (MFP) family"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02238"
FT                   /protein_id="ABO02238.1"
FT                   /translation="MRQRIVFVAAIVGFLASLAAAWVYSIQEPPQPPVFKPASNPYPRG
FT                   VYATGIVESDQSSGANVNLYPEVTGTVTRIFVREGDAVKAGDALLAIDDAVQRATAAQL
FT                   AAQADVAQALLDEIRAQPRRETLDVAAAQVEAAAASLKTAQDQYDKQQRAFAIDPRAVS
FT                   RDALDNALNGVKLARANLGVLTRQYRLTRAGAWVYDVRNQEKQAVALRKAADAAAALLA
FT                   RYTLRAPADGVVLAMNAAVGSYLSPQGMYDTYTQGATPALVLGSPANHLQVRCYVDEIL
FT                   ISRLPAGKMPSAHMSVRGTAMEADLAFVRVQPYVTPKIQLSDQRAERVDVRVLPVIFRV
FT                   VPRKDLRLFPGQIVDVYIASG"
FT   gene            147789..150128
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0175"
FT                   /note="ABC-type export system, outer membrane channel
FT                   protein; this gene contains a frame shift which may be the
FT                   result of a sequencing error; identified by match to
FT                   protein family HMM PF02321; match to protein family HMM
FT                   TIGR01845"
FT   gene            151127..152824
FT                   /locus_tag="BMA10247_A0176"
FT   CDS_pept        151127..152824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0176"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03691"
FT                   /protein_id="ABO03691.1"
FT                   /translation="MGFAHMKVATRLGIGFALVACLLAVMVAFALDRMAKFEGWMVEIT
FT                   EVNSVEAKLAAKLELSITERALALRNLILLDRQDEMQIEQDRIDAKAKLYRQSRDRLAT
FT                   MFATLDGTPQERALLEQIGQQGDAADGFIARARTMILAGQKDDAYKLLRFEFRPVQAKW
FT                   WALTRELKALEEKQNEEATLHAKAAYEESRTWMLVLGALALVSSVVSAWLITRGIVRQL
FT                   GGEPCDAAHAANMIAAGDLSVAIGVRDGDEVSLMHAMKSMRDSLAEIVSQVHVSADTIA
FT                   TASGQIASGNLDLSARTEQQAASLEETAASMEQLTATVQQNTDNSRQADTLAASASHVA
FT                   EKGGAAVTQVVDAMGSIHATAQKIVEIIGVIDGIAFQTNILALNAAVEAARAGEQGRGF
FT                   AVVASEVRSLAQRSATAAREIKELIGGSVVQVEAGDRLAKEAGATMHEVVESIRRVTLI
FT                   MAEITRASEQQTSGIVEIDRAITQMDQVTQQNASLVEEAAAAAESMREQSAALVRAVRV
FT                   FKLDAYPAVASSRAAPPARPARPARVASFDAGASVAAHAAPRLARIAP"
FT   gene            152858..153709
FT                   /gene="cysC-2"
FT                   /locus_tag="BMA10247_A0177"
FT   CDS_pept        152858..153709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC-2"
FT                   /locus_tag="BMA10247_A0177"
FT                   /product="adenylyl-sulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="identified by match to protein family HMM PF01583;
FT                   match to protein family HMM TIGR00455"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01966"
FT                   /protein_id="ABO01966.1"
FT                   /translation="MAGLRLFLGCLPVVCQKCAGSLSAVCRPCAATPPAGRAARPSQGI
FT                   PIMSASSPSRARPGARPHDGAPAPVRDACPAPRRDASAPENLFWHAGRVAADARSTQFG
FT                   RPPLTLWLTGLSGAGKSTLAGELERLLLRDRWPCAVLDGDNLRHRLNRDLGFGAEDRHE
FT                   NIRRTAEVARLMNGVGLVVIASLISPFRDDRAMAREIVGSDWFSEVYVSTPLDECERRD
FT                   PKGLYRKARGGLLPNFTGVSAPYEPPVSADLAIDTTRLSVAAAAAMLRAHLIARCAGRH
FT                   VD"
FT   gene            153699..153995
FT                   /locus_tag="BMA10247_A0178"
FT   CDS_pept        153699..153995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0178"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02506"
FT                   /protein_id="ABO02506.1"
FT                   /translation="MSIERPLDWFRRLQCFVCERRFNQRCDRHLLVALVRSAHAHRRGA
FT                   CDAAAGDDGCAANGEHGGLCFGDVPRTRADAPPIRFDERRGARASSPDTRQDY"
FT   gene            154007..155161
FT                   /locus_tag="BMA10247_A0179"
FT   CDS_pept        154007..155161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0179"
FT                   /product="sulfotransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03579"
FT                   /protein_id="ABO03579.1"
FT                   /translation="MTHAATGAAIGTPIGAVRPRPVLMIPLRRCGSHALRLRLNLNSQF
FT                   YSPYPLHIVDFMPLLPLYGDLADDRAYFRLVADIVGLQAASMVKWPGVAFDPVEIFDAL
FT                   RHAPRSAHRIVWELLLRAGEREGARVVMDKSLDSVHYADELMTLYPDMLFLNVVRDPRA
FT                   QVASMNRAIIHDFDTLLNAQAWVAAHRAADVLIARHPQRVLTIRYEDFLSDQAHTLQRV
FT                   CAFFGIDFLPRMLDIANSPEARHISRMSELWASNCFAPIAANADKFKQQLSTAEIATIE
FT                   TLAHEYMQRYGYQQMTDATAMPDAFAAAAARRRSDARRRHAWRELEQSNFRDFVLRRHR
FT                   ADYLETVRARLQRHASAHADSRADSPAGAPGRRDTLTAAFDVTD"
FT   gene            155507..156157
FT                   /locus_tag="BMA10247_A0180"
FT   CDS_pept        155507..156157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0180"
FT                   /product="osmotically inducible protein Y domain protein"
FT                   /note="identified by match to protein family HMM PF04972"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02220"
FT                   /protein_id="ABO02220.1"
FT                   /translation="MKTDRQIKQEVEDELTGDPMIDVAHFDVDVAGHIVTLTGHPSSYA
FT                   EKLAAEKAANRVAGVRAVVVDVQVRLPSDDVRTDEAIADAVRSTLHWTVGLHDAAVHVQ
FT                   VEAGWVTLSGQVDWPYQSHVAARAISQMRGVTGVTNQIEVLGDISADEIAGGIRRAMQR
FT                   HAEREANHIDVTVKDGTVTLAGKVGSYAERAVARGAAWSARGVRAVVDDLVVE"
FT   gene            complement(156626..156757)
FT                   /locus_tag="BMA10247_A0181"
FT   CDS_pept        complement(156626..156757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0181"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03353"
FT                   /protein_id="ABO03353.1"
FT                   /translation="MLVCETPARCARSRSPRTPRAVGARARSRRTNSASRRYASGCR"
FT   gene            complement(156759..157040)
FT                   /locus_tag="BMA10247_A0182"
FT   CDS_pept        complement(156759..157040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0182"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03866"
FT                   /protein_id="ABO03866.1"
FT                   /translation="MSYHDVYTESGYLAYGRAEAAPDTEADRPARPRPAAARADRTDAL
FT                   LALAREAGMLVTLDGQIGRERYQSVAGSVASLMRFVTALEQSLLDGDQ"
FT   gene            complement(157475..158434)
FT                   /locus_tag="BMA10247_A0183"
FT   CDS_pept        complement(157475..158434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0183"
FT                   /product="decarboxylase family protein"
FT                   /note="identified by match to protein family HMM PF03641;
FT                   match to protein family HMM TIGR00730"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02031"
FT                   /protein_id="ABO02031.1"
FT                   /translation="MNPPPPPRAKRRRTRAASASASASAPGMRPTPRRTRTAPKRRAPL
FT                   SSTVERLVSSPTYRQADEDLAFLQRPEMCGVRLQLDYWKTEETLQRFGICDTVVVYGST
FT                   RIASPAVARARLADAQHRLAERPNDPERRHAVSVAVRLLERSHYYGVARDLGRLVGETG
FT                   RSPHPRRLTIITGGGPGIMEAANRGAHERGAPSIGLNITLPREQFPNPYVTPELCFRFH
FT                   YFAIRKLHLLERAKAAVFFPGGYGTCDELFEVLTLLQTRKIAPLPVVLVSRAFWRSAVD
FT                   FGFLVDEGMIDPCDAALFRFCETADEIWAAIGGPHGPA"
FT   gene            complement(158473..158604)
FT                   /locus_tag="BMA10247_A0184"
FT   CDS_pept        complement(158473..158604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01835"
FT                   /protein_id="ABO01835.1"
FT                   /translation="MSPIPRARSPTKPARGCAAQPRIVTSALSADVDRDQAAHNDPA"
FT   gene            158750..159037
FT                   /locus_tag="BMA10247_A0185"
FT   CDS_pept        158750..159037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02355"
FT                   /protein_id="ABO02355.1"
FT                   /translation="MQIAYFGFAGSAQLEAEASIQLIRLERFSARLAGCHLAIEALGAG
FT                   AASPTYDVRLDLITRGYELKPIPHMTGTDPLDAIRRAFDAAERELAAALA"
FT   gene            complement(159423..159797)
FT                   /locus_tag="BMA10247_A0186"
FT   CDS_pept        complement(159423..159797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0186"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03494"
FT                   /protein_id="ABO03494.1"
FT                   /translation="MRITVHLDTFASTDPAAYAILWIDTTEHRWSREGHAGVELPAWSN
FT                   VVCRGGTTRVTGADDPHSLCVLEGLDLGAKQGPFEGETGAAHWYPHAHRAPVVGAWHVQ
FT                   CIDETVAPAEHELFTGREAS"
FT   gene            complement(159856..160542)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0187"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            160617..160844
FT                   /locus_tag="BMA10247_A0188"
FT   CDS_pept        160617..160844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0188"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01931"
FT                   /protein_id="ABO01931.1"
FT                   /translation="MHQDTLFDSLLAAARRRSITEGEVMHMLDDEIARLADGARIHDYL
FT                   RVIAIRRVRERIVSHARAADEAHARRPGAR"
FT   gene            160844..161830
FT                   /locus_tag="BMA10247_A0189"
FT   CDS_pept        160844..161830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0189"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF08240;
FT                   match to protein family HMM TIGR02822"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02663"
FT                   /protein_id="ABO02663.1"
FT                   /translation="MRAMVFDGGAPRLREAELPDPVPAAGQLLIDVHACGVCRTDLHVV
FT                   DGDLRDPKRPVIPGHEIVGTVAALGALAKGFTIGERVGVPWLGRTCGHCAYCASGRENL
FT                   CDAPGFTGYTIDGGYAQRTVADARFCVHVPSRYDDIHAAPLLCAGLIGYRTLKMAGSAR
FT                   RIGLYGFGAAAHLVAQVARFQGRTVYAFTRPGDAAAQRLARRLGAAWAGGSDEAAPEPL
FT                   DAALIFASVGALVPAALAAVVKGGAVVCGGIHMSDIPSFSYDLLWGERRIVSVANLTRD
FT                   DAAEFMRIANDVPLDVEATPYPLAQANQALDDLRAGRLAGAAVLTMR"
FT   gene            complement(162036..162764)
FT                   /locus_tag="BMA10247_A0190"
FT   CDS_pept        complement(162036..162764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0190"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="identified by match to protein family HMM PF00027;
FT                   match to protein family HMM PF00325"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03721"
FT                   /protein_id="ABO03721.1"
FT                   /translation="MIRLHPVTADDAPKLPATRCSTCAIRNVCMPAGLTPIEFARLDAM
FT                   VCTTRHVKRGDALFRTHDTFQSIYAVRTGSFKTVVMHRDGREQVTGFQIVGETLGLDGV
FT                   CGGRHNSDAIALEDSTVCIIPFAQLEAVCREVKPMQHHVHQLMSGEIVRESSLMMLLGT
FT                   MTAEQRVAAFLLNISERFQKRGYSASEFNLRMTREEIGCYLGMKLETVSRMLSKFQRDR
FT                   LIAPRGKQIRITDPQGLARV"
FT   gene            162862..163176
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0191"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(163275..163388)
FT                   /locus_tag="BMA10247_A0192"
FT   CDS_pept        complement(163275..163388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01602"
FT                   /protein_id="ABO01602.1"
FT                   /translation="MLPGARRTRAPVRMRGDMSTPAAATRRETPQRYRVLL"
FT   gene            163483..164229
FT                   /gene="phbB-1"
FT                   /locus_tag="BMA10247_A0193"
FT   CDS_pept        163483..164229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB-1"
FT                   /locus_tag="BMA10247_A0193"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659; match to protein
FT                   family HMM TIGR01829"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02129"
FT                   /protein_id="ABO02129.1"
FT                   /translation="MQAKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSERNDHVSTW
FT                   LMHERDAGRDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKG
FT                   DWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSVNGSRGAFGQANYASAKAGIHG
FT                   FTKTLALETAKRGITVNTVSPGYLATAMVEAVPQDVLEAKILPQIPVGRLGRPDEVAAL
FT                   IAFLCSDDAGFVTGADLAINGGMHMS"
FT   gene            complement(164420..164749)
FT                   /locus_tag="BMA10247_A0194"
FT   CDS_pept        complement(164420..164749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0194"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03634"
FT                   /protein_id="ABO03634.1"
FT                   /translation="MNWRNAWNGRQQAASADAYRTPRPPRTLRPESAKHDGARRSIETG
FT                   RGESADECRGRHAGGDGEIRVRCFVTLNDYADRSRGRAVGQCPLRAAETIDMQAEPARN
FT                   ATGER"
FT   gene            complement(164823..166241)
FT                   /locus_tag="BMA10247_A0195"
FT   CDS_pept        complement(164823..166241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0195"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02976"
FT                   /protein_id="ABO02976.1"
FT                   /translation="MGASNTTRIPGGLMKLTFLGATETVTGSKYLLEDAGTRVLIDCGL
FT                   FQGTKKLRLRNWSPLPVPADSIDAVVLTHAHLDHSGYLPVLVREGFRGPIYCTHGTAAL
FT                   CEIMLIDSARLLEEEADFANRHGYSKHHPALPLYTTDDAKRTLERLAPRDFDAPSALAG
FT                   DLHFRLLPAGHILGAASVVVCWRHTLLAFSGDLGRAHDPIMRAPVPPVHADYLVVESTY
FT                   GDRLHDASDPQTELADVFAKTFARGGVVVMPCFTVGRAQEILYYIAQLKQTGRMPHVPV
FT                   FLDSPMATSVTEIYRRRLSDHRLTMSDADAIGHAAVMVRTVEQSKAIADHHGPMVVIAG
FT                   SGMATGGRVLHHLARYAPDSRNTVLLVGYQAAGTRGAALAAHEPTLKIHGEYVRVRAQV
FT                   QMISSLSAHADYGEILGWLGAQSSAPARTFVTHGEPAAADALRRRIEETLHWRCDVPSY
FT                   LESVELEDAPTRAA"
FT   gene            166916..167806
FT                   /locus_tag="BMA10247_A0196"
FT   CDS_pept        166916..167806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02272"
FT                   /protein_id="ABO02272.1"
FT                   /translation="MNAIVRRDIRFALPPDRICDWHTEGVGVTHLFNALSLLFPAGERF
FT                   FMDSVRNYRDRIEEPNLKRDIAGFIGQEAMHTREHVEFNDLLQAAGLPAHKLDKRLWTV
FT                   LGWFKKVLPHSMQLAITMALEHYTAMFTGLVLANRITTSEVDGYRQMWMWHSMEETEHK
FT                   AVAYDVWRTVMKPSLASYLLRTGTMLFVTLVFWATLFDFNTRLLISHRRRIGGRLGIGK
FT                   LVKYLWGPRNGIFAQIAREWIDYFRPGFHPWDHDNSVHLERLDDLIAEIDASNARQAAK
FT                   AAPRRVPLHPVPQAV"
FT   gene            complement(167929..169545)
FT                   /locus_tag="BMA10247_A0197"
FT   CDS_pept        complement(167929..169545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0197"
FT                   /product="ISBma2, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02535"
FT                   /protein_id="ABO02535.1"
FT                   /translation="MADMAGAALARDAHADAPTRAPKKTEGPLVAALQIADKPSPSGGF
FT                   LFFNGVMLKTPMPTQHELEMVTLEELVPKDHLLRQIDAAVDFEFIRAKVAHLYCADNGR
FT                   PALDPVVMFKLLFIGYLFGVRSERQLMREVQVNVAYRWFARFRLTDKVPDASTFSQNRR
FT                   RRFTDTTVYQEIFDEIVRQAIKRGLVDGRVLYTDSTHLKANANKGKFDVVKLEQTPAAY
FT                   TEALNAAVDADRAAHGRKPLDRDDDEPPSSKDTKLSRTDPDSGYMVRDDKPKGFFYLDH
FT                   RTVDAKHAIITDTHVTPASVHDSQPYLDRLDRQRERFEFKVEAVGLDAGYFTPAVCQGL
FT                   EERGIAGVMGYRTPNHKPGMFYKRQFKYDAYRNEYVCPQGQALPYSTTNRLGYREYKSN
FT                   AQICGRCPVRSQCTNSAIAVKVVTRHVWERAKERVDARRLTEWGQRIYARRKQTVERSF
FT                   ADAKQLHGHRYARMRGLRKVAEQCLLAAAAQNIKKIAMLLARKRKKGPAGPDWRFVRML
FT                   LRLVSGLRCSFDYPLAANPQS"
FT   gene            complement(169621..169806)
FT                   /locus_tag="BMA10247_A0198"
FT   CDS_pept        complement(169621..169806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0198"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01563"
FT                   /protein_id="ABO01563.1"
FT                   /translation="MRAQRGGSGLAAARRAPALVRCGAASKNMKNAKSAELRCGAQRRA
FT                   AMHKRCRNGAKGREMV"
FT   gene            170041..171603
FT                   /gene="lysP"
FT                   /locus_tag="BMA10247_A0199"
FT   CDS_pept        170041..171603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysP"
FT                   /locus_tag="BMA10247_A0199"
FT                   /product="lysine-specific permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03646"
FT                   /protein_id="ABO03646.1"
FT                   /translation="MSPHPNSDNSTAQSNPPQLRRSLKARHLTMIAIGGSIGTGLFVAS
FT                   GASISQAGPGGAMLAYLLIGLMVYCLMMSLGEMAAFMPVSGSFATYGAKYVEEGFGFAL
FT                   GWNYWYNWAVTIAVELVAAQLVMHYWFPDVPGVWWSAAFLGVMFLLNVLTVRGFGEAEY
FT                   WFALIKVVTVIAFIGVGLLMIFGILKGGPSNGWSNFTIGDAPFAGGLPAMMGVAMIAGF
FT                   SFQGTELIGVAAGESENPRTTIPRAVRQVFWRILLFYVLAIFVIGVLIPYTDPNLLKSD
FT                   VTDVGVSPFTLVFRHAGLAFAAGVMNAVILTAVLSAGNSGMYASTRMLHNLATEGRAPK
FT                   LFAKLSAGGVPRNALYATTAVGALCFLSSLYGDKTVYLWLLNTSGMTGFIAWLGIALSH
FT                   YRFRKGYVRQGFSVDQLPYQSSLYPYGPIFAFALCIVIALGQDYQAFLANRIDWIGVLA
FT                   TYVGIPLFLVVWLGYRLVHKTRVVRYEDMDIASWVAEHERAAAHEAREAAAVRVPSSPE
FT                   AAS"
FT   gene            complement(171803..172636)
FT                   /locus_tag="BMA10247_A0200"
FT   CDS_pept        complement(171803..172636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0200"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01590"
FT                   /protein_id="ABO01590.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(172660..172923)
FT                   /locus_tag="BMA10247_A0201"
FT   CDS_pept        complement(172660..172923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0201"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03423"
FT                   /protein_id="ABO03423.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            complement(172989..174152)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0202"
FT                   /note="ISBma1, transposase, interruption-N; this gene model
FT                   represents a disrupted reading frame with multiple genetic
FT                   anomalies; identified by match to protein family HMM
FT                   PF01610"
FT   gene            complement(174189..174314)
FT                   /locus_tag="BMA10247_A0203"
FT   CDS_pept        complement(174189..174314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0203"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03275"
FT                   /protein_id="ABO03275.1"
FT                   /translation="MRRAPCVRRQASGVRPEQERQATRIKKGSSQKTVETWRTIA"
FT   gene            complement(174404..175843)
FT                   /locus_tag="BMA10247_A0204"
FT   CDS_pept        complement(174404..175843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0204"
FT                   /product="BNR/Asp-box repeat protein"
FT                   /note="identified by match to protein family HMM PF02012"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02739"
FT                   /protein_id="ABO02739.1"
FT                   /translation="MRRNALPVSFVSGIAAAAALAMSAAAHGAPVLVSGPSPFAGCTIG
FT                   GPGVNYVNAEVEPWVAVNPANPSNVIGAWQQDRWSNGGAHGLVAGYSFDGGLTWKQTNL
FT                   PFSACAGGLAYERASDPWVSIGPDGTAYSVSISFNQSNNSNAVAASVSTDGGQTWSAPT
FT                   LLIADNEPTTQFFNDKESVSANPTKAGTAYAVWDRLEQPTGNPHANLHTAASRGPSYFS
FT                   KTVDGGKTWSAPSVIVDVPSRQQTIGNQIVVDRKTGTLYDFFDLIQPPFSAAAGKVAFI
FT                   KSTDDGATWTKPQIVSGLQTVSVTDPNTNEPVRTGDIIPEPAIDPATGQLYVVWQDSRF
FT                   NGGLYDEIALSTSSDGGATWSAPLRVNTPSGRPAFNPSVRVNSAGVVAVTYYDFRDLQP
FT                   GNTTTLPTHYWRTLSSDGGRTFGTERRIAGPFDMRTAPVAEGFFIGDYAGLDTRGTSFL
FT                   PFFVQTNSGNTANRTDVFAAP"
FT   gene            175859..176140
FT                   /locus_tag="BMA10247_A0205"
FT   CDS_pept        175859..176140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0205"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01925"
FT                   /protein_id="ABO01925.1"
FT                   /translation="MSSGRDCRIQAARARAGRPSVGTVASARPIRLGCRARLRFAVIDC
FT                   RPPPSLGSASASVRLSRFSLPPSCGGARRWRRACRESAATNASKWIAM"
FT   gene            complement(176210..176368)
FT                   /locus_tag="BMA10247_A0206"
FT   CDS_pept        complement(176210..176368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0206"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03520"
FT                   /protein_id="ABO03520.1"
FT                   /translation="MARMRARRTERRRTAAFGTPAKQRTIGISLNARHARKGSAIGNSS
FT                   ARFFQHP"
FT   gene            complement(176515..177567)
FT                   /locus_tag="BMA10247_A0207"
FT   CDS_pept        complement(176515..177567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0207"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03436"
FT                   /protein_id="ABO03436.1"
FT                   /translation="MIRAARSALAARAGRAFDLPTLGRTLAVCAPTIALYGATGDARWL
FT                   LASIATVSIAIAVERVGIAPLGALAQGAAIVAGFLSLSCALSAWPAFVAGCATLAAAAV
FT                   ALSRCGARLRSLGNFVFIPSLYLTCEAAAAHHSATRLVPYLGAAMLPAIALSGVQAWRN
FT                   APAAHRLHALARWRGARELGRPAASSDVAQAIVAVALAVAAAALLVEWHHIDNGQWAIW
FT                   SAASVVTGDAATARVKLRDRGLGALAGVPLGLAAGHALPHGALVYTLATLASVLTLVAF
FT                   RHYATGFGARCACIACASWVAQQSTAIAAERVVNVLAGGLIGIACVLATHWFATRPLTR
FT                   RHNARANRRA"
FT   gene            complement(177590..178162)
FT                   /locus_tag="BMA10247_A0208"
FT   CDS_pept        complement(177590..178162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0208"
FT                   /product="isochorismatase family protein"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02830"
FT                   /protein_id="ABO02830.1"
FT                   /translation="MNTALIGLDYIVDIMHPTGKIARSAAHAAQRDVVGRFNRALAAAK
FT                   QKDWLRIGVKVGFEPGYADLPAHSPMFGRAQAFGALDLSGAGTAFHPDLDAAAFQLVVV
FT                   KPRVSAFYATRLEAALRARRIERVIVAGVSTAWAVQAAARDAHDRDYEVLVLEDACAAA
FT                   TEDEHQRSIHTLRGIARIVTLDDLAAL"
FT   gene            complement(178159..178644)
FT                   /locus_tag="BMA10247_A0209"
FT   CDS_pept        complement(178159..178644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0209"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02616"
FT                   /protein_id="ABO02616.1"
FT                   /translation="MITSHHLQQASRLRGQVTALNRRLRREAQADPVQFSQLVVLGAID
FT                   RLGGDVTPSALASAERMRSSNLAALLRELEGGGLIQRHADPADGRKSRVSLTASGKRML
FT                   YGNRAKREEWLVRAMHACLTAGERELLAAAGPLLERLAQFDEAAGAASPAPSPRSSR"
FT   gene            complement(178846..178983)
FT                   /locus_tag="BMA10247_A0210"
FT   CDS_pept        complement(178846..178983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0210"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03157"
FT                   /protein_id="ABO03157.1"
FT                   /translation="MHAAFERFKRRMAVRGAALHRERSAARSIAPIVFDEKTVNDKLAK
FT                   "
FT   gene            178978..179925
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0211"
FT                   /note="carboxylesterase family protein; this gene contains
FT                   a frame shift which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF07859"
FT   gene            complement(179969..180763)
FT                   /gene="benD"
FT                   /locus_tag="BMA10247_A0212"
FT   CDS_pept        complement(179969..180763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="benD"
FT                   /locus_tag="BMA10247_A0212"
FT                   /product="1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate
FT                   dehydrogenase"
FT                   /EC_number="1.3.1.25"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02069"
FT                   /protein_id="ABO02069.1"
FT                   /translation="MNTHHAPGRFSGKVTIVTGAAQGIGRGVARRAAREGATAVLVDRA
FT                   DLVHEAAADIVAAGGRALAVVADLETYAGAEAMARAAVDAFGSIDVLVNNVGGTIWTRP
FT                   FDRYEAAQIEAEIRRSLFPTLWCCRAVLPGMIARGGGAIVNVSSIATRSVHRVPYAAAK
FT                   GGVNALTASLAFEHAAHGVRVNAVAAGGTDAPPRKVPRNTEPQGDDDARWYRAIVDQTL
FT                   SSSLMHRYGTIDEQVTAILFLASDEASYITGSVLPVGGGDQG"
FT   gene            complement(180760..181779)
FT                   /gene="benC"
FT                   /locus_tag="BMA10247_A0213"
FT   CDS_pept        complement(180760..181779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="benC"
FT                   /locus_tag="BMA10247_A0213"
FT                   /product="benzoate 1,2 dioxygenase, electron transfer
FT                   component"
FT                   /EC_number="1.14.12.10"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF00175; match to protein
FT                   family HMM PF00970; match to protein family HMM PF08021"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01687"
FT                   /protein_id="ABO01687.1"
FT                   /translation="MEHRIALQFEDGVTRFIACRDGETLADAAYRQQINLPLDCRDGAC
FT                   GTCRCRCESGDYALPASSYIEDALTANEAAQRYVLACQTRPRSDCVIDVPASSAACKTG
FT                   AARHEGTLASVERLSASTIHFSIDVDEPAKLAFLAGQYVNVEIPGLGATRSYSFSSRPG
FT                   DARVSFLVRNVPGGRMSRYLTDEAAPGQRIAFSGPHGSFYLRDAARPALFLAGGTGIAP
FT                   FLSMLDVCASRDGAPPVRLVYGVTRDDDLVALERLGDVERRLAGFAYRTCVADEASAHP
FT                   RKGYVSAHVEPEWLNGGDVDIYLCGPAPMVDAVQAWLRERGVTPANLYFEKFSSSNAP"
FT   gene            complement(181823..182314)
FT                   /gene="benB"
FT                   /locus_tag="BMA10247_A0214"
FT   CDS_pept        complement(181823..182314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="benB"
FT                   /locus_tag="BMA10247_A0214"
FT                   /product="benzoate 1,2-dioxygenase beta subunit"
FT                   /EC_number="1.14.12.10"
FT                   /note="identified by match to protein family HMM PF00866;
FT                   match to protein family HMM TIGR03232"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03590"
FT                   /protein_id="ABO03590.1"
FT                   /translation="MKTIDLADIQAFLYRESRLLDDKAWDAWLDCYRADAVFWMPSWDD
FT                   ADALVTDPQREISLIYYPNRQGLEDRVFRIKTERSSATVPDTRTSHNIANVERESADGD
FT                   VHTVRFNWHTLSYRYKTVSSYFGMSRYAIDFSGDAPKIVSKYVVLKNDYINQLIDIYHI
FT                   "
FT   gene            complement(182311..183678)
FT                   /gene="benA"
FT                   /locus_tag="BMA10247_A0215"
FT   CDS_pept        complement(182311..183678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="benA"
FT                   /locus_tag="BMA10247_A0215"
FT                   /product="benzoate 1,2-dioxygenase, alpha subunit"
FT                   /EC_number="1.14.12.10"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM PF00848; match to protein
FT                   family HMM TIGR03229"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02943"
FT                   /protein_id="ABO02943.1"
FT                   /translation="MIPIDPDRRATPRPIDDFLVEDKARGDYRLHRSAFTDEMLFELEM
FT                   KHIFEGNWIYLAHESQLPNANDYYTTTIGRQPIVIARNRHGELNAFVNACTHRGAMLCR
FT                   HKRGNRASYTCPFHGWTFSNGGKLLKVKDPEGAGYPDCFNRDGSHDLKKVARFENYRGF
FT                   LFGSLNPEVEPLAAHLGDAARIIDMIVDQSADGLEVLRGSSTYTYEGNWKLTAENGADG
FT                   YHVSAVHWNYAATVNHRKTDAQHEDTIRAMDAGNWGRQGGGFYAFDHGHMLLWTRWANP
FT                   EDRPNFDRRDEFAARCGGDVADWMIRNSRNLCLYPNVYLMDQFGSQIRVLRPLAVDRTE
FT                   VTIYCIAPKGEAPDARARRIRQYEDFFNVSGMATPDDLEEFRACQQGYAGRAVEWNDMC
FT                   RGASHWIEGPDEAARRIGIRPLMSGVKTEDEGLYTVQHRYWIATMKQALAAERSGA"
FT   gene            183896..184816
FT                   /gene="benM"
FT                   /locus_tag="BMA10247_A0216"
FT   CDS_pept        183896..184816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="benM"
FT                   /locus_tag="BMA10247_A0216"
FT                   /product="ben operon transcriptional regulator BenM"
FT                   /note="identified by similarity to GP:23491546; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02570"
FT                   /protein_id="ABO02570.1"
FT                   /translation="MKMELRHLRYFVAVAEEQNFTRAAERLHIAQPPLSRQIQQLEEAL
FT                   GVTLFERHARPLKMTDAGRFFYSHAVQLLAQTAELEAMTKRVGKIERALSVGFVGSTLY
FT                   GMLPRIIRRFRAEHGEVELSLHEMSTMDQIQALKDGRIDVGFGRIRHEDARVRRVVLRE
FT                   ERMIVALPDGHPLEAAKPVLSLHDLVNETLIIFPKSPRPSYADQVLAAFHDRALKPRRI
FT                   YETRELQIALGLVAAGEGVSVVPHSVYGLKRDDVGYKELDDPNLVSPIIMSTRMLDESG
FT                   DIRAMLELIYRLYDEFKMTYLPPHG"
FT   gene            complement(184994..186031)
FT                   /locus_tag="BMA10247_A0217"
FT   CDS_pept        complement(184994..186031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01767"
FT                   /protein_id="ABO01767.1"
FT                   /translation="MQNAPVDHVREQAMANLDMALVVGAAGGIGGEMVRALRGAGWRVR
FT                   ALARSAPPGDGAADIDWRLGDASNPHDVAEAARGCAAIVHAVNPPGYRRWSEWVLPMLE
FT                   NTIAAAKRERATIVLPGTVYNYGPDAGGLLREDSPQRPLTRKGAIRVEMERRLRDATEA
FT                   GARVLIVRAGDFFGPGARNNWFSQGLVKPGRPVRTVRAPGRAGVGHQWAYLPDVAQAMV
FT                   ELLARRDALDAFSCFHLAGHWDADGTRMSAAIRAAAARRSGVEPRVAAFPWWLVTLASP
FT                   FVETLREMREMRYLWREAVRLDNARLVAALGREPHTPLEAAVETTLDALGCLNGRASRA
FT                   APSVR"
FT   gene            186087..187034
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0218"
FT                   /note="transcriptional regulator, LysR family, authentic
FT                   point mutation; this gene contains a premature stop which
FT                   is not the result of sequencing error; identified by match
FT                   to protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT   gene            complement(186988..188040)
FT                   /locus_tag="BMA10247_A0219"
FT   CDS_pept        complement(186988..188040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0219"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02793"
FT                   /protein_id="ABO02793.1"
FT                   /translation="MTRRSTKDNLGLRRPTIPVAYLRHLLTVFEERGIDARDARAGTGL
FT                   RDDVLGEPDARIAPSQWGRLVLNAIRLSGDEGIGFELGLRLRMSVHGFLGYAALTAADL
FT                   RASLLVNARYFRMRNRQYRLHYAERDDGATLSLHGVQASPVLQHHAMFEIVLTGIAQNV
FT                   GTVAGRADPPIELQFAWPEPDYYARYRDRLPPVRFGCAANAVWVSRDALDWPLPLADDV
FT                   AHRQALAQVEREYADVRHEEGDLVARVRAELTLTAHGYPGPDALARRLLMSTRTLRRRL
FT                   LDAGCGYRALVDEARLRDARRLLRASDLDLKTIAARLQFNDPANFTRAFRKWTGLTPSA
FT                   YREAGGGDER"
FT   gene            complement(188037..188210)
FT                   /locus_tag="BMA10247_A0221"
FT   CDS_pept        complement(188037..188210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0221"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01727"
FT                   /protein_id="ABO01727.1"
FT                   /translation="MRKWSRHRVSRAWESSGSSATSYARAPLVREGANSHNACHLWPIL
FT                   AIPSHFETSAAR"
FT   gene            188190..190223
FT                   /locus_tag="BMA10247_A0222"
FT   CDS_pept        188190..190223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0222"
FT                   /product="FAD/FMN-binding/pyridine nucleotide-disulphide
FT                   domain oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF00724; match to protein
FT                   family HMM PF03486; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03846"
FT                   /protein_id="ABO03846.1"
FT                   /translation="MTTPFPHLLAPLDLGFTTLRNRVLMGSMHTGLEDSRKTLPRLADY
FT                   FAERARGGVGLIVTGGFAPNVAGWTKPFGGTLSTGAAARRHRVIPDAVHAHGGKIALQI
FT                   LHTGRYGYHPFAVAPTRLKSPISPFTPHELSARGIERQIRAFVRCAQLAREAGYDGVEI
FT                   MGSEGYLINQFISLHTNKRTDEWGGSYANRMRLPVEIVERTREAVGRDFIIVYRLSMLD
FT                   LIPDGSNWDEVVLLAKAVERAGATIINTGIGWHEARVPTIATSVPRGAFAWVTKKMKGE
FT                   VGIPLVTTNRINRPEIAEQILADGCADMVSMARPFLADAEFVKKAAEGRVDEINTCIGC
FT                   NQACLDHAFKNQIASCLLNPRACHETELNYTRAASAKRVAVIGAGPAGLACATVLAQRG
FT                   HRVELFDAAAEIGGQFNMAKRIPGKEEFHEALRYFARQIELAGVQLRLNRRVDAAELIA
FT                   AGYDDVVLATGVAPRNPRIPGQDHPKVLTYIDVLARNKPVGERVAVIGAGGIGFDVSEF
FT                   LVQDGESPALDLDAWKAEWGVTDPALARGGVVRGEVAPPARRVTLLQRKATGLGKGLGK
FT                   TTGWIHRATLKMKQVEMIGGVNYELIDDKGLHVTFGKERRDPTVIEADTIVLCAGQEPE
FT                   RALYEPLKAAGVPVHLIGGAELAAELDAKRAIDQGARLAARL"
FT   gene            190241..190696
FT                   /locus_tag="BMA10247_A0223"
FT   CDS_pept        190241..190696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02775"
FT                   /protein_id="ABO02775.1"
FT                   /translation="MACGGVKLVRSSRVRAARGAGSGVRVDDRSRGARASAFIRARRGP
FT                   LRRRRVRRPAATLAEADDMTQAAASRARRRRSLRCRPFRCGSALQCAAQSAALRAEIGI
FT                   VSCVAVAPDAGNRRRRARAGGARCARRVEPLTHAWSVVNRAPRRVGA"
FT   gene            190728..190877
FT                   /locus_tag="BMA10247_A0224"
FT   CDS_pept        190728..190877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0224"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02459"
FT                   /protein_id="ABO02459.1"
FT                   /translation="MRVRAHTRAAHLPAWPKHIPPMLWHRVAPLFSAKMICLIDGFSSR
FT                   SPAV"
FT   gene            190948..191835
FT                   /gene="cyoA-2"
FT                   /locus_tag="BMA10247_A0225"
FT   CDS_pept        190948..191835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA-2"
FT                   /locus_tag="BMA10247_A0225"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF00116;
FT                   match to protein family HMM PF06481; match to protein
FT                   family HMM TIGR01433"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02087"
FT                   /protein_id="ABO02087.1"
FT                   /translation="MNRKAFRSLSWFGAIGALASLSGCGLDVLDPKGAVGAAEKSLIAT
FT                   STWAMLIVVVPVILLTLLFAWRYRASNRNATYAPKWAHSTAIEIVIWTVPSLIILFLGI
FT                   LTWKTTHALDPYRPLESAVKPIDVEVVALDWKWLFVYPDLGIASVNQLAVPVGTPINFR
FT                   ITSDSVMNSFFIPQLGTQVYAMAGMQTRLHLIADEPGDFAGISANYSGRGFSDMKFRTL
FT                   ATSRDAFDAWVAKVRASADRLDMTAYGQLAQPSEKQPVRYYSTVDPRLFNNIIAKYNDG
FT                   RVLDLTDAACRTKR"
FT   gene            191838..193844
FT                   /gene="cyoB"
FT                   /locus_tag="BMA10247_A0226"
FT   CDS_pept        191838..193844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="BMA10247_A0226"
FT                   /product="ubiquinol oxidase, subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF00115;
FT                   match to protein family HMM TIGR02843"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01713"
FT                   /protein_id="ABO01713.1"
FT                   /translation="MFGKLTLSAIPFDQPIIMGAGAFMALVVLGILGALTYTKRWKWLW
FT                   CEWLTTVDHKKLGVMYIIVALIMLLRGFADAVMMRLQLALAYNGPGYLPPHHYDQIFTA
FT                   HGVIMIFFMAMAFMIGLMNIIVPLQIGARDVAFPFINSLSFWMTAVSAILINISLVVGE
FT                   FAQTGWLAYPPLSELQFSPGVGVDYYLWALQISGVGTLLTGVNFFVTILRMRAPGMTLM
FT                   KMPVFTWTALCTNVLIMASFPILTVTLALLGLDRYLGMHFFTNDAGGNAMLYLNLIWAW
FT                   GHPEVYILILPAFGIFSEVVATYAKKPLFGYKTMVYASCAIMVLSFLVWLHHFFTMGSG
FT                   ANVNAFFGMMTMVIAIPTGVKVFNWLFTIYRGRLEFSTPILWTIGFMVTFTLGGMTGVM
FT                   MAIPGADFVLHNSLFLIAHFHNVIIGGVLFGYLAGFNYWFPKVFGFKLNETLGKAAFWF
FT                   WQVGFYVAFVPLYVLGFMGMTRRLNHYDNPAWHPWLIVAACGAALIAIGIACQLLQLAV
FT                   SLRDRRLPENRDPTGDPWGGRTLEWATASPPPAYNFATIPTVHALDEFAYRKERGLGIG
FT                   KPAEYRDIHMPSNTSAGLFVGVFSLVLGFAAVWHIWWLAIAALAGILVTVIAYSAGEND
FT                   GYYIPADAVRRIEEKRGGARFVARPAQVELEAN"
FT   gene            193844..194452
FT                   /gene="cyoC"
FT                   /locus_tag="BMA10247_A0227"
FT   CDS_pept        193844..194452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="BMA10247_A0227"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by similarity to SP:P18402; match to
FT                   protein family HMM PF00510; match to protein family HMM
FT                   TIGR02842"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02431"
FT                   /protein_id="ABO02431.2"
FT                   /translation="MSYPSVSAAPRHAAHDHPPSHSVFGFWLYLMTDCVIFAALFAVFA
FT                   VMAHQFAGGPTAVDLFDIPGVALETALLLVSSITYGFAMIGAQRGRRGALFGWLAVTFV
FT                   LGAAFLGLELREFSQMIAEGAGPQRSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALR
FT                   RPALTERDIRRLTCLSLFWHFLDIVWICVFSFVYLASVI"
FT   gene            194453..194785
FT                   /gene="cyoD-2"
FT                   /locus_tag="BMA10247_A0228"
FT   CDS_pept        194453..194785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD-2"
FT                   /locus_tag="BMA10247_A0228"
FT                   /product="cytochrome o ubiquinol oxidase, subunit IV"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF03626;
FT                   match to protein family HMM TIGR02847"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02697"
FT                   /protein_id="ABO02697.1"
FT                   /translation="MADMHLSHDGEAHGTVGGYLAGFILSVLLTAASFGLVLSGALSSH
FT                   ASLIALAVLAFVQIVVHLVYFLHMNGSSSQRWNVMAFSYTVLTAAILIVGTLWVMHNVG
FT                   MNMMSR"
FT   gene            complement(194905..195195)
FT                   /gene="catC"
FT                   /locus_tag="BMA10247_A0229"
FT   CDS_pept        complement(194905..195195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catC"
FT                   /locus_tag="BMA10247_A0229"
FT                   /product="muconolactone delta-isomerase"
FT                   /EC_number="5.3.3.4"
FT                   /note="identified by match to protein family HMM PF02426;
FT                   match to protein family HMM TIGR03221"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03484"
FT                   /protein_id="ABO03484.1"
FT                   /translation="MLFHVEMTVNLPVDIDPVKAAALKAEEKEIAQRLQREGVWRHLWR
FT                   VAGRYANVSVFDVESPAHLHDVLSQLPLFPYMQIDVRALCRHPSSIHDDDR"
FT   gene            complement(195233..196135)
FT                   /gene="catA"
FT                   /locus_tag="BMA10247_A0230"
FT   CDS_pept        complement(195233..196135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catA"
FT                   /locus_tag="BMA10247_A0230"
FT                   /product="catechol 1,2-dioxygenase"
FT                   /EC_number="1.13.11.1"
FT                   /note="identified by match to protein family HMM PF00775;
FT                   match to protein family HMM PF04444; match to protein
FT                   family HMM TIGR02439"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03347"
FT                   /protein_id="ABO03347.1"
FT                   /translation="MNKEAIDALLKSFDDAATRPGNPRVRAIVNRIVKDLFYTIEDFDV
FT                   QPSEFWTALNYLNDAGKEFGLIAAGLGFERFLDVRMDEAEAKAGLQGGTPRTIEGPLYV
FT                   AGAPESVGHARLDDGTDPGETLVMRGRVLGGNGAPLANALVEVWHANHLGNYSYFDPSQ
FT                   PVFNLRRSIRTDAEGRYSFRSVLPVGYSVPPGSKTEQLLDQLGRHGHRPAHIHFFVSAP
FT                   GHRKLTTQINIEGDPHIWDDFAFATREGLIPKIAQAEGAQGKPYGIDGRFALIDFDFTL
FT                   TRERGDVPASEVERVRPQA"
FT   gene            complement(196170..197303)
FT                   /gene="catB"
FT                   /locus_tag="BMA10247_A0231"
FT   CDS_pept        complement(196170..197303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catB"
FT                   /locus_tag="BMA10247_A0231"
FT                   /product="muconate cycloisomerase"
FT                   /EC_number="5.5.1.1"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746; match to protein
FT                   family HMM TIGR02534"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02491"
FT                   /protein_id="ABO02491.1"
FT                   /translation="MIATGITIDRIDTLLVDVPTVRPHKLSVATMNCQTLVLVRVRCSD
FT                   GIEGVGEGTTIGGLAYGEESPESIKTNIDAYFAPMLRGADASRPGAAMARVRKLLQGNR
FT                   FAKCALETALFDAHARRLGVPLSELLGGRTTDALDVAWTLASGDTARDIAEAEAMLEAR
FT                   RHRAFKLKIGARAVAEDVAHVVAIKRALGERGDVRVDVNQAWTESEAVWAGARLADAGV
FT                   SLVEQPIAAANRAGLKRLTALAHIPIMADEALHGPVDAFALARERAADVFAVKIAQSGG
FT                   LQGAAAVAAIAAAAGIELYGGTMLEGAAGTIASAQLFSTFGALEWGTELFGPLLLTEEI
FT                   LVEPLRYEDFKLHLPSAPGLGIAFDWARIERMQRRAR"
FT   gene            197393..198280
FT                   /gene="catR"
FT                   /locus_tag="BMA10247_A0232"
FT   CDS_pept        197393..198280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catR"
FT                   /locus_tag="BMA10247_A0232"
FT                   /product="cat operon transcriptional activator CatR"
FT                   /note="identified by similarity to SP:P20667; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02161"
FT                   /protein_id="ABO02161.1"
FT                   /translation="MELRQLRYFIAVAEEMNITRAAQRLHMTQPPLSRQLQLIEDEIGL
FT                   PLFERGARPLKLTDAGRVLYAQARRVLEQADELAPLTRRLAQAAERIVIGFVPSTLYGA
FT                   LPEVIRAFREAAPAVELSLIEMFTLEQLGALKGGRIDIGFGRLRFDDDRLVREVLVEER
FT                   LIAALPDGHPLAAPDASISLADIAGQTLIVYPSTPRPSFADQQLSALRDGGLAPVAVHE
FT                   VRELQTALGLVAAQVGVSLVPESVEGVRVKGVVYRRLPEPVATSPIILSRRLHDESRAT
FT                   ALFCSLARKLMAGH"
FT   gene            complement(198330..199334)
FT                   /locus_tag="BMA10247_A0233"
FT   CDS_pept        complement(198330..199334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0233"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03861"
FT                   /protein_id="ABO03861.1"
FT                   /translation="MFRTPALCARQTIMPPTPFDPLALREHRLFESRDLDETRERISRV
FT                   MQPHALLPDGSRHGPSHMDYVRLGGLGIGTIAFGDAMRVHLDAVDGYHLLMFCLTGSAQ
FT                   VRTMGRAFDVDAHTGVLCAPGEPFDAHLSRDCEQFVLRIDAATLAAHAGDAAAALDPVI
FT                   GIDDSALSAWMQQLQLVARSPELLASASANPRVATRLEQLLLDLLIDGHPPAAPPARRA
FT                   DPAPGFVRRAQEFIGAQLAQPLQLADIAQAAGVPERTLRDGFLQFRGTSPMQYLRQRRL
FT                   ERARELLRTAAPERRIAEIALDCGFAHFGRFAIAYRERFGELPSATLADRRDA"
FT   gene            199549..200826
FT                   /locus_tag="BMA10247_A0234"
FT   CDS_pept        199549..200826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0234"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, alpha
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM PF00848"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03054"
FT                   /protein_id="ABO03054.1"
FT                   /translation="MEMTESPVALIDRADSSDVRFPRDDGSRVPYKVFSSQAVYEREQE
FT                   RIFRGPTWNFVALEAEIPKPGDFKSTFVGDTPVVVTRGEDGALAAWVNRCAHRGAQVCR
FT                   KARGNASSHTCVYHQWSFDSRGDLLGVPFRRGQKGMAGMPADFDPKSHGLRKLRVDSYK
FT                   GLVFATFSDEVAPLPDYLGAQMRPWIDRIFHKPIEYLGCTRQFSKSNWKLYFENVKDPY
FT                   HASMLHLFHTTFNIFRVGMKARSIPDATHGLHSIITMTKTRDDADTASAYKQQNIRSFD
FT                   EGFSLEDDSILGLVSEYDEDTTNHIQPIFPQLVIQQIHNTLVARQLLPKGPKNFELIFH
FT                   FFGYADDTPELRDLRIKQANLVGPAGYISMEDTEATELVQRGTVRDANAASVIEMSRGN
FT                   PDQQDTAITESLIRRFWVGYQQLMGY"
FT   gene            200823..201338
FT                   /locus_tag="BMA10247_A0235"
FT   CDS_pept        200823..201338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0235"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00866"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02155"
FT                   /protein_id="ABO02155.1"
FT                   /translation="MKRETNMTDITDGLTGDIRTWFELHMLQNRYIGHLDNDRLERWPE
FT                   LFTEDCLYEIVPKENADLGLPIGIVYCTNRRMLRDRVVSLRHANIYEAHTYRHMTSGLT
FT                   IVGGEGGEIETESSYVVVQTRSDGESNVYQAGKYYDTVVRTAEGLRYRKKRVIYDTSRV
FT                   QTLLATPI"
FT   gene            201360..201689
FT                   /locus_tag="BMA10247_A0236"
FT   CDS_pept        201360..201689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0236"
FT                   /product="aromatic-ring-hydroxylating dioxygenase,
FT                   ferredoxin subunit"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01968"
FT                   /protein_id="ABO01968.1"
FT                   /translation="MSNETAAAWHTLGALDEFSEDEPAARVVGNKPIAVFRVGDDVFAL
FT                   HDLCTHGHARLSEGFVENGCVECPLHQGLFDLRTGAPKCAPVTQPVRAYPIRIVDGQVE
FT                   IHVDG"
FT   gene            201676..202917
FT                   /locus_tag="BMA10247_A0237"
FT   CDS_pept        201676..202917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0237"
FT                   /product="aromatic-ring-hydroxylating dioxygenase,
FT                   ferredoxin reductase subunit"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03250"
FT                   /protein_id="ABO03250.1"
FT                   /translation="MSTADPYLIAGGGHAARRAAETLRERDPAARIVMIGAEPELPYDR
FT                   PVLSKEALVGGDAGERRAFVRDAAWYRERDIELRLGVRVEAIERGARRVRLSDGARLGY
FT                   ARLLIATGSRVRRFAGPVDAGVHVHYVRTLADTRALRAALAPGKRVAVLGGGFIGLEVA
FT                   ASAVRLGCRATVVDPAPRLLQRGMPEAVGAFALALHARHGVDVRLGALPERIRRAANGA
FT                   AVVETSAGGIVADVVVAGIGVVPNVELAQAAGLDVDDGVCVDEMCRTADPAIFAAGEVT
FT                   RHFNPLVGRALRIESWQIAENQPAVAAANMLGAAETYAQWPWLWSDQYDSNLQTLGLFG
FT                   GEQTLVLRGSPERDRAFCVFALNARRELAAVAAVNAGREIAVCRRLMTAGVALDPARLA
FT                   DPSDALRAMLPRGV"
FT   gene            203122..203538
FT                   /locus_tag="BMA10247_A0238"
FT   CDS_pept        203122..203538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0238"
FT                   /product="HIT family protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03580"
FT                   /protein_id="ABO03580.1"
FT                   /translation="MAYDQSNIFAKILRGEVPCIRLCETDTTLAFMDIMPQSRGHALVV
FT                   PKEAAETFYELSEAAAAEAMKMTKRVALALRRTLEPEGLFIGQFNGAAAGQTVPHVHFH
FT                   VIPRWADEPLKMHAREMADAAELEALAARIRTAL"
FT   gene            complement(203605..205257)
FT                   /locus_tag="BMA10247_A0239"
FT   CDS_pept        complement(203605..205257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0239"
FT                   /product="putative phospholipase D"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02109"
FT                   /protein_id="ABO02109.1"
FT                   /translation="MPDRPALRGLAPRHPPRIVKAAARALVLCAALALSGCATHPPATT
FT                   LERTVSHALPPDASTPLADALAVQARAHPGESGFVVLPRGDEALQMRIAVARAATKTLD
FT                   IQYYIAAEDTTGKLLLGAALYAADRGVRVRMLVDALNFKDIDKLMAALDAHANLEVRVF
FT                   NPFGAPRLGMFARTANVFTRIDNFTRRMHNKAMISDNQIAIVGGRNLGDEYFNASPTLQ
FT                   FRDLDVLAAGPVTRAVSASFDAYWSSALTYPLPALNRRRYDAKDLDAARDALRAHWRAN
FT                   ATPYNAKPLNATPLAAQIARNELGLVWASAEFTADSPEKIAAPDDSYKSPPMQRLFALT
FT                   RDAQREFLVLSPYFVPHDAGVNALGRLTARGVRVAILTNSLAATDAIAVQAGYAPYRVP
FT                   MLERGVELYEYKPDPGRSRIGMLGSRSRASLHAKAYVIDRKILVIGSMNLDPRSAHLNT
FT                   ELALVIHSPRLANEVANLFDEVTKPTISYRVTLAPDTPGAAQTTGAGAPAWPLVWTEIA
FT                   DGQVRTYSVDPNAGFYRNLLTGLCLLLPIDDQL"
FT   gene            205216..205341
FT                   /locus_tag="BMA10247_A0240"
FT   CDS_pept        205216..205341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0240"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02675"
FT                   /protein_id="ABO02675.1"
FT                   /translation="MARRETAEGGAIRHVGTPSGIGRNETSNRRRGRPVHRAKAF"
FT   gene            complement(205361..205645)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0241"
FT                   /note="rex protein; this gene contains a frame shift which
FT                   may be the result of a sequencing error"
FT   gene            205703..205957
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0242"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            205950..207425
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0243"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF04286"
FT   gene            207485..209065
FT                   /locus_tag="BMA10247_A0244"
FT   CDS_pept        207485..209065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0244"
FT                   /product="Na+/H+ antiporter"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM TIGR00831"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01614"
FT                   /protein_id="ABO01614.1"
FT                   /translation="MSPVSAFKLVLLSFLAIVALELLAKRLRLPPAAALLVGGAGIAFL
FT                   PGLPPVNLDPDLVLIVFLPPLLMDGAYFSVWEEFKRNVGGIMMLAIGAVAFTTLAVGVA
FT                   VHLVAPGLPWAACFALGAIVSPPDAVAAKAVLERVALPRRLMVLLEGESLLNDAAGLVL
FT                   FRFAVAAALTGAFSTGDAVVRFAQLGVGGVAVGFIVGWLIVRFLKLVEDDYLVITVAVL
FT                   AAWISYIAGELFEVSGVIATVTTGMMLGWHQHEVFSASVRNRGTAFWQVIVFLLEALVF
FT                   VLIGLSLRGVIERLGGLGEVFATMTPAVAAVVAAVVASRFVWVFAVELLKAPVARLRGR
FT                   GPRGDWKAATVMGWAGMRGVVTLAIALSLPDAMPGRDLILVAAFAVILVTVLLQGTTIG
FT                   PLIRLLKLRDPGPAAHHLTEPQTWARVEAAQLSAIQPLVHDAEGNVIHPRLLEQYTYRA
FT                   SVTARHQDEPAFPQRERDAHYDVVLAAIAAGRAELLRLHRGGQIHDEMLYLLERDLDLQ
FT                   EIAAQHAKG"
FT   gene            complement(209148..209324)
FT                   /locus_tag="BMA10247_A0245"
FT   CDS_pept        complement(209148..209324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0245"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03598"
FT                   /protein_id="ABO03598.1"
FT                   /translation="MSDARAGLRRARAFFPSTDKSNGKRCEPTAAVRGDARRDPLRPAR
FT                   DGAPAAGRLFDCR"
FT   gene            209373..211013
FT                   /locus_tag="BMA10247_A0246"
FT   CDS_pept        209373..211013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0246"
FT                   /product="putative acetolactate synthase"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03028"
FT                   /protein_id="ABO03028.1"
FT                   /translation="MKASDLFVKALEAEGVQYVFGIPGEENLDLLESLRRSRIKLVLTR
FT                   HEQAAGFMAATYGRLTGKTGVCLATLGPGATNFVTAAAYAQLGGMPMLMITGQKPIKSS
FT                   KQGHFQIVDVVGMMQPLTKLTRQIVSIGNIPSAVREAFRRAEEERPGATHLELPEDIAH
FT                   EEGDGKPIPASYSRRPIAEEKALARAVDAIQAARHPLLMIGAGGNRKTTCRMLKEFVDT
FT                   TGIPFFTTQMGKGVIDETHPLWLGNATLSDGDFVHRAIEHADCIVNVGHDVIEKPPFFM
FT                   RADDKTVIHVNFLGAQVDPVYFPQIEVVGDIANAVWQMKEKLARQPHWDFSRFMLIKAH
FT                   FDAHLKKGQDDPRFPMYPVRIVNDLYRSLPEDGIVCLDNGMYKIWFARYWRAHEPNSLL
FT                   LDNALASMGAGLPSAIATKIVHPQRKVIAVCGDGGFMMNSQELETAVRLKLDLVVMILR
FT                   DDAFGMIRWKQENMNFPDYAMTLANPDFVAYAQSYGAHGHRIASADALEPLVRECFASP
FT                   GVHLIDVPIDYSDNERVLNREIKRLSAQL"
FT   gene            211105..212538
FT                   /locus_tag="BMA10247_A0247"
FT   CDS_pept        211105..212538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0247"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03734"
FT                   /protein_id="ABO03734.1"
FT                   /translation="MLKETYPYYLANEAVYANTGLEVTDKYSGKVATRVALADARAIDA
FT                   AIAAAVAAQRPLRALPAFRRQAILEHCVAHFRERFDELAEALCIEAGKPINDSKGEVTR
FT                   LIDTFRVAAEESVRIEGGLVNLEISPRAQGYSGYYRRVPIGPCSFISPFNFPLNLAAHK
FT                   VAPALAAGCPFVLKPASRTPIGALIIGEVLAQTDLPKGAFSILPAHRDGADLFTTDERF
FT                   KLLSFTGSPAVGWELKKRAGKKKVVLELGGNAAAIVDADQRDRLDYVVDRLAFGAYYQS
FT                   GQSCIGVQRIIAHADLYDALREKLIAKTRSLKMGDPKDPATFVGPMISEAEARRLAGWM
FT                   DAAVAAGARIIAGGNVDGAMFEATLLEGVGRDQDLYRKEAFGPVALLERFADFDDALAR
FT                   VNDSDFGLQAGVFTDSLSHAQRAWDELEVGGVVINDVPSFRVDNMPYGGVKDSGLGREG
FT                   IRYAIEDMTELRLMVVRQR"
FT   gene            complement(212705..212854)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0248"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(212818..212964)
FT                   /locus_tag="BMA10247_A0249"
FT   CDS_pept        complement(212818..212964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02228"
FT                   /protein_id="ABO02228.1"
FT                   /translation="MVATFAPFLGERRAALGLEFEFGFRKALAAGDTVTMTWRSLRSSR
FT                   ARS"
FT   gene            212986..213222
FT                   /locus_tag="BMA10247_A0250"
FT   CDS_pept        212986..213222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0250"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01580"
FT                   /protein_id="ABO01580.1"
FT                   /translation="MRAADDPPAESRRFGERFVVMQRIHAACERRESAHGIHVEGDYFR
FT                   DSFVNAATRIHGGAVNNWIRKRYARFKRNSHEY"
FT   gene            213270..213719
FT                   /locus_tag="BMA10247_A0251"
FT   CDS_pept        213270..213719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0251"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03619"
FT                   /protein_id="ABO03619.1"
FT                   /translation="MARDARNVRDCTAGRPAARDVGIGVDRLSPTDQTVEPGSRAGGRR
FT                   GFAPAARAADRHGDARGMPAANTRPASVACRLRGGRPRTCAHMRRSGMTKTFAFLHLAA
FT                   YARAIDKSDCGGQITYCAEAIARRAYPAHCGNRIRRIVPIRVFSG"
FT   gene            213969..215066
FT                   /locus_tag="BMA10247_A0252"
FT   CDS_pept        213969..215066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0252"
FT                   /product="response regulator/sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02931"
FT                   /protein_id="ABO02931.1"
FT                   /translation="MMNKTNRDNASDSLESGISVLLVDDQAFVGEVIRRSLVPESDIVL
FT                   HTCTDAQRALAMAKEVKPTVILQDLVMPDIDGLELVRAWRADAQTARVPIIVLSAKEEP
FT                   AVKRAAFVAGANDYLVKLPDTIELIARIRYHSNSYLMLRQRDEVLDFLSHDMRTPQTSI
FT                   LALLDVYRNEHGAMPPILERIETHARRALALADGFIHLTRAQSEKRPSETVSLNEVVLD
FT                   AVDQMWEKAGSVGSRVRADVPPTECLCIGDRMMLTRAVANLVDNALKYGPGGSEVRCTL
FT                   VEDGDGWLIGVEDEGAGIAPDQRAAATESFVRLVPAGGAQRGGFGLGLAFVRATAAKHR
FT                   GQILMRYTPRGFLAGLRIPKDVSAA"
FT   gene            215063..215230
FT                   /locus_tag="BMA10247_A0253"
FT   CDS_pept        215063..215230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0253"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03155"
FT                   /protein_id="ABO03155.1"
FT                   /translation="MTRGGSAAGARRPLFVHDGSSYTRDARGAHRAGADGTIRPVRRAP
FT                   LHSPDFPPAG"
FT   gene            215273..216913
FT                   /locus_tag="BMA10247_A0254"
FT   CDS_pept        215273..216913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0254"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02420"
FT                   /protein_id="ABO02420.1"
FT                   /translation="MRKSAAGSRLTLGNRILFSFGVLFVLMLFMAALSYQRLRAINDEA
FT                   ISIERDSLPGVYLASSLRASANESYIVLQRAVFVDAEAEAVQRDLAKVPGLLEEFDKLS
FT                   SAYQASTFRSDDQERFNAFRAAYERYLPLLNDAVQKARGARPDALAAYARVTPAWEEVI
FT                   RHANVLVQENRRFADQSATLIRESVHGTEITLAVALGVVLVVALMLGYLLHRAVTVPMA
FT                   RLIDVHDVMRTGNLTQRLNLGRSDEFGTLESGFNRMADELTALVAQAQQSSLQVTTSVA
FT                   EIAATSREQQATANETAATTTEIGATSREIFATSRDLLRTMNEVSAVAEQSATLAGVGQ
FT                   SGLTRMGETMRSVMDAAGSVNAKLAILNEKAININQVVATITKVADQTNLLSLNAAIEA
FT                   EKAGEYGRGFAVVATEIRRLADQTAVATYDIEQTVKEIQSAVSAGVMGMDKFSEEVRRG
FT                   MRDVQQVGGQLSQIIAEVQTLAPRFQMVNEGMQTQASGAEQITQALAQLSEAAQQTAES
FT                   LRQSSQAIDDLTLVANQLRTGVSRFKVDA"
FT   gene            216948..217466
FT                   /locus_tag="BMA10247_A0255"
FT   CDS_pept        216948..217466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0255"
FT                   /product="cheW domain protein"
FT                   /note="identified by match to protein family HMM PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02050"
FT                   /protein_id="ABO02050.1"
FT                   /translation="MLFLLFHLDGERYALDAAEIAEVLPLAATKTIPGAPAWAAGILMY
FT                   RGEPVPVIDVPRLALGRRAQPLRSTRLVLVRYRLPAAAEPAFVPPRVRLLGLIVERATQ
FT                   TARIAREAFRDSGFATPHARWLGPIASDADGVVQWVALRHIVDGEARALLFDYAASLDA
FT                   HGAPAGGGR"
FT   gene            217463..219517
FT                   /locus_tag="BMA10247_A0256"
FT   CDS_pept        217463..219517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0256"
FT                   /product="CheR methyltransferase, SAM binding/TPR domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF01739; match to protein
FT                   family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03746"
FT                   /protein_id="ABO03746.1"
FT                   /translation="MNVFDPRFHAWLSRETGIDPASLGNDFVARALAERIAATQPGAGG
FT                   EAAQAGRPQPAITDEAVDAYWQCLNASADERRALIELFVVPETWFFREREAFAALARLG
FT                   AQRLFAEPARALRILSAPCSTGEEPYSAAMALLDAGIDPSRFEIDALDISARAIAHAQR
FT                   GRYGRNSFRGHVLGFRDLHFKAAADGWVLDERVRACVRFRQANLLDLLGCAGEPYDFVF
FT                   CRNVLIYFDRDAQDRVVRIVEEQLDARGILFVGPAETGVVMRQGLASAQIPLAFAFRKP
FT                   AVEAAARPGAGGVGARRGGAAPGGAANVVNAANAANAGAAAGDRVPTFGGTLRAIAHEW
FT                   FFDAGWPTPEPIVRAIDGARSAFESFAASPASAQGATRFAPSEPRAQAGDAGERPAGIF
FT                   ARAPGAAEPGGEALARTGDAGRFATAPRANAFEAGWTAAGAFSRAPDAGRARAGLFAPA
FT                   SDAARAAHEEPFADAAGAARAAFDAPPGVSADAGRLAATARDAGAAPRASASLDHSFDT
FT                   ARPVFGTAAVAPGIAAPAFASRALSATALAGAFEADGTHAAAVDEAPLDAARRLADAGA
FT                   LDAAQQAVRASIEQSGPSAEAFYLLGLIADARGRSDEATDCYRKALYLEPTHYEALTHL
FT                   ATLLDIAGDRDGAQWLMQRARRAAQYESAASVTDTDDGEPRGTHGTRRR"
FT   gene            219498..220232
FT                   /locus_tag="BMA10247_A0257"
FT   CDS_pept        219498..220232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0257"
FT                   /product="chemotaxis protein cheW"
FT                   /note="identified by match to protein family HMM PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02480"
FT                   /protein_id="ABO02480.1"
FT                   /translation="MERDVVERPRIAFDIDACWNRIGTRGDRSCERLDTYRRCLNCPVF
FT                   ERHAALLLDRPLTDADLADAARVAAERAPGANAPASKASAAARDGDADAVHSALAFRVA
FT                   DEWLALPIRVLREITDTRAIHPLPHRRNRAVLGIVNVRGMLRVAVSLAELLSLDARADR
FT                   AAPRMSFTRMLVVAHRGDPVVFPVDEVEGVLRFASADWMPVPATVARTGAVHSRGVFAW
FT                   RGKSIGLLDEDRLFDSLTRSLR"
FT   gene            220229..222823
FT                   /locus_tag="BMA10247_A0258"
FT   CDS_pept        220229..222823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0258"
FT                   /product="putative chemotaxis sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01584; match to protein
FT                   family HMM PF01627; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03255"
FT                   /protein_id="ABO03255.1"
FT                   /translation="MSTDDDFGRASLLELFREETHTQTQALSERLLALERGAQDAATLE
FT                   ACMRAAHSLKGAARIVGVPQGVDIAGRMEDCFVAAQHGRQPLTPCHVDALLTGVDLLVR
FT                   VGDPQTAASVAPHEIDAFAAALAAADAGVEPGADARGANAYESDGNAYERGGAARASVA
FT                   AAPGEAADASRESGAREAAGPNRAGAAAGAADVRASADAGDARGASDTRDVRRTAGARG
FT                   ANRSTEVFGAGEATGIGASTHANDANGMNATNLATSAAHPPRGAFAAAHDAPPSSAPSD
FT                   APRAPSQMRRVRADTLNRLLSLSGESLVESRWLKPFAESMLRVKRAQRDAARSLDSAVE
FT                   ALADDADPRVRGALNEARQMFTDLQRTFAARLDELDRFERRSSHIAEQLYDEALQCRMR
FT                   PFGDATRAYPRVVRDLARSLGKRVRFSIVGEATQVDRDILDMLDAPLGHLLRNALDHGV
FT                   EPPEVRLARGKPAEATITLEARHSAGSLLVSVSDDGPGADLAAVRAAIVRHHLTDEDTA
FT                   ARLSDQELLEFLLLPGFSMRERVTDVSGRGVGLDAVQEMVKSVRGAVRIFNEPGLGMRF
FT                   VLQLPLTLSVIRSLIVDVGGEPYAFPLVQVRRTLELERADIDVLEGQQHFPLDDRRVGL
FT                   VTAHQLLDAGELDESRPATAVVVVGGEPETYGVEVDRFLGERMLVVQPLDGRLNKIQNI
FT                   AAGALLENGDPVLIVDVEDLIRSIDKLIRGGQLAKVRRGDRDALARRAKRVLVVDDSLT
FT                   VRELERKLLEKRGYDVTIAIDGMDGWNAIRGDAFDLVVTDIDMPRMDGIELVTLIKGDP
FT                   LLKSVPVMIVSYKDRDEDRRRGLEAGADYYLAKGGFHDEALLDAVHDLIGDA"
FT   gene            222830..223858
FT                   /locus_tag="BMA10247_A0259"
FT   CDS_pept        222830..223858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0259"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01670"
FT                   /protein_id="ABO01670.1"
FT                   /translation="MNIGIVNDLPLAVEALRRTIALRPEHRVLWVATDGAQALDFCVAQ
FT                   PPDLVLMDLVMPRIDGVSATRSIMERSPCAILIVTANVGANASYVYEAMGAGALDAVDT
FT                   PTLEQGGSADPSQPLLAKIDQIGRLLATRMPLAAPAAAAPAPQGALPPLVAIGASAGGP
FT                   TALTALLRRLPDDFPAALVIVQHVDQAFAIGMAQWLDGYSPLPVRIARQGSVPQAGEVL
FT                   LAATNDHLHLTSRGVLAYTRRPEETPYRPSVDVFFHSVVDHWKGEAIGVLLTGMGRDGA
FT                   LGLKAMRTKGHYTIAQDEATSAVYGMPKAAAAIGAASAVLPLERIADQLISLVQRNRQR
FT                   WR"
FT   gene            223961..224971
FT                   /gene="dehII-1"
FT                   /locus_tag="BMA10247_A0260"
FT   CDS_pept        223961..224971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dehII-1"
FT                   /locus_tag="BMA10247_A0260"
FT                   /product="haloacid dehalogenase, type II"
FT                   /EC_number="3.8.1.2"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01428; match to protein
FT                   family HMM TIGR01493"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02183"
FT                   /protein_id="ABO02183.1"
FT                   /translation="MRDEAGLYFSPGMQAGGSPIMSDGRGAFLSDVQARRSARGGSYGA
FT                   VLRSSPRRAPPAGARLAAAFGRARAFGVGPVRAADGGRCILKRHPTTQENIMQTLGVKA
FT                   LVFDVFGTVVDWRSGVIRDATPFLAKYGGAGADPAAFADAWRAGYSPAMEEVRSGRRPF
FT                   TRLDVLHRENLDALLPAFGIDRASVADADLDALNLAWHRLDPWPDSVAGLTRLKAHYII
FT                   APLSNGNVILMIDMAKRAGLPWDAILGAEVAQAYKPTPEAYLRTADILALRPDEVCLVA
FT                   AHNGDLAAARRCGYRTAFVARAREHGPAQTTDLRAEQDWDVVAADFIELAQRFGA"
FT   gene            225321..226604
FT                   /locus_tag="BMA10247_A0261"
FT   CDS_pept        225321..226604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0261"
FT                   /product="voltage-gated chloride channel"
FT                   /note="identified by match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03132"
FT                   /protein_id="ABO03132.1"
FT                   /translation="MKRLHAFEPVAALAHLCRWLALSAVVGALAGSASALFLWALDLAT
FT                   GTRIAHPWLLWLLPAAGFATGWVYHRVGRSVERGNNLLIDEIHDPRAIVPTRMAPLVLV
FT                   ATVVTHLFGGSAGREGTAVQMGGALADRVTQLVGLDRDARRIMLMGGIAAGFSSVFGTP
FT                   LAGAVFGLEVLAIGRLRYDALFACVAASIVADAVCRLWGVHHTVYVVPFVPAPSAAGVA
FT                   SAVAAGIAFGVVGRLFAAATHGLAALAKRRIAYPPLRPVAGGALVALAATLLHAPQYLG
FT                   LGIPTIEAAFRAPLPVYDFAGKFAFTVVTLASGFKGGEVTPLFYIGATLGNALSPLLAL
FT                   PAPVLAGLGFVAVFAGAANTPIASTIMAIELFGAPIGVYAALACVVAYLFSGHAGIYRA
FT                   QRIGHAKLPGPRGDVCVAKSAAGQTAPR"
FT   gene            complement(226807..227742)
FT                   /locus_tag="BMA10247_A0262"
FT   CDS_pept        complement(226807..227742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0262"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01719"
FT                   /protein_id="ABO01719.1"
FT                   /translation="MNRTGWPPRLPPRLKRIWYGAGGLRAGWAVLLYAAIVAAILLALG
FT                   AAARIAHHPFRPRGDLSTAGQMPFELALCAAALIATHVMSRLDRRSWLDYGLRAQRAAL
FT                   HFGWGAFCSLAAVSAIMGLLVATGGATIEYSGANRAAAFESAVTWACAFVLVALAEEIA
FT                   FRGYAFFKLAQRTHPVVAAALTSLAFGLSHVSNRNENIAGIVPVVIYGLVACLAIWRTG
FT                   SLWWALGEHAMWDWSESFLFGAADSGLTAHDTLFKSHAIGPVWLSGGTVGPEASVLVFP
FT                   ALAALAYVAWRLPSRMVSGPPLARGRRQAA"
FT   gene            227903..228016
FT                   /locus_tag="BMA10247_A0263"
FT   CDS_pept        227903..228016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0263"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02411"
FT                   /protein_id="ABO02411.1"
FT                   /translation="MSGGVRRAPRGIRRARPASFSGALLRRPLQRAYPVSV"
FT   gene            228099..228572
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0264"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(228601..229257)
FT                   /locus_tag="BMA10247_A0265"
FT   CDS_pept        complement(228601..229257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0265"
FT                   /product="surface antigen family protein"
FT                   /note="identified by match to protein family HMM PF05433"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03033"
FT                   /protein_id="ABO03033.1"
FT                   /translation="MNTKPIQTTTTKRAAFTKTTLLLALASAAALSLSACVAPNAYGPY
FT                   GSQPQYGTPAYAQPSYAQPAYTQPSYAQPDYSQPGYPQQGYTQPGYQQGYQPGYQPGYS
FT                   GYSTQYGTIAGIRPIGGATSPSGVAGTVVGALVGGVLGNQIGRGHGRDAATVIGALGGA
FT                   VAGNQIGQQMGAQPSAYRVDVQLSDGSMRSFDLQTPGDLRPGDRVRVDGNQISRY"
FT   gene            complement(229304..229603)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0266"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(229748..230788)
FT                   /gene="trpS-2"
FT                   /locus_tag="BMA10247_A0267"
FT   CDS_pept        complement(229748..230788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS-2"
FT                   /locus_tag="BMA10247_A0267"
FT                   /product="tryptophan--tRNA ligase"
FT                   /EC_number="6.1.1.2"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03404"
FT                   /protein_id="ABO03404.1"
FT                   /translation="MHDDTSNPCRAPIALTGDRPTGALHLGHYIGSLKTRIALQDTHRQ
FT                   FILVADTQALTDNAHDPDKVRRNVIEVALDYLAVGIDPRRSTIAVQSGLPALAELTLFY
FT                   LNFVTVARLERNPTIKDEIHARGFGRDIPAGFLCYPVAQAADITAFKADTVPVGDDQLP
FT                   LIEQTNEIVRRVNRQAGADVLPEASALISPTGRLPGVDGKAKMSKSQGNAIALSSSPDA
FT                   IADAVRRMYTDPNHLRVSDPGTVEGNVVFTYLDAFDGEPDELERLKAAYRAGGLGDMVL
FT                   KRRLEDRLQALIAPIRERRAQLARDPGYVVDVLKDGTAHARDVTQRTLDEVRDALGAFS
FT                   FRRFVG"
FT   gene            complement(231230..232270)
FT                   /locus_tag="BMA10247_A0268"
FT   CDS_pept        complement(231230..232270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0268"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01651"
FT                   /protein_id="ABO01651.1"
FT                   /translation="MADMPKSPQFPPTPSAAAPAAARRAVHVLAFDDVQLLDVTGPLQV
FT                   FASANDFAARRGLAIPYAPRVVAAHAPSVMSSAGLAFAAAPLPAAREPSDTLIVAGGCG
FT                   VHGAARDPRLVDWVRRRAAYARRIASVCSGAFVLAAAGLLGGRRVVTHWSRCDELAQRY
FT                   PDVRVEPDPIFIRDGNVWTSAGVTAGIDLALALVEDDLGRALALDVARYLVVFLKRPGG
FT                   QAQFSAALSLQHEGGCFDELHAWAAANLGADLSVAALAARAGMSERSFMRRYREATGRT
FT                   PARAIEQMRVEAARNLLADAPLPIKRIAARCGFGSEETMRRSFLRMLGVAPQAYRERFA
FT                   TNRRGV"
FT   gene            232379..233077
FT                   /locus_tag="BMA10247_A0269"
FT   CDS_pept        232379..233077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0269"
FT                   /product="DJ-1/PfpI family protein"
FT                   /note="identified by match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03475"
FT                   /protein_id="ABO03475.1"
FT                   /translation="MTIEVGLLLFPQVQQLDLTGPHDVFASLPGVTVRLVWKTREPVAS
FT                   SSGLVLAPNATFDDCPPLDVICVPGGIGVADLMEDADTLAFLRRHAAHARYVSSVCTGA
FT                   LVLGAAGLLRGRRATTHWAFHSLLAPFGATPVRERVVRDGNLVTGGGVTAGIDFALTLA
FT                   AELVGEDDAQAVQLQLEYAPAPPFAAGDPDTAPARIVERMRERSKPVLARREQVVARAV
FT                   AALERQRADG"
FT   gene            complement(233416..235425)
FT                   /locus_tag="BMA10247_A0270"
FT   CDS_pept        complement(233416..235425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0270"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02710"
FT                   /protein_id="ABO02710.1"
FT                   /translation="MVQKTTHPGGRAFTDVLAFTFRHWRAQPVRIAGIAALALATALGD
FT                   VLTPLFAGRLVDALSHGVAAADKAAAWSRALHAFGVLIGIGLACTLLRQAVFRNIIVLT
FT                   LKMMSEIAANAFHRVQRFSTDWHANSFAGSTVRKITRGMWAIDLLNDTLLVALLPSIVM
FT                   LTGATLLLGLHWPVMGAVVGGGSVVFIAVTVAMSLRYVAPAARLGNLWDTRMGGALADA
FT                   VSCNPVVKAFGAETREETRLDGVVSKWRARTRRAWRRGTLNGGVQGAMLAAMQAAILGA
FT                   ALWLWAHDRASIGDITFALTTFLVLQGYLRDIGMHIRNLQRSVNDMEELVSLERQPLGI
FT                   DDKPGAKPISIARGEIRFEHVTFGYSGAHAKPLYENFSIRIAPGERVGLVGHSGSGKTS
FT                   FIKLIQRLYDVDGGHITIDGQDIAEVTQASLRSQIAIVQQEPLLFHRTLAENIAYARPG
FT                   ATRDEIERAARLASAHAFIDALPQGYDTLVGERGIKLPGGERQRVAIARAFLADAPVLI
FT                   LDEATSSLDSESEVLIQQAMERLMVGRTTLVVAHRLSTVRALDRLIVLDKGRVIEEGSH
FT                   DALIRLEGGVYRRLFERQALELAKGLIEQTGGTVADWLRDEQDEHGGRDERNERGERDK
FT                   PGALDGHDARRTHGVLDESRDGGQADNSAMAMEK"
FT   gene            235744..236997
FT                   /locus_tag="BMA10247_A0271"
FT   CDS_pept        235744..236997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0271"
FT                   /product="dyp-type peroxidase family protein"
FT                   /note="identified by match to protein family HMM PF04261;
FT                   match to protein family HMM TIGR01413"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02018"
FT                   /protein_id="ABO02018.1"
FT                   /translation="MLPIRDERRAASRFVVLVVLVVLVGAGRSGLTSRSARGAAPRARR
FT                   HRVGGRAPRWAEANATRRSRGACTRAVARTCAPGAARPKGPLRHGARTRLPNRLPKPAR
FT                   ADVMGQSDVPCRTEHCIEETMSDFQPGILAPIPAASRYLSFRISHPEHAASVLAALRDA
FT                   LDGVDTVIGLGPSLVQALDRKIDGLKEFPELSVPGAPVPSTPAALWVWLRADDLGAATV
FT                   RSRDIERLVAPAFELDAAANAFRYADDRDLSGYEDGTENPEGDEALEVAFVSGKGAGLD
FT                   GASFVAVQQWVHDFGKMREIPGDEMDRVIGRRKDDNEELEDAPAYAHVKRTEQESFKPE
FT                   AKVLRRSSPWADERRAGLYFVAFGHSFRAFEVQMRRMIGATDGVHDGLFRFTQPITGSF
FT                   FWCPPVKGGKLDLSALGL"
FT   gene            complement(237184..237339)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0272"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            237338..237598
FT                   /locus_tag="BMA10247_A0274"
FT   CDS_pept        237338..237598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0274"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02413"
FT                   /protein_id="ABO02413.1"
FT                   /translation="MAVAHRDIVAASMGPACRCPLRARRHGDHASAMRNAFRELAWSAF
FT                   HCRVRNARRSRYEADTKPIQHAGQYRRERAADGRQLIDGSR"
FT   gene            complement(237574..237687)
FT                   /locus_tag="BMA10247_A0273"
FT   CDS_pept        complement(237574..237687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0273"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03062"
FT                   /protein_id="ABO03062.1"
FT                   /translation="MRNRRISPCFQSKTARTTKIGSFESGCFLTHRLPSIN"
FT   gene            237875..239077
FT                   /locus_tag="BMA10247_A0275"
FT   CDS_pept        237875..239077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01776"
FT                   /protein_id="ABO01776.1"
FT                   /translation="MRRSELKFNCIAATILAAVAADATAAGACLNGSTIASTTRAPLVA
FT                   RQGSVFSSTLYDPAITSNNRTHNPVMLTVKVTNNGRPVAGCDVAWQPRGAGGASGWLFP
FT                   ASASTDANGIASAWWVAGSGAAQTAVASIRRFDGTTQGVAIGGSAQPHATRANSIHLNY
FT                   EPASDWTAFRVDVTPEALAPTTYWEAIGWPGAYTGIQSIDGKQNGLVLFSVWDVNGKSP
FT                   QIIAKGPGVDCTQFGGEGTGYKCAKRHAPVAGRTYRFMASIAPVAGQNQTDYSVWFTDT
FT                   STNARELIATLRYQKAVQSANYANSFVEDWATQGASCLGATQRAGQYGNVWALDRASAQ
FT                   WRTVKRASTSAVYTPDHNEVCSNYQFSVVNGRFRMSTGGHAVGQPLNLPNGPKSFPLTL
FT                   P"
FT   gene            complement(239217..239606)
FT                   /locus_tag="BMA10247_A0276"
FT   CDS_pept        complement(239217..239606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02339"
FT                   /protein_id="ABO02339.1"
FT                   /translation="MPLIHATAEMAPDAPNYVVELEAGKHRLQGDENEHEGGGNVGPAP
FT                   YELVLSGLAACTVATLRMYMQRKAWPAARLLARAELHVDREGAQYVRRTIVVDGAQRTR
FT                   LAEIAEKTPVTLFVKRGTRIETTLK"
FT   gene            complement(239698..240624)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0277"
FT                   /note="transcriptional regulator, LysR family; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT   gene            241015..242247
FT                   /locus_tag="BMA10247_A0278"
FT   CDS_pept        241015..242247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0278"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03832"
FT                   /protein_id="ABO03832.1"
FT                   /translation="MDFSPSARCRELSERIAAFMRDEIAPVEARYAEQLTGDADWRRWR
FT                   QPDVMETLKAKARAAGLWNLFLPEAEHGGAGLSNAEYAPLAELMGHSFIAPEAFNCNAP
FT                   DTGNMEVLARYGSPEQRRRWLEPLLAGEIRSAFCMTEPEVASSDATNMRATAKLEGDEI
FT                   VLNGRKWWSTGIGHPLARVVIFMGLTDPQAEPHRRHTMVLCPLDAPGVRIERMLPVFNA
FT                   YDEPSGHGEVSFTNVRLPASNVILGPGRGFEIAQGRLGPGRIHHCMRALGAAEKALTLL
FT                   CARATARTAFGKPLVKLGGNGDVVANLRMAIEQARLLTLKAAWTIDTQGVKAALSLISQ
FT                   IKVVVPAVAQQAADAAIQIHGGAGLSNDFPLAALYAYARVLRIADGPDEVHRAVVAKLE
FT                   VKRQLAAAEAA"
FT   gene            242244..243320
FT                   /locus_tag="BMA10247_A0279"
FT   CDS_pept        242244..243320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0279"
FT                   /product="phosphotransferase enzyme family protein"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03181"
FT                   /protein_id="ABO03181.1"
FT                   /translation="MSVRLDDARDVRDEDRLDAAKLDAYLKPRIAGLSGEPRIRQFHGG
FT                   ASNLTYLIGYGDRELVLRRPPAGAKAGAAHDMLREAAVMAALGPDYRYVPAILARCDDP
FT                   AVLGSEFYVMERIAGVILRRELPAELKLDRADVRKLCERFVDRLIELHAIDASRPEIAA
FT                   LGKGEGYVARQLSGWAQRWRNALTDGTNPCDDVLAWLERHRPAGERRICVIHNDFRFDN
FT                   VVLDPADPLSIVGVLDWEMATLGDPLMDLGGSLAYWAQADDDPAFVAMRRQLTHADGMM
FT                   TRRELVEYYGARTGLDVGGFVFYEVFGLFRLMVIAQQIYRRFVLGHTTNEQFAGLGAVV
FT                   RYLGERCRRVIDAAGGAR"
FT   gene            243317..244006
FT                   /locus_tag="BMA10247_A0280"
FT   CDS_pept        243317..244006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0280"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02213"
FT                   /protein_id="ABO02213.1"
FT                   /translation="MTELLLIRHAQASFDAADYDCLSPLGDEQSARLGAWMARGARRPA
FT                   LIATGTLRRHAQTADGCARAAGVDAPRLALAGLDELDADELIARHRPALASRDALLRAM
FT                   AAEADPRRAFQTLFAAAVARWTGGAHDGEYGCAWPEFRARTLAAWDALAGQPAREIWAF
FT                   TSGGPIGVIVAALFGVPAERSFELAWPLVNTSVTRIRIGRGGARVTTYNGWPHLDGERD
FT                   ERLVTHR"
FT   gene            244040..244810
FT                   /locus_tag="BMA10247_A0281"
FT   CDS_pept        244040..244810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0281"
FT                   /product="7-alpha-hydroxysteroid dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01560"
FT                   /protein_id="ABO01560.1"
FT                   /translation="MSAPNLFDLSGKIAVVTGGSRGIGAEVAKLLGAFGAHVVVTSRRL
FT                   DDCRAIADEIVAAGGSAEAAACHIGELEQIDALYASLEGRHGRLDVLVNNAATNPYYGP
FT                   IVDTDLGAFQKTVDVNIRGYFFMSSRGAKLMGKNGGGSIVNVASVNGVIPGYWQGIYSI
FT                   TKAAVISMTKAFAIECAASGVRCNALLPGLTDTKFASALTQTPEVLKQVLAHVPMRRAA
FT                   QPTEMAGAVLYLASAASSYTTGTVLNVDGGYLSV"
FT   gene            complement(244899..245072)
FT                   /locus_tag="BMA10247_A0282"
FT   CDS_pept        complement(244899..245072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0282"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03573"
FT                   /protein_id="ABO03573.1"
FT                   /translation="MPARRGAKCFVFVMNTPLSFSMFARRPRASLVRPKRHALERRAAA
FT                   MRTIAAAIVSGV"
FT   gene            245050..245829
FT                   /gene="linX"
FT                   /locus_tag="BMA10247_A0283"
FT   CDS_pept        245050..245829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linX"
FT                   /locus_tag="BMA10247_A0283"
FT                   /product="2,5-dichloro-2,5-cyclohexadiene-1,4-diol
FT                   dehydrogenase"
FT                   /EC_number="1.1.-.-"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02592"
FT                   /protein_id="ABO02592.1"
FT                   /translation="MAPRLAGKRAFITGAAGGLGRAIARRMAEQGAQVFLTDIVDAAVL
FT                   EAFAAELNDTAGERIAWAAVQDVADEAQWASRLSQAADAMGGLSVLVHNAGVGSFGAIG
FT                   QIARDEWRRVMAINVESIVLGTKHALPYLEAGAPASIVNISSVAAFKQEPDYTAYNASK
FT                   AAVASLTKSIAVDCARRQTEVRCNSIHPSFIMTGIVAPIVRLVGEKEAARKLARGVPMR
FT                   RLGEPDDVAHAAVYLASDESRYVTGAELVIDGGMCAV"
FT   gene            245817..247256
FT                   /locus_tag="BMA10247_A0284"
FT   CDS_pept        245817..247256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0284"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02553"
FT                   /protein_id="ABO02553.1"
FT                   /translation="MRGLTSRVRRRRHFRAPPAKLEKSRRCDCIVADRGSRIADRGSRI
FT                   ADRGSRIADRGSRIADRASCLAPRASRLVPRASRLAPRASRLAPRASRLAPRASRLAPR
FT                   ASRLAPRASRECDRGALAAFADAGACRPFPFLPKVMPMSTPVNRQLRLKARPDGRVGHE
FT                   HFTLAEAPLPPLGPGEMLVRVLYLSMDPTNRVWMSDIPQYLPPVAIGDVMRALGIGRVV
FT                   ASNAPGFAEGDLVQGLVGWQDYAHVRADEIAQYTKLPAALGLPLPRLLGACGMSGLTAY
FT                   YGLTEIAPVQPGETLVVSAAAGSVGSVAGQIGKIHGARVVGIAGGADKCRYLTDELGFD
FT                   AAVDYKSDDWKRALKDATPDGVHVSFENVGGEIMRAVLSRMAIGGRVALCGVIANYNNG
FT                   RPADDVSVLIAKRLTMRGFLILDYRKSREAIATLAGWLRDGRLKAEETVADGLTNAPDV
FT                   LNRLFDGSHRGKLVLRVDPQA"
FT   gene            complement(247559..247882)
FT                   /locus_tag="BMA10247_A0285"
FT   CDS_pept        complement(247559..247882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01884"
FT                   /protein_id="ABO01884.1"
FT                   /translation="MNACTRTERHAPREADAPPARRCAKPERRGLSVRREPRRGSMEID
FT                   GERRSERRDERGKRSRTTAKQPPNRETERVGASERHGPLSRTKVARSPPRHGGSSMRAI
FT                   FGN"
FT   gene            complement(247904..249109)
FT                   /locus_tag="BMA10247_A0286"
FT   CDS_pept        complement(247904..249109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0286"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03628"
FT                   /protein_id="ABO03628.1"
FT                   /translation="MHPLRSILPLALFTAVGLLATDLYLPAVPSLPQQLGGSIESAQAT
FT                   LAAFSAALAVSQLVWGAAADRFGHRRTLAFAVLLQLVAGAACALAPSMGALIGARLAQG
FT                   FGVGAAMVIVPALVRQSFGDGGAVRALAWLGIVESAVPGLAPLVGAALLVVADWRTSFW
FT                   IIVALSAIAAPLVFRVIPTARAMRACAPANVGAHAGGYRRLLRSPVYLGYALGHALCFA
FT                   ALLAFVASAPQVVEIWLGAGPSTFSLMQACGVAAFMLSAARSGKWSDALGLDRIIALGA
FT                   LLQFAASAAFLLLAYADWRSTPLVVASWMLFCGSLGLRGPASMARALAAEPAVAGRAAG
FT                   LLMFFGLGGAALATQAVAPFLRLGLAPVAWMCAGFTLASGAVVLWGIAIRGRHRAAATE
FT                   IA"
FT   gene            249627..251672
FT                   /locus_tag="BMA10247_A0287"
FT   CDS_pept        249627..251672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0287"
FT                   /product="putative TonB-dependent siderophore receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02484"
FT                   /protein_id="ABO02484.1"
FT                   /translation="MSLLLAASLAHGETGAPPAERRSDAPPATALAPIFVTANPLGASA
FT                   LSSPTASLSGDALTLRRTDSLGDTLNGLPGVSTTTYGPLVGRPIIRGMDGDRIRLLQNG
FT                   VAAYDASSLSYDHAVPQDPLSVERIEIVRGPAALLYGGNAVGGVVNTIDNRIPREAITG
FT                   VSGALDASYGGANNARAGAALVEGGNGRFAFHLDAFGRETDALRIPGHAHSARQRALDG
FT                   EDASEPYGRLPNSDGRRYGGAAGGSYTWADGYVGASYSGYESNYGSVAETDARLQMRQE
FT                   RVALASEVRNLRGPFSQLKFDFGYTNYQHKEIEDGVTGTTFRNHGYEARVEARHRKLGP
FT                   FEGALGVQVGQNTFSALGGEALAPTTRTTSVALFGLEQWQATDALKLSAGARIEHVRLD
FT                   PSANGDDKFGFARSRDFNAGSVSAGALYQLAPAWSLAGNVSYTERAPTFYELYANGPHG
FT                   ATGQYLIGRPDAQKEKAVSTDLALRYASGPNRGSIGVFYSRLRNYLAEYDTGRLVDDDG
FT                   VPVAPGADDALREAVYRGVRAEFYGVELEGRWRAFERRGHRVDLELSADYTHARNADTG
FT                   EPLPRIAPLRATLAADYGYGPFGARAQLTHAWAQHRVPEHDLATDGYTSLGVVLTYKLR
FT                   VGATNWLAYLRGDNLTNQDIRYASSVVRNIAPQGGRSVSIGMRTTF"
FT   gene            251843..252271
FT                   /locus_tag="BMA10247_A0288"
FT   CDS_pept        251843..252271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02838"
FT                   /protein_id="ABO02838.1"
FT                   /translation="MKRTIRKSWAALVPLLVAGSVCAAAPLCQTQKLGAHTSKMCVEQT
FT                   PFKHDYYTLWVDDSPIFMLPDDYVEKVALTHTVPEDGAIEFPLSKQGTPTVTISGGCAP
FT                   VSETQGKGADAVNLETGRVCSFNWGKEPVVKDLRFSFE"
FT   gene            complement(252487..253545)
FT                   /locus_tag="BMA10247_A0289"
FT   CDS_pept        complement(252487..253545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0289"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:NTL03PA02651; match
FT                   to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02150"
FT                   /protein_id="ABO02150.1"
FT                   /translation="MDSGNDHQKFFHLLLLVVTVGLCWILTPFFGAIFWGTILAILFQP
FT                   VQRWLAARFGKRRNLAALVTLSLIILIVILPLAFVTATLVQEIAYAYQQIKTMQPNMTQ
FT                   YFQEFMHALPSSVHRVLHNYGLTDIAGIQKKLTDGAAAISQFVAAQALSIGQNTFQFVV
FT                   SFGVMLYLVFFLLRDGGEIGRRVRRALPLDEEHKQHLLTKFTTVVRATVKGNIAVAAVQ
FT                   GALGGLIFWILGIEGVILWGALMAFLSLLPAIGAGLVWVPAAGYFAVTGQIWKCVILVA
FT                   FCVGVIGLVDNLLRPILVGKDTKMPDWVVLISTLGGMALFGINGFVIGPLVAALFMASW
FT                   DIFARTEQTDWE"
FT   gene            complement(253773..254339)
FT                   /locus_tag="BMA10247_A0290"
FT   CDS_pept        complement(253773..254339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0290"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01909"
FT                   /protein_id="ABO01909.1"
FT                   /translation="MKVAIATVLGSLALAGCTTTPDKPANASSNASTREAIDARVNATL
FT                   SRLYSTVPGSRELVSKSRGVLVFPNVLQAGFIVGGQSGNGALRVGGSTLGYYNTSSLSV
FT                   GLQAGAQSKALIFLFMSQDALDKFRNSDGWAAGADASVALVKVGANGAVDTSTVTAPVE
FT                   VIVLTNAGLMGDLSVNGTKVTRLKL"
FT   gene            complement(254406..255170)
FT                   /locus_tag="BMA10247_A0291"
FT   CDS_pept        complement(254406..255170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05957"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03810"
FT                   /protein_id="ABO03810.1"
FT                   /translation="MQRRKPAASIVIIASRPASPATPPPSRCRKRHEREEKADIRRRAT
FT                   KAFFTDHPHHVKQKNTETGSYARPRPRPASIQTVAFSAEPHPAKASAPPRRLAAAAARN
FT                   SGPDNESHMSSVRTFPSTIRRTIIMALSDTVEYKLDRGLSEARRAGRRFARDARSAARD
FT                   LNGDVKDNMRSLVDELDALLKEDVDVDALRKRLHGRLEAARDTLDDASWHASRRLRQSA
FT                   ERVTQAVHDNPWQTAGIVAGLAFAAGILLARR"
FT   gene            complement(255564..257438)
FT                   /locus_tag="BMA10247_A0292"
FT   CDS_pept        complement(255564..257438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0292"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03692"
FT                   /protein_id="ABO03692.1"
FT                   /translation="MRTPTPLFAALSLLSTVAAAPAFAAAASPVSTNCGGSATPIAEIQ
FT                   GAGAPSPLAGQNVSIEAVVTADFGGADGFGGFFVQQADPQRRNQPGVSEGLFVYSPKAR
FT                   ARAGELVHVTGKVEEKYGQTQLTLSGAVAVCASGQSVTPATLALPVDSPNAFAAYEGML
FT                   VRLPQTLTVTEVYELGRYGSVLLSNGRLRTPTSVVPPAQAKAVAEANARNRLILDDGSN
FT                   KQNPATVPYPAPALSAANTLRAGYTAADVEGVLELRYGAWRLQPVPGARTPTFGASANP
FT                   RTAAPARDPRANLRVASFNVLNYFNGDGAGGGFDDPSNRGAKNYEEFVRQDAKIVSALK
FT                   ALDADVIGLMEIENDGYGPLSAVRQLAAKLGENWRVVDPGSARLGGDAIAVALIYDSRK
FT                   VKPIGNAATLAIDDKNRQPLAQTFRPLGGSRAVTVAVNHLKSKNCPDATGDDLDQGDGQ
FT                   GCWNATRSRAAAKIADWLARNPTGAPSEGVLLIGDLNSYTYEDPVRTLESRGYVNLVSS
FT                   KVGSGAYSYVYNGEAGYLDHALATNALAWRVKAVHDWHINADEPIALQYTLAYKSAEQQ
FT                   RTYYAPDAYRSSDHDPVLIDIALADEYAAAASRRGAEMAAAHSRRPWH"
FT   gene            257799..258152
FT                   /locus_tag="BMA10247_A0293"
FT   CDS_pept        257799..258152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0293"
FT                   /product="DGPF domain protein"
FT                   /note="identified by match to protein family HMM PF04946"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03112"
FT                   /protein_id="ABO03112.1"
FT                   /translation="MSYMLLIVEPRGQRSTRTRAEGEALYERMRHFAGELQSRGVLIGA
FT                   ESLVSDDQSTRVQVRNGEVRLVDGPYAEAKEMVGGFFLLDVGTQGEALAIAKDCPAAEW
FT                   CSVEVREIGPCFR"
FT   gene            258319..258732
FT                   /locus_tag="BMA10247_A0294"
FT   CDS_pept        258319..258732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0294"
FT                   /product="DGPF domain protein"
FT                   /note="identified by match to protein family HMM PF04946"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01852"
FT                   /protein_id="ABO01852.1"
FT                   /translation="MHFMIMVKANAASESGAMPDASLIAAMAAYHEELAKAGVLLDAAG
FT                   LQPSSKGWRVRYSGGKRAVVDGPFAETKELIAGYTLIQVRSRDEALEWTRRFPAPFGEH
FT                   DGGEIEVRQLFELDDFEPGDGIDRFRELESKLG"
FT   gene            258754..259293
FT                   /locus_tag="BMA10247_A0295"
FT   CDS_pept        258754..259293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03442"
FT                   /protein_id="ABO03442.1"
FT                   /translation="MVQIVVIAGAAALAFALPLMLYAASRPGTRRVEHRARIEAGAARI
FT                   FPAPADLRRFDACNPCERKAPALRGAYGAVRSGVGASDAWTREKAGVGRFGTTGLGEPS
FT                   HVRTRLDFVRRFDAHDVAEFTLRPDGDATVVTWAMRGPSPFLSKLMRACLSIGKMIGKD
FT                   FSTGLANPKALAEGRA"
FT   gene            259290..260558
FT                   /locus_tag="BMA10247_A0296"
FT   CDS_pept        259290..260558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0296"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF08281; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02714"
FT                   /protein_id="ABO02714.1"
FT                   /translation="MMDAAVHRAIDAVWRIEAARIIAHVARLVRDVGVAEELAQDALVA
FT                   ALEHWPSGGVPDNPGAWLMTAAKRRALDHLRQHALHARKREQIGLDLDALGAHVAPDVA
FT                   DVFEAARDDDIGDDLLRLVFTACHPVLSTDARVALTLRLLGGLTTGEIARAFLTPEPTI
FT                   AQRIVRAKRTLSAAKVPFEVPRAPERAARLASVLEVIYLVFNEGYSATAGDDWMRPALT
FT                   DEALRLGRVLAGLAPDESEVHGLVALMEIQASRMHARVDAQGCPVLLLDQDRSRWDPLL
FT                   IRRGLAALARSEALGGASGPYALQAALAACHARARHADDTDWEQIVALYDALAQVAPSP
FT                   VVELNRAVAVGMAFGPAAGLEIVDALAADPALARYHWLPSVRGDLLAKLGRRAEAQAEF
FT                   QRAADMTLNAREREMLLARATQR"
FT   gene            complement(260754..260972)
FT                   /locus_tag="BMA10247_A0297"
FT   CDS_pept        complement(260754..260972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0297"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01782"
FT                   /protein_id="ABO01782.1"
FT                   /translation="MYFWKAGALRSERDVAVVGAVKMCRASMFREKGLRLAACGRLCRS
FT                   ARRASKSSGVVPSDQEGGRRLTRAPSA"
FT   gene            260991..261110
FT                   /locus_tag="BMA10247_A0298"
FT   CDS_pept        260991..261110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0298"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02103"
FT                   /protein_id="ABO02103.1"
FT                   /translation="MRAAADSHARASHHRATYSLGASRRFSIASYDSNGKGYG"
FT   gene            261103..262143
FT                   /locus_tag="BMA10247_A0299"
FT   CDS_pept        261103..262143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0299"
FT                   /product="N-acetylmuramoyl-L-alanine amidase domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01471;
FT                   match to protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02666"
FT                   /protein_id="ABO02666.1"
FT                   /translation="MAEEQQAKIINEGRRGFLARSSAWPVGMLMLPLAGCGDGDGDGVV
FT                   PSAHAQDTPPPSGAGYTIDRSIQSPNQDSRVRTLVLHYTAQTLADSIASLTSPQRQVSA
FT                   HYLVPDAADDGRRFKVFELVPQARRAWHAGVSYWQGDRMLNAGSVGIEIVNLGFPPEDE
FT                   NLPLMNRRWYPYPDAQVAVFGALAADVVAQHQVLPHKVVGHSDVAPGRKTDPGPLFPWK
FT                   KLYDQYKIGAWPEAEAVDYYRVNRPFAGDVASLQSKLLAYGYDTPQTGTLDAQTVNVVS
FT                   AFQMHFRPSRYDGVPDVETVAILDALLEKYFNRGRAINKQTLPGATAPTGEKGSDAWPL
FT                   APAPSR"
FT   gene            262414..262836
FT                   /locus_tag="BMA10247_A0300"
FT   CDS_pept        262414..262836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0300"
FT                   /product="rubrerythrin"
FT                   /note="identified by match to protein family HMM PF02915"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01734"
FT                   /protein_id="ABO01734.1"
FT                   /translation="MAQLKGSKTEENLKYAFAGESQANRRYLYFASKADVEGQNDIAAL
FT                   FRSTAEGETGHAHGHLEYLEAVGDPATGLPFGTSRQNLQSAIAGETHEYTDMYPGMAKT
FT                   ARDEGFEEIANWFETLAKAERSHANRYTKALDGLVD"
FT   gene            262948..264285
FT                   /locus_tag="BMA10247_A0301"
FT   CDS_pept        262948..264285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01933"
FT                   /protein_id="ABO01933.1"
FT                   /translation="MSHREGSLEAPTRHPLDWRSDAFYDQAAIDAELARVFDICAGCRR
FT                   CVSLCGAFPTLFDLVDETETGEAHAVDPKSFGKVVDQCYLCDLCYMTKCPYVPPHPWNV
FT                   DFPHLMLRARAARYRRNEVRLRDKLLSNTDMLGHFAGIPIVTQAVNAANRTPAMRGALE
FT                   ATFGVDRRAWLPPFASRKFRRVAPRSPAPPPRDGERTPGRVAIYATCYVNYNEPGIGHD
FT                   LLAVLAHNGIPYELVASEACCGMPLLEQGNLEGVAAKKAANIPVLARHAREGHALIGAI
FT                   PSCVLMYKSELPLMFPDDADVRAVADAFWDPFEYMIARHRDGLLKTDFKHELGVVSYHV
FT                   PCHARVQNIGRKAADALSLVPGTKVKVVERCSGHAGTFGVKREFHAQALKIGAPVFNAI
FT                   AEQAPDYMSSDCALAGHHIEEGIGAKGVEPPPFAHPITLLRRAYGI"
FT   gene            264311..264892
FT                   /locus_tag="BMA10247_A0302"
FT   CDS_pept        264311..264892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02803"
FT                   /protein_id="ABO02803.1"
FT                   /translation="MTLTRDSLLTLEAYAKVRRQEHARVIAHKKRRAVSIGNHLRLLFE
FT                   DETTIRYQIHEMLHIEKIFDEDGIQAELDAYLPLVPDGSNLKATLQIEYENETQRRAAL
FT                   ARIVGIEDRVFLRVDDEAPVYAIADEDLERDTAEKTSAVHFLRFELGDAMKAKLKAGAP
FT                   LSIGCDHPHYPIQAARIDPDVAASLAGDLD"
FT   gene            265469..266473
FT                   /locus_tag="BMA10247_A0303"
FT   CDS_pept        265469..266473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0303"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02406"
FT                   /protein_id="ABO02406.1"
FT                   /translation="MFFDELNDEEWARLSTLIADEPIRLNRRGRPRAENRVVANAVLWI
FT                   LTTGEPWSKLPGRYPSGPTCRRRFEEWLASGTLGEMVRVLSEESGRAFAYVPPPPESVA
FT                   PVRRAEPAADCDRLRGVFWQNPESWQLPVAQTDVCHPGAGVNVRRFASEDDEDGAHDAD
FT                   AHPHGFNVPGAPPVRDHAHGRAHAASFSFATHAPQTETYRGYTVYGIAQPVQNLMYRAW
FT                   AEIVQDDRRVERSGLIGPRFTDAESAEQYALDWARQWIDRRCAGAPSVRETPAPVAGQA
FT                   GKSVPTIAGLSALAMAETNIKHFAAELHRAPAEGRGDASQVQIDRHEYAYRVG"
FT   gene            complement(266546..266824)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0304"
FT                   /note="mannose-6-phosphate isomerase; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF01050;
FT                   match to protein family HMM PF07883"
FT   gene            complement(266864..268075)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0305"
FT                   /note="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; this
FT                   gene contains a premature stop which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00483; match to protein family HMM PF01050; match to
FT                   protein family HMM TIGR01479"
FT   gene            268240..268383
FT                   /locus_tag="BMA10247_A0306"
FT   CDS_pept        268240..268383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0306"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03614"
FT                   /protein_id="ABO03614.1"
FT                   /translation="MLQLVGAAPRKAPAAIFISSGCLSRRLIRKNMRAKMRHYDEKISD
FT                   YF"
FT   gene            268504..269550
FT                   /locus_tag="BMA10247_A0307"
FT   CDS_pept        268504..269550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0307"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM TIGR03025"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01690"
FT                   /protein_id="ABO01690.1"
FT                   /translation="MLSVLARMIDIAMAVAGAMIAAMIHRGGFVWLDDLQRTVVVFDCM
FT                   LVVVFFPAFGIYQSWRGKPVFGLMWRVSVAWLVVEGAGILMSFSVHHAGELSRLWLGYW
FT                   AMATITLLVASKACVYAVLRQLRRGGYNHKSVAIVGRAQASATKRLIAHMRARPDAGFN
FT                   PVCIYDEHDDASTGETDGIAIERRFGHLVRRVRSREIGELWLVLPLSEEPQIHRIVTEF
FT                   RNDFVNIRFVPDVRSLSFFNQEVIELLGVPAINLAASPITDVRILPKFVFDRLFALVAL
FT                   MVLSPAMLVIATLVKLTSPGPVFFRQKRKGIDGNEFEIYKFRSMKVHQEMGGKVTQARK
FT                   NDSRVTPV"
FT   gene            269616..269879
FT                   /locus_tag="BMA10247_A0308"
FT   CDS_pept        269616..269879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0308"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01762"
FT                   /protein_id="ABO01762.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            269903..270736
FT                   /locus_tag="BMA10247_A0309"
FT   CDS_pept        269903..270736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0309"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03478"
FT                   /protein_id="ABO03478.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(270764..271651)
FT                   /locus_tag="BMA10247_A0310"
FT   CDS_pept        complement(270764..271651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0310"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02795"
FT                   /protein_id="ABO02795.1"
FT                   /translation="MARNRTVLPLERAQVDVVQERSGVVGDRRISLRVCGEATQGYLLE
FT                   RYHAAPGEPSFVQRVNLFDDATIASFVEHDPYSAELESLYRAVIDVPKKALKFAGRETI
FT                   QPEFASECVSESGLLTVMRNTILECGATNCFYHYFRIDEKTGNLKNHELLIGGTPVWSH
FT                   RYVHRHWYLNDPAMAHARNDTRPLRASTLAPLPHDHWLNQQAQFLGLTSNVFFPAHRRD
FT                   DDTIGLLHVSSSLPAAQGEEIIWRNRRTLRGLATEMLEWKVTAQRNTLAREMSLSHHEL
FT                   VALRLVGRVTCPLR"
FT   gene            complement(271834..272091)
FT                   /locus_tag="BMA10247_A0311"
FT   CDS_pept        complement(271834..272091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02193"
FT                   /protein_id="ABO02193.1"
FT                   /translation="MNAKAAALHIRRSRRSGHSFGPAFNGCALNIPCRTSARGPHRFSE
FT                   SRYPFPNRAINQEFSDSIPAEFIGHQKFNYPKPITNSTIN"
FT   gene            complement(272391..273245)
FT                   /locus_tag="BMA10247_A0312"
FT   CDS_pept        complement(272391..273245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0312"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03848"
FT                   /protein_id="ABO03848.1"
FT                   /translation="MNDCARDIAPDRDQIRIGSGAPGIERVEAHFLDHAFTPHRHDTYA
FT                   IGITLSGLQTFGYLGEIHHCLPGQCHILHPDELHDGRAGTDEGFGYRIIYVDPALVQEA
FT                   LGGRMLPFVRSPIFQAPAVSEALAAGIWNLDEEIDNVSRIDIAVAVANLLTAAAAKGSA
FT                   PKAGPLAMVELTRIRDIIASCPHEPISMDALEHASGLDRWTIARQFRRLFGTSPSRFRT
FT                   QRQLNLVRRLLMEGESLSTASTDAGFSDQSHMSRHFKSTYGITPGAWISAVRTRHAQHP
FT                   SDH"
FT   gene            273341..273934
FT                   /locus_tag="BMA10247_A0313"
FT   CDS_pept        273341..273934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0313"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03349"
FT                   /protein_id="ABO03349.1"
FT                   /translation="MRSLVALLFAAAVVMGSPGPSTVSVTAMGASYGVRRSLKYAWGLI
FT                   AGTVAVLLLVSTGVTAFVMSMPSAARILNIVSALYILYLAYRIATAPPLDKRAENLSSP
FT                   AFKGGFLLAVANPKAYIAIGAVFAGTTLVATDYGLDAAAKIVLLSVMIVIIHLGWLLAG
FT                   VSLSRFLHDPVASRIINVSLAAILAIVSLIALFE"
FT   gene            complement(274176..274586)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0314"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            274755..276077
FT                   /locus_tag="BMA10247_A0315"
FT   CDS_pept        274755..276077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0315"
FT                   /product="dehydrogenase, FMN-dependent"
FT                   /EC_number="1.1.2.-"
FT                   /note="identified by match to protein family HMM PF01070"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01995"
FT                   /protein_id="ABO01995.1"
FT                   /translation="MSAMSVRIRRPPEDERPRCAGGERRRIQMANVGKAWNIDDLRKMA
FT                   RKRVPKYFFDYLDGGANSETTMRANENDFARWRLRQKVLTGAQSRVAGLGATYLGAEHR
FT                   LPILLGPVGFAGMYWSRGEIAAGRAADDAGIGQCLSTFSICSLEDVAAARSGPLYFQLY
FT                   MFRDRDLTEDILARCRLANVDAVFLTVDTCYIPIRERDARNGFRADTRLSARGVWSMLK
FT                   RPGWCAGALSHGVPRIGNVLRYPELGASLLEQSAAVGRMIETRLSWADVKWLRARWPGR
FT                   IVIKGILDPDDARRAVDEGVDGILISNHGGRQLDPAPSVMDVLPEIAEAVGKRTEILMD
FT                   GGVRRGADVIKALALGASAVSIGRAYVYGLGAAGEKGVSRCLELLKGEMLPALNMMGFE
FT                   SIAELRAAGKSALRMAVPVHGATAVVEGAEGGARRLTESVL"
FT   gene            complement(276142..276597)
FT                   /locus_tag="BMA10247_A0316"
FT   CDS_pept        complement(276142..276597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0316"
FT                   /product="putative ebsC protein"
FT                   /note="identified by match to protein family HMM PF04073"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02223"
FT                   /protein_id="ABO02223.1"
FT                   /translation="MSVESVRQFLAEKAPDIDVIALSESSSTMTLSAAWDIKPAQIAKT
FT                   LAMKVGDAHVLLVSCGDSRLDNQKIKAALGGKAKMLSAEETVAVTGHPVGGVCPFGLPA
FT                   PLPVYCDVMLKSYEFVVPAAGSTHAALRIDPVRLAELVEAEWVDVCK"
FT   gene            complement(276946..277404)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0317"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            277882..279525
FT                   /locus_tag="BMA10247_A0318"
FT   CDS_pept        277882..279525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0318"
FT                   /product="alpha amylase family protein"
FT                   /note="identified by match to protein family HMM PF02922"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02351"
FT                   /protein_id="ABO02351.1"
FT                   /translation="MSECPHDPYAQHHSHCLPFGAQPCGAAGATTRTHFRVWAPAHAAV
FT                   TLALDTAGGLHELPMAPAGDGWFETFADCGAHTRYRYRLDEALTIPDPASRSQPEGADG
FT                   PSEVIDPRAFTWRHTFWRGRPWEEIALYAIQPGAAGGYDGVRERLPQLAQLGVTALELL
FT                   AAPQARDDSLPFAPIAAYGGVDALKRLIDEAHGFGLAVLLDLDYARFGCGSDEMRRYAQ
FT                   PFFHTRDDPLQAPPLALDHPQVCDFFCDNALYWLEEYRCDGLRIREADRIDSAWLREIA
FT                   DRVHAAMPTDRIVHLVLGSERHPSHLADTHFDAQWNGCGERALYRLTGRRDRAHDDGVS
FT                   THQSIHALARALTANGAVFQRAHPAGEGGMADVGLPLTSLVLSDGVVRDAREADLAALA
FT                   LSLLTPQIPLIFDEAAGDASRRHFVQSALAVRAKLIAPRLIDVRPRRADMLRAADGVEA
FT                   DALVAAWRLGDGETLSIALNLSPQALPFHGAPDGTIVFETPARARDRVDAGVLPPYALV
FT                   AWLTGDVNQYALTHDVRRYADVAPHSPGGA"
FT   gene            complement(279684..280313)
FT                   /locus_tag="BMA10247_A0319"
FT   CDS_pept        complement(279684..280313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0319"
FT                   /product="putative thiamine-phosphate pyrophosphorylase
FT                   ThiE"
FT                   /note="identified by match to protein family HMM PF02581"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02874"
FT                   /protein_id="ABO02874.1"
FT                   /translation="MSARDGDRAADHDMHDDLALPPYYLITPEPASGSDADLAAFLDRL
FT                   SDALATGLTLVQLRVKTLDAPAYAALAAGALARCRAQRARMIVNGPIAVEAALALGAAG
FT                   VHLGSAALRAATARPLGSEGLLSAACHSLDELRHAQRIGADLATLSPVLPTLTHPGAPT
FT                   LGWTRFAECAAHTRVPVYALGGMTRTHLETARAHHAHGIASIRGLW"
FT   gene            complement(280310..281650)
FT                   /locus_tag="BMA10247_A0320"
FT   CDS_pept        complement(280310..281650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0320"
FT                   /product="CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595; match to protein
FT                   family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02487"
FT                   /protein_id="ABO02487.1"
FT                   /translation="MIQIFALIGALLLVALNGFFVAAEFGLVKLRATRVKTLARQHGLR
FT                   GRILRIVHARLDAYLSACQLGITLASLGLGWIGEPAFAALLSPVLAFAGVESEKLVHLI
FT                   SLVFAFSVISFLHIVVGELAPKSMAIRQAEKTGLWVALPLYAFYWAMYPAIWVLNTSAN
FT                   AVLRLAGLSADHGGDAHYSTDELKLILRSRRNAAGAAKAPKHAYSNDEWNTLAHSLDFS
FT                   SMTVSDLMRPAHEMVGLRRDLPLADNMEVVARHRFSRYPLFDDQSRETVNGLIHLKDLL
FT                   LARHAGAALADLSDYVRPVQYVKPDTPALDLFRRFRKGAPHFALVGKKGEKPIGFLTLD
FT                   NLLGALVGQIHDEFRQGDSDWSRLDDGTLIGKGSLPVVSLEQALGIDIDEGRAESVGGL
FT                   VIQALNDLPTEGRRVSFDRFDIVVKKMIGPRIVLVRVYPKSPKEADE"
FT   gene            complement(281736..282515)
FT                   /locus_tag="BMA10247_A0321"
FT   CDS_pept        complement(281736..282515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0321"
FT                   /product="putative sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03309"
FT                   /protein_id="ABO03309.1"
FT                   /translation="MIPSAEPAAALLRERAARYAAEVALFVRDHALSVASHDLRSPLNA
FT                   MHSWAYVLERRLTASDENLARALDGIRIGIEQQTKLLETTIDAPRAETRSLPIARAGVA
FT                   LDALADECAALARIALGDARGTAVTIASPMRPASLECDRERVAQALWSMLTFAIEASAP
FT                   GGEVALGCDGPADAARLNVTFLARLPALTDATLPHVFETFARREALAERQGERPAAVFA
FT                   LAQRVARAHGGAFAQEPNPLADGARATLALTIPAARA"
FT   gene            complement(282608..283528)
FT                   /locus_tag="BMA10247_A0322"
FT   CDS_pept        complement(282608..283528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0322"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01819"
FT                   /protein_id="ABO01819.1"
FT                   /translation="MKHDARKHLRANLLMLAAAAIWGSAFVAQRLSLAVIGPFLFTGLR
FT                   FLLGAAVLVPLLCANGAARAHCATLARERTRLLPGLALGGLLAVSISLQQIGLQYTKIA
FT                   NAGFISSLYVVLVPVIGVFFRHRTGIGTWLGALLAAIGLYFLSVDAHFSMLYGDWFQLA
FT                   GAIVIAFHVIAVGHLVRRHDPLVLSFMQFVVCGALCLALGLAIEPLDRATLTRALPTLL
FT                   YGGLLSVGVGYTLQVVAQRDAAPAHAAVIFSMEGVFAAIAGWAALGETLSLRALAGCAL
FT                   MIAGLLVCQLLPGHARRASDNALAA"
FT   gene            complement(283595..284512)
FT                   /locus_tag="BMA10247_A0323"
FT   CDS_pept        complement(283595..284512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0323"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02205"
FT                   /protein_id="ABO02205.1"
FT                   /translation="MNRHQCTFHPFPFEMKPLDLDAVRAFVLVAELASFTRAADALGTT
FT                   QSAVSLKLKRLEAQLGKPLLERTPRRVTLAAVGAAFLPAARELLDAHERALAALSSAQR
FT                   RLVIGVSEHVAVPDLPAVLTGLNRHDPGLALEMHVGMSAGLLAQYDERRLDAAFVRHEP
FT                   GEDPPRDDATLLFTEPLAWLAAPGWTPRADEPLPLAVLAGPCGVRAAALRALERAGVRW
FT                   RERFTGGGVAAVAAAAAAGLAVCPLARRVAPRSLVDVGARLRLPALPDSQVALYSRVRD
FT                   ARSIDTLRRFADSLAGPAQSAGRE"
FT   gene            284568..284951
FT                   /locus_tag="BMA10247_A0324"
FT   CDS_pept        284568..284951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0324"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /EC_number="5.3.2.-"
FT                   /note="identified by match to protein family HMM PF01361"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02890"
FT                   /protein_id="ABO02890.1"
FT                   /translation="MPFTRIALREGKSAEYRRALSEGVHCALQHAFAVPVDDIFMTVTE
FT                   HSADNFFYGRDYLGIARSDDLVMIQITANNTRTLEQKRELYRLIADQLAQRPGVRREDV
FT                   FVSLVEVLKEDWSFGNGIAQYVS"
FT   gene            285149..287071
FT                   /locus_tag="BMA10247_A0325"
FT   CDS_pept        285149..287071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0325"
FT                   /product="CHAD domain protein"
FT                   /note="identified by match to protein family HMM PF05235"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03855"
FT                   /protein_id="ABO03855.1"
FT                   /translation="MARVLEIVLDFSLQDWQATRGARVRAARDLGAELARAWRICPPVK
FT                   MRRGHERVTIEPCRFVEAQPNDGGRWQTWIETTAQARRVLAARCRPFVPGVTVREHFDD
FT                   YRGDVRVATPLADEQAPIAAGSTPVPRDSAAAARDVRDGGDAPPSRGRASRAAAARTAA
FT                   RAAASTPVAPDADVSGAADASGSSRSSTSGSASESAAESASDSVSAESTAPSAGAVPVG
FT                   DAVAGTASLESGSTARPAPDFVVERRRGRWLGADGIEVELTLDDIVFAPAAASSDTIRA
FT                   VASRVCELRLAVADPDDPDARAAALRALFNAARELSGAWPASLSPISVLDRACAVDAPD
FT                   ANGAPAKAQSVDLSNTRTQRAAFFALGCSVTGQWLGNEAGVRDTAEPEYVHQMRVALRR
FT                   LRTLARLFPRYADAAWKDAFSGDIRWLAGMLGAVRDWDVCVTSTLPALAAADGDEAAWA
FT                   GTLDAARAQGDAARAELRQALGTARYTRLVFAWLEWLSLFPLGEDDPARGKAPSLKRHA
FT                   AKRVSRLFGHLYGARRLTALDAAARHRVRIDAKRLRYALEFFSSLASRRTREDMVRLLA
FT                   RVQNALGDANDATVALRCLERLSALPYQLGFARGYGAAAQRYAAEAAEQLLRGMRAPKI
FT                   GGRKA"
FT   gene            287106..287954
FT                   /gene="modE"
FT                   /locus_tag="BMA10247_A0326"
FT   CDS_pept        287106..287954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modE"
FT                   /locus_tag="BMA10247_A0326"
FT                   /product="transcriptional regulator ModE"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03459; match to protein
FT                   family HMM TIGR00637; match to protein family HMM
FT                   TIGR00638"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02135"
FT                   /protein_id="ABO02135.1"
FT                   /translation="MTADSLSSRSDARAARESLALSGELWLHAGGQTLGGAARIALLAA
FT                   IGETGSITRAAKAVGLSYKGAWDAIDTMNNLAGEPLVLRATGGKGGGGTTLTPRATALI
FT                   AAFRAIEREHRRFIDAASAAVEGFEVNWKLIGRIGMKTSARNQLFGKVLAVKHGAVNDE
FT                   VVLALPGEHTITAVVTHESVQELGLAPGVDACALVKASWVVLAVEDGSPLRLSARNQLQ
FT                   GVVETVTRGAVNSEVLLALDGGMTLAAIVTNDSVDALGLAQGVSAVAAFKASSVILAVN
FT                   G"
FT   gene            complement(288343..288501)
FT                   /locus_tag="BMA10247_A0327"
FT   CDS_pept        complement(288343..288501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0327"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01620"
FT                   /protein_id="ABO01620.1"
FT                   /translation="MTMAPLDAPNRPAAAEGWRRSACAASAPPSAALRSRRQRDAATAD
FT                   ARAPLYA"
FT   gene            complement(288498..289199)
FT                   /gene="modC"
FT                   /locus_tag="BMA10247_A0328"
FT   CDS_pept        complement(288498..289199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="BMA10247_A0328"
FT                   /product="molybdate ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02948"
FT                   /protein_id="ABO02948.1"
FT                   /translation="MSLVVDIRKTLVTPERHFTLDVSFASNAQRIVLFGPSGAGKSLTL
FT                   QAIAGLLAPDRGTISIGGDTLFDGARGIDVPTQARRVAYLFQDYALFPHLNVRQNIAFG
FT                   LKRGWRNPRAQELPDDAAYWLRAFELEALAGHYPAQLSGGQKQRVALARALIAQPRILL
FT                   LDEPFSALDVAMRQRMRRELTDLQMRLDIPMVLITHDPDDVAAFGDQVVRLQEGRVLPD
FT                   TPIAEWVTNMR"
FT   gene            complement(289201..289875)
FT                   /gene="modB"
FT                   /locus_tag="BMA10247_A0329"
FT   CDS_pept        complement(289201..289875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="BMA10247_A0329"
FT                   /product="molybdenum ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02141"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03505"
FT                   /protein_id="ABO03505.1"
FT                   /translation="MHDAWVPLLLSLKVAGWATALDLVLGVAAGYALARWRSGARDVVD
FT                   SLLTLPLVLPPTVLGYYLLVLLGRRGVLGAWLDRIGIQLVFTWQGAVIASMVVAFPLIL
FT                   KSARAAFEAVDPQLERAARTLGISETGIFFRVTLPLAARGILAGALLAFARALGEFGAT
FT                   LMIAGNLPGRTQTLSVAVYAAVQAGDDATANFLVLVTSATCVLILLIAGRLVPQRALAA
FT                   AR"
FT   gene            complement(289888..290640)
FT                   /gene="modA"
FT                   /locus_tag="BMA10247_A0330"
FT   CDS_pept        complement(289888..290640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="BMA10247_A0330"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR01256"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01633"
FT                   /protein_id="ABO01633.1"
FT                   /translation="MLSALVAGFAAPAAHAADELVVSAAASLTNAFKAVGDAYEKQHPG
FT                   TKILFNFGASDVLMQQIAKGAPADVFASADQKAMDRAAAERVIADGTRRDFAANSLVLI
FT                   VPADSRATFGSLRDLTAPAVKRVAFGDPASVPVGRYTEGALKAAGVWNDVGVKGVLAAN
FT                   VRQSLDYVARGEVDAGFVFGTDAAVMPERVKVALTVPTQTPITYPIAVVKDSRHAAAAQ
FT                   GFVAFVLSPAGQAVLAKYGFKPAAGGAN"
FT   gene            complement(291129..291827)
FT                   /locus_tag="BMA10247_A0331"
FT   CDS_pept        complement(291129..291827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0331"
FT                   /product="membrane protein, PAP2 family"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02285"
FT                   /protein_id="ABO02285.1"
FT                   /translation="MFDLPPRLWISITALGGAGLTLPLAVTIAVWLALGYSLRRAAAWL
FT                   AVLGTAIGAVALTKIAFLGWGIGVRAWDFTGFSGHAMLSTSVYPVAMFLALARARPAVR
FT                   VAGVVVGLAAGVAVGLSRVALDAHSPSEAVTGCVIGALAALSFIAGSWRAMPHRWSAPA
FT                   VATSLVAVTIALHGITVPSHRWVTAVALQLSGHERPYVRARWKANPNYRPASRPTQQQT
FT                   LGAPAAVERA"
FT   gene            292132..293226
FT                   /locus_tag="BMA10247_A0332"
FT   CDS_pept        292132..293226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0332"
FT                   /product="polyhydroxybutyrate depolymerase domain protein"
FT                   /note="identified by match to protein family HMM TIGR01840"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03299"
FT                   /protein_id="ABO03299.1"
FT                   /translation="MPNARTSASALKAAQKMTADWPFAETMAAAAAASVASVAASADTV
FT                   PPAARESRVRPRAAAWAGGEWIRADHPLPPAFGRFVKHLEYGLYVPSGAKTLGLPLVVM
FT                   LHGCKQDMNQFSQGTRMNLLADRYGFAVLYPEQSLSAHAHGCWHWYEDTVHGGRGEAQA
FT                   VVALVDALVAERGFDASRVYAAGMSAGAGLVSLLALHFPRRFAAVALHSGPAFGDAHSG
FT                   ITAMDVMRRGLHRDPAAVVDALVEPGAHPGMPAFIVHGDDDRVVVPKNADELAVQFLRL
FT                   NGLADADGEPAGVERFETRAADVRTLDYRRDGESVVRLCRVHGLAHAWAGGDDSVPFHS
FT                   AAGPDASELIWSFFASRERAAVAS"
FT   gene            293323..293481
FT                   /locus_tag="BMA10247_A0333"
FT   CDS_pept        293323..293481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0333"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03836"
FT                   /protein_id="ABO03836.1"
FT                   /translation="MYLLSRLFLFLTKSPEQRAKERADAYLAGASDLYDLEFRMRKLDR
FT                   EAALDRA"
FT   gene            complement(293594..294013)
FT                   /gene="ohr"
FT                   /locus_tag="BMA10247_A0334"
FT   CDS_pept        complement(293594..294013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohr"
FT                   /locus_tag="BMA10247_A0334"
FT                   /product="organic hydroperoxide resistance protein"
FT                   /note="identified by match to protein family HMM PF02566;
FT                   match to protein family HMM TIGR03561"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01992"
FT                   /protein_id="ABO01992.1"
FT                   /translation="MNILYKTAATSTGGRDGRATSHDQKLDMKLSAPRELGGAGAEGTN
FT                   PEQLFAAGYSACFLSAMKFAAGQNKQTLPADTTVTAEVGIGPNEEGGFALDVELRVALP
FT                   GLDAAAAKTLVDRAHHVCPYSNATRNNVAVRLVVA"
FT   gene            complement(294151..294627)
FT                   /locus_tag="BMA10247_A0335"
FT   CDS_pept        complement(294151..294627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0335"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02509"
FT                   /protein_id="ABO02509.1"
FT                   /translation="MRFTDASAMNDSPTFPLTLDDQLCFALYSTSLAMTKAYKPLLDKL
FT                   ALTYPQYLAMLVLWETDDMAVKDIAARLSLDPATVTPLLKRLEALGYIERVRDTNDERI
FT                   VHARLTADGAALKHKARAVPAELFCAMRQTPDFLIRLREDLTRLRQALTDADGA"
FT   gene            complement(294600..295109)
FT                   /locus_tag="BMA10247_A0336"
FT   CDS_pept        complement(294600..295109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0336"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01982"
FT                   /protein_id="ABO01982.1"
FT                   /translation="MNVPAASGGPAARLPEPLAQAVARLRTADGAATDVLTRQTPRQHH
FT                   SSEGIGVRPTAMPQRRERAPLHAERPRRGVFSRLLPFSAVFHCGHALRRPVPAAHARPA
FT                   CAIGQCRRHRLPVIVREIAAGEAPHRSSDSSSPFPADARGPSPIGVIGRKIISTRIFCA
FT                   LLTLPP"
FT   gene            complement(295106..295918)
FT                   /locus_tag="BMA10247_A0337"
FT   CDS_pept        complement(295106..295918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0337"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02099"
FT                   /protein_id="ABO02099.1"
FT                   /translation="MQLIEVSAKTGYVWFRQGIWLFRRNPLAFVTLFFTYLLAMMLVSL
FT                   VPVIGAALPLLLIPGIAVGFMAACRDTIAGKQVLPTILIDGFRSYGPTVTQRLLALGGL
FT                   YIVSMAAVFACSALGDGGTLLKIMFGLGAENLGPEALDSPGVRIAVLIAAALYAPVAMM
FT                   FWFAPVLTAWHDVPPVKALFFSVVSCWRNKGAFTVYGLLWFALALGVSFGLAALMQALG
FT                   ASAYALTVMMPASIVITAMLYCSFYATYRGCFGVQEPGAQSPPNASGR"
FT   gene            complement(295909..296904)
FT                   /gene="thrB"
FT                   /locus_tag="BMA10247_A0338"
FT   CDS_pept        complement(295909..296904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="BMA10247_A0338"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="identified by match to protein family HMM PF01636;
FT                   match to protein family HMM TIGR00938"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02781"
FT                   /db_xref="GOA:A3MBA7"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MBA7"
FT                   /protein_id="ABO02781.1"
FT                   /translation="MAVFTAVSDADLALWMRHYDLGDVVAFRGIPSGIENSNFFLTTTR
FT                   GEYVLTIFENLTAGQLPFYVDLMSHLAKHGVPVPAPVARDDGTLFGELHGKPAAIVTKL
FT                   EGAAQLAPGVEHCVEVGQMLARMHLAGRDYPRHQPNLRSLPWWRDTVPAIAPFVTGEQR
FT                   ALLEGELAHQAAFFASDDYAALPEGPCHCDLFRDNALFAHAEPDTGHSVRLGGFFDFYF
FT                   AGCDKWLFDVAVTVNDWCVDLPTGALDAARADALLRAYQTVRPFTAGERRRWGDMLRAG
FT                   AYRFWVSRLYDFHLPRAAQMLKPHDPGHFERILRERIAHAGALPETHACN"
FT   gene            complement(296998..297396)
FT                   /locus_tag="BMA10247_A0339"
FT   CDS_pept        complement(296998..297396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03116"
FT                   /protein_id="ABO03116.1"
FT                   /translation="MKPLLFAAALTALALVGPARAADAAQAAADAKAQAAANEAAGLPD
FT                   LTKINRPGAEVTSKVDFNDVRRTPSFHEKSKNGTEVTEFRDRGKPVEINVKSNFGTRYQ
FT                   MSASPDTSPRPHDAGVPVTRLPSVNLHY"
FT   gene            297319..297537
FT                   /locus_tag="BMA10247_A0340"
FT   CDS_pept        297319..297537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0340"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03841"
FT                   /protein_id="ABO03841.1"
FT                   /translation="MCGVGGAGGADEGECRQGGGEKERLHRVSPIEPFDFSKYRRRADA
FT                   VRRCASGLAAAMGIGCASGFRDNVETI"
FT   gene            297552..299078
FT                   /gene="amn"
FT                   /locus_tag="BMA10247_A0341"
FT   CDS_pept        297552..299078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amn"
FT                   /locus_tag="BMA10247_A0341"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /note="identified by match to protein family HMM PF01048;
FT                   match to protein family HMM TIGR01717"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01652"
FT                   /protein_id="ABO01652.1"
FT                   /translation="MKNDPNRRSRTRTPGSPCVEAFDDPIAAVARLSEIYETNTAFLRD
FT                   AFARYRGNEAFDEHVRACYPFVRIRTDVNTHIDSRRSYGFVAGPGVFETTVTRPDLFAN
FT                   YYREQLRLLAKNHHVRIEVGVSAQPIPVHFAFSEGIHLEGDLDRDRLVAMRDVFDTPDL
FT                   AYLDDRIVNGTYEPAPGEPHPLALFTAARVDFSLHRLRHYTATLPTHFQNYVLYTNYQF
FT                   YIDEFVKLGRTMMSASDDPEVRAYRSEYTAFVEPGDVITYNANLGEDASEGTPPPRLPQ
FT                   MPAYHLKRADGSGITMVNIGVGPSNAKTITDHIAVLRPHAWVMLGHCAGLRNTQRLGDY
FT                   VLAHGYVREDHVLDADLPLWVPIPALAEVQVALERAVAQVTQLEGAELKRVMRTGTVAS
FT                   VDNRNWELRDHREPVQRLSQSRAIALDMESATIAANGFRFRVPYGTLLCVSDKPLHGEL
FT                   KLPGMADQFYRGQVDQHLQIGVKAMEILRTNGLDRLHSRKLRSFAEVAFQ"
FT   gene            complement(299162..299848)
FT                   /locus_tag="BMA10247_A0342"
FT   CDS_pept        complement(299162..299848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0342"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03318"
FT                   /protein_id="ABO03318.1"
FT                   /translation="MIFAHAVRRGLRDRNPAREIGSAKETKRDRYITDDELDTVRAAIV
FT                   ASADDKTSSARSFLCLIDLAYQTAQRIGDLLALNWQDVSDDGISFRPSQTVNRSGVRLL
FT                   IEMTPDLQETLNRARGGKIASIGPMICTHASGCYTYIGAYSGWKRACLRARSAYEKDWK
FT                   KKGITPNPKYLIGMHFHDPRAKALTDPKRQQGAAAAQSLAGHTTESMTAPLHEIARSGT
FT                   RPASPH"
FT   gene            complement(299845..300132)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0343"
FT                   /note="portal protein, PBSX family, truncation; comparison
FT                   of this gene to its homologs suggests this gene has been
FT                   truncated"
FT   gene            300157..300390
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0344"
FT                   /note="bacteriophage tail completion protein S; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            complement(300689..301522)
FT                   /locus_tag="BMA10247_A0345"
FT   CDS_pept        complement(300689..301522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0345"
FT                   /product="A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02448"
FT                   /protein_id="ABO02448.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(301546..301809)
FT                   /locus_tag="BMA10247_A0346"
FT   CDS_pept        complement(301546..301809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0346"
FT                   /product="transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03009"
FT                   /protein_id="ABO03009.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            302309..303259
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0347"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            303579..303698
FT                   /locus_tag="BMA10247_A0348"
FT   CDS_pept        303579..303698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0348"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01788"
FT                   /protein_id="ABO01788.1"
FT                   /translation="MPIMRDKPDASRSASSHPFSSESKRFQVELPGVRVRHSR"
FT   gene            303714..303977
FT                   /locus_tag="BMA10247_A0349"
FT   CDS_pept        303714..303977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0349"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02117"
FT                   /protein_id="ABO02117.1"
FT                   /translation="MRHTLLATLFVSRGHCRRPIRRADHERAVPGGTTKANARATRGRP
FT                   APLPVRMRTKFNGKHATPCAKARFSMSTTRRHVYESLVRIGF"
FT   gene            complement(304413..305096)
FT                   /locus_tag="BMA10247_A0350"
FT   CDS_pept        complement(304413..305096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04463"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02671"
FT                   /protein_id="ABO02671.1"
FT                   /translation="MEARIACAAGYRAALRSAGWRTRASVSEEAGRPRRSVEAVTGESP
FT                   AAPRTARSGSQPANRRIHIMNKILVSACLAGLPVRYDGSSKTVEDALLHTWRDEGRLVV
FT                   VCPELAAGFGTPRRPAEIRLHRGGGDVLAGAASIWDDTGADVTARFIDGAHHALRQAIA
FT                   HGCRYALLANGSPSCGSGFIYDGTFSGNRHDGSGVAAALLEQHGIRVFAPSKLKALASL
FT                   IERDG"
FT   gene            complement(305564..305848)
FT                   /locus_tag="BMA10247_A0351"
FT   CDS_pept        complement(305564..305848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0351"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03410"
FT                   /protein_id="ABO03410.1"
FT                   /translation="MKRSLIAFALTGAGIALSGAAHAVNVDVNIGTPAPVVVAPAPAPV
FT                   IVAPAPAIVVGWHGDRYWDGHRYWERREWEERHRRRGFCPPGHAKKGEC"
FT   gene            complement(306266..307000)
FT                   /locus_tag="BMA10247_A0352"
FT   CDS_pept        complement(306266..307000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0352"
FT                   /product="decarboxylase family protein"
FT                   /note="identified by match to protein family HMM PF03641;
FT                   match to protein family HMM TIGR00730"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02104"
FT                   /protein_id="ABO02104.1"
FT                   /translation="MIPSLRSLADQERATAKKARASWQMFTIMAEFIEATEYLSEIRPA
FT                   VSIYGSARLKPDSPHYKLTVQIARKLSDAGFAVISGGGPGIMEAANKGAHAGKAPSVGL
FT                   NIELPHEQAGNHFQDISLRFRHFFTRKVTFVKNSDAVIVMPGGFGTLDELSEVLTLIQT
FT                   KKSRLVPIVLVGSAFWSGLLQWFRDQMIPMGLINPDDMNLMKVIDDPDQVLEAVLAFYE
FT                   DRGEETEESHPPRPEEDRMFYL"
FT   gene            307017..309797
FT                   /gene="polA"
FT                   /locus_tag="BMA10247_A0353"
FT   CDS_pept        307017..309797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="BMA10247_A0353"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00476;
FT                   match to protein family HMM PF01367; match to protein
FT                   family HMM PF01612; match to protein family HMM PF02739;
FT                   match to protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02312"
FT                   /protein_id="ABO02312.1"
FT                   /translation="MPEERNLEGKTLLLVDGSSYLYRAYHAMPDLRGPGGEPTGALYGI
FT                   VNMLRRMRKDVSAEYSACVFDAKGKTFRDDLYADYKAHRPPMPPDLALQIEPIHTAVRA
FT                   LGWPLLMIEGVEADDVIGTLAKQAEQHGMNVIVSTGDKDLAQLVTDRVTLINTMTNEAL
FT                   DRDGVLAKFGVPPERIVDYLSLIGDTVDNVPGVEKCGPKTAVKWLTQYGSLDGVVEHAG
FT                   EIKGGVGDNLRRALDFLPLARKLVTVETGCELAPHVESFDASLATDGEGRDALREIFAK
FT                   YGFKTWLRELDSEPAAAAGAAGAAAAGAAPDPASGATAELPLATARNYATVQTWEQFDA
FT                   WLAKISAAELTAFDTETTSLDPMRAEIVGLSFSVEPGHAAYVPVAHRGPDMPAQLPRDE
FT                   VLAKLTPWLEDAGKKKLGQHLKYDAQVLANYGIALNGIEHDTLLESYVLESHRTHDMDS
FT                   LALRHLGVKTIKYEDVAGKGAQQIGFDEVPLAQASEYAAEDADITLQLHHALYPQIARE
FT                   PGLTRVYRDIELPVSLVLRKMERTGVLIDGDRLSRQSGEIATRLVALEQEAYALAGGEF
FT                   NLGSPKQIGQIFFERLQLPVVKKTPSGAPSTDEEVLQKLAEDYPLPKLLLEHRGLSKLK
FT                   STYTDKLPRMVNPDTGRVHTNYAQAVAVTGRLASNDPNLQNIPVRTTEGRRIREAFVAP
FT                   PGSKIVSADYSQIELRIMAHISEDESLLRAFAHGEDIHRATAAEVFGVTPLEVTSDQRR
FT                   IAKVINFGLIYGMSSFGLASNLGITRDAAKLYIDRYFLRYPGVARYMEETRMRAKEKGY
FT                   VETVFGRRLWLPEINGGNGPRRQAAERAAINAPMQGTAADLIKLSMIAVDDWLERGGLR
FT                   ARMIMQVHDELVLEVPEDELSIVREKLPEMMCGVAKLKVPLVAEVGVGENWEEAH"
FT   gene            310116..311498
FT                   /gene="ndh"
FT                   /locus_tag="BMA10247_A0354"
FT   CDS_pept        310116..311498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="BMA10247_A0354"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02875"
FT                   /protein_id="ABO02875.1"
FT                   /translation="MHRFIIVGGGAGGLELATRLGDRYGARGDRPARALVTLVDRYPTH
FT                   IWKPLLHEVAAGSMDPFTQELEYAAQARWHGFEFHQGELIALDRASRRVTLAPVADNDG
FT                   AELLPLRELEYDTLVIAIGSTTHYFGVQGAQQHSIALDTVAEAERFRKRLIAACMRAEH
FT                   QPAEPAVRTAEGGPEQAVEPTDAAQVSASPRIQVAIVGGGATGVELSAELRNTAQVLSA
FT                   YGLHKLDPRHDVGIVLIESGPRILPALQERVSTATAELLEKLGVRLLLGERVTEVAPGV
FT                   VRTASGKSVRADLTVWAAGIKAPSVLAKLDGLEVNKLGQLAVRRTLQTETDPDVFAFGD
FT                   CAGCEWPGHERNVPPRAQAAHQQASFMLRALANRLEGRPLPEFTYRDFGSLVSLGHFSA
FT                   VGNLMGGLIGGNMLIEGLFARFMYMSLYRLHIAALHGYPRMVLDTVAHWLRRSTLPRVK
FT                   LH"
FT   gene            311672..311845
FT                   /locus_tag="BMA10247_A0356"
FT   CDS_pept        311672..311845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02380"
FT                   /protein_id="ABO02380.1"
FT                   /translation="MCGSTVGRAAESVEGACVVTIAWTGGAKPAAAPLPVGRRRSSSVT
FT                   RCPFAVRSAHRQ"
FT   gene            complement(311839..313701)
FT                   /locus_tag="BMA10247_A0355"
FT   CDS_pept        complement(311839..313701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03661"
FT                   /protein_id="ABO03661.1"
FT                   /translation="MTPLDRASRRQRHATPTKHYEVGMNEPTRQTTGDLSERRGPNRRR
FT                   RAPRSPARQRGSLAIIAAIAIGVVIAALGAVDLGNLFYQRRALQSIADLAALAAAQTMD
FT                   DGCAKPAATAQSAALGNGFDSTASGQSMTVVCGRWDVKDNVGPSFFAGSASGAAAGSDA
FT                   QLNAVQVTVTRAVPYYFLGAQRTIAATSTAEATNVGAYSIGTTLAQLQGGVANALLNGL
FT                   LGANLNLSVLSYQGLANARIRIKDLMAAANVGTVSALLSTQTTVPQLANWMLSALSQTS
FT                   VANADLQTSIGALQTIVSANIPGGRTFTIGNTANSAGIFSIGLSNPQAALDATFSPFDA
FT                   LLVAAEIATGQTAFSLANGLNIGGLNANLQVQIIQPPVLGIGEAGIDPVTKTWRTIART
FT                   AQVRLYLNIGLGTANLPLGLLGALLPVQVNLPLSLQIAPGQAWLQSASCTASPSTCASA
FT                   IGVQTGLTNLCIGDTPANMSASLPFTCSTPATLVNVANLVTIKSLVSFPADVPASQTPT
FT                   LTFYGTTGGYQSTNSNGVGSVLGNALSGLGASLQQTQISLFGISLPLGPIQTALNSFLG
FT                   GVLPPLLSGLDAAIVPLLQLLGVQVGESTIHDMSLTCGVSQLVY"
FT   gene            313921..314193
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0357"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            314346..315221
FT                   /locus_tag="BMA10247_A0358"
FT   CDS_pept        314346..315221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0358"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="identified by match to protein family HMM PF01738;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02953"
FT                   /protein_id="ABO02953.1"
FT                   /translation="MLKPEVDSLVPHVPFSRRKFVQAALGGTFAAAVLPVSAQTITTDA
FT                   AGLDVDTVQIRSGDASVPAYRAQPDGKSNLPVIVVIHEVFGVHAHIADICRRFAKLGYL
FT                   AIAPDLYARQGDPSKHASIQELIDQVVSKVPDRQVIEDLDATVRWAGKNGGDLSRLGVT
FT                   GFCWGGRQTWLFAEHNPHVRAAVAWYGKVAGETNEMTPFNPDDHAAQLKAPTLGLYGGK
FT                   DDSISQRSLARMRERLAAAGTQAARESEIVVYPDAGHAFFADYRPSYVKADADDGWKRA
FT                   IAWFRHHGVM"
FT   gene            complement(315280..316149)
FT                   /locus_tag="BMA10247_A0359"
FT   CDS_pept        complement(315280..316149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0359"
FT                   /product="rhodanese domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02563"
FT                   /protein_id="ABO02563.1"
FT                   /translation="MPHTHYTTLISADNLAERLAAAPGSVLVFDCRFDLADTDLGEQAY
FT                   AAGHIPGAHYLHLDRDLSGAKTGTNGRHPLPARDALVDTLKAHGLRQNQQIVAYDAQGG
FT                   MYAARLWWLLRWLGHDSVAVLDGGLQAWQSEGHAVSQDTPPKSMGDFRAGAPLATVVDA
FT                   QTVLANLATKDRLVIDARAADRYRGENETIDRVGGHIPGALNRFFKDNLTADGRFKSGH
FT                   ELREAFSPLLGATEPKKVILQCGSGVTACHNALAMEIAGLHDPALYAGSWSEWSADPSR
FT                   PVATGANP"
FT   gene            complement(316274..317755)
FT                   /locus_tag="BMA10247_A0360"
FT   CDS_pept        complement(316274..317755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0360"
FT                   /product="ISBma2, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01927"
FT                   /protein_id="ABO01927.1"
FT                   /translation="MFFNGVMLKTPMPTQHELEMVTLEELVPKDHLLRQIDAAVDFEFI
FT                   RAKVAHLYCADNGRPALDPVVMFKLLFIGYLFGVRSERQLMREVQVNVAYRWFARFRLT
FT                   DKVPDASTFSQNRRRRFTDTTVYQEIFDEIVRQAIKRGLVDGRVLYTDSTHLKANANKG
FT                   KFDVVKLEQTPAAYTEALNAAVDADRAAHGRKPLDRDDDEPPSSKDTKLSRTDPDSGYM
FT                   VRDDKPKGFFYLDHRTVDAKHAIITDTHVTPASVHDSQPYLDRLDRQRERFEFKVEAVG
FT                   LDAGYFTPAVCQGLEERGIAGVMGYRTPNHKPGMFYKRQFKYDAYRNEYVCPQGQALPY
FT                   STTNRLGYREYKSNAQICGRCPVRSQCTNSAIAVKVVTRHVWERAKERVDARRLTEWGQ
FT                   RIYARRKQTVERSFADAKQLHGHRYARMRGLRKVAEQCLLAAAAQNIKKIAMLLARKRK
FT                   KGPAGPDWRFVRMLLRLVSGLRCSFDYPLAANPQS"
FT   gene            complement(317888..318994)
FT                   /locus_tag="BMA10247_A0361"
FT   CDS_pept        complement(317888..318994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0361"
FT                   /product="iron-sulfur cluster-binding protein, Rieske
FT                   family"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03356"
FT                   /protein_id="ABO03356.1"
FT                   /translation="MSNLSDALQLKSAHSQLPVTAYFDEALLAREIETLFKKGPRYVGH
FT                   ELMVPEAGDYFALPSEDEGRVLVRNQASQIELLSNVCRHRQAIMLNGRGRTQNIVCPLH
FT                   RWTYDLEGQLLGAPHFPDKPCLNLHATPLQHWQGLLFEAEGRDVAHDLAQLGTKHHFDF
FT                   SDYLFDHVEIHECNYNWKTFIEVYLEDYHVVPFHPGLGSFVSCDDLKWEFGDWYSVQTV
FT                   GVHNALAKPGSPTYQKWHDQVLRYRNGVPPEFGAIWMVYYPGLMIEWYPHVLVVSWLIP
FT                   RGPQKTTNIVEFYYPEEIALFEREFVEAERAAYMETAIEDDEIAWRMDAGRRALMERGE
FT                   SQVGPYQSPMEDGMQHFHEFLRRQLGAI"
FT   gene            319264..319557
FT                   /gene="xseB"
FT                   /locus_tag="BMA10247_A0362"
FT   CDS_pept        319264..319557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="BMA10247_A0362"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF02609;
FT                   match to protein family HMM TIGR01280"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02519"
FT                   /db_xref="GOA:A3MBD0"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MBD0"
FT                   /protein_id="ABO02519.1"
FT                   /translation="MAKTATPGACASDPGSGPLPENYEMALAELEALVARMEGGTLSLE
FT                   DSLAAYRRGAALVAFCQQQLEKAEQQVRVLDGASLKPLSAGTAAADGEDDDL"
FT   gene            319554..320438
FT                   /gene="ispA"
FT                   /locus_tag="BMA10247_A0363"
FT   CDS_pept        319554..320438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="BMA10247_A0363"
FT                   /product="geranyltranstransferase"
FT                   /EC_number="2.5.1.10"
FT                   /note="identified by match to protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01983"
FT                   /protein_id="ABO01983.1"
FT                   /translation="MTFDQWMRSVLERVETALGHYLPAGTVAPAQLHEAMRYAVLGGGK
FT                   RVRPLLCHAAGELTGASEAARDAASAALEMIHVYSLVHDDMPCMDDDALRRGKPTVHVK
FT                   YDEPTALLVGDALQSQAFVALTDAAALPADRQAALVRELALASGSIGMAGGQAIDLASV
FT                   GVALTRDALEKMHRMKTGALLRASVRMGALAGETPSGDAMRALDAYAAAVGLAFQVVDD
FT                   ILDVTTDSATLGKTAGKDAANDKPTYVSIIGLDASRALAAQLRADAHAALEPFGARAQR
FT                   LAELADLVVNRVS"
FT   gene            320471..322426
FT                   /gene="dxs"
FT                   /locus_tag="BMA10247_A0364"
FT   CDS_pept        320471..322426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="BMA10247_A0364"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="identified by match to protein family HMM PF02779;
FT                   match to protein family HMM PF02780; match to protein
FT                   family HMM TIGR00204"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01791"
FT                   /protein_id="ABO01791.1"
FT                   /translation="MGAQEVRARLFSYNGTTMYDLLKTIDDPADLRRLDRRQLQPLADE
FT                   LRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPDDRIVWDVGHQTYPHKILTGRRD
FT                   GMKTLRQFDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDRFSIAVIGD
FT                   GAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARA
FT                   GVERVLSVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNI
FT                   KELRGPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEW
FT                   LCDAAELDARVVGITPAMREGSGMVEFEKRFPERYYDVGIAEQHAVTFAGGLATEGLKP
FT                   VVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFLRCIPNM
FT                   TVMAASDENECRQMLHTALQQPNPTAVRYPRGAGTGVATVKAFTEIPLGKGEVRRRTSQ
FT                   PDGKRIAILAFGTMVAPSLAAADALDATVANMRFVKPIDAELVQALARTHDYLVTVEEG
FT                   CVMGGAGSACVEAMMESGAVRPVLQLGLPDRFVDHGDPAKLLSLCGLDGDGIAKSIRER
FT                   FLSHAADVASPAKRVA"
FT   gene            322541..323386
FT                   /locus_tag="BMA10247_A0366"
FT   CDS_pept        322541..323386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0366"
FT                   /product="conserved hypothetical protein TIGR00294"
FT                   /note="identified by match to protein family HMM PF02649;
FT                   match to protein family HMM TIGR00294"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02353"
FT                   /db_xref="GOA:A3MBD3"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MBD3"
FT                   /protein_id="ABO02353.1"
FT                   /translation="MSRRMTLQGSNKMNLMNPEFAMPDVQSTVDTRQMPIQRVGVRAVR
FT                   HPLTVRTAEGETQATVGTWNLDVHLPADQKGTHMSRFVALLEERGGPLTADAFRTMLAT
FT                   MLEKLEARAGRIEVSFPYFVNKTAPVSGVRSLLDYEVTLTGDVRDGLTRVFAKVLVPVT
FT                   SLCPCSKKISQYGAHNQRSHVTIDAELAADVPVEDLIRIAEEEASCELWGLLKRPDEKF
FT                   VTERAYENPKFVEDLVRDVARRLDADERIVAYVLEAENFESIHNHSAYALIERDKRRGA
FT                   "
FT   gene            complement(323338..323610)
FT                   /locus_tag="BMA10247_A0365"
FT   CDS_pept        complement(323338..323610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0365"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02987"
FT                   /protein_id="ABO02987.1"
FT                   /translation="MPPDIMLARHASRRRSSPNAVAGRAVNCLHTQTATGLRRPRRTHT
FT                   HRRHAQTKKAVRFERPLPRIRRTPPRDSGAHAPRRLSRSISAYAL"
FT   gene            complement(323777..324856)
FT                   /gene="gcp"
FT                   /locus_tag="BMA10247_A0367"
FT   CDS_pept        complement(323777..324856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="BMA10247_A0367"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02679"
FT                   /protein_id="ABO02679.1"
FT                   /translation="MRTRASMRPPHTIMLVLGIESSCDETGLALYDTERGLLAHALHSQ
FT                   IAMHREYGGVVPELASRDHIRRALPLLEEVLAASGARRDDIDAIAFTQGPGLAGALLVG
FT                   ASIANALAFAWDKPTIGIHHLEGHLLSPLLVAEPPPFPFVALLVSGGHTQLMRVSDVGV
FT                   YETLGETLDDAAGEAFDKTAKLLGLGYPGGPEVSRLAEAGTPGAVVLPRPMLHSGDLDF
FT                   SFSGLKTAVLTQMKKLEAAHAGGAVLERAKADLARGFVDAAVDVLVAKSLAALKATRLK
FT                   RLVVAGGVGANRQLRAALSAAAQKRGFDVHYPDLALCTDNGAMIALAGALRLARWPSQA
FT                   SRDYAFTVKPRWDLASLAR"
FT   gene            324957..326180
FT                   /locus_tag="BMA10247_A0368"
FT   CDS_pept        324957..326180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0368"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF03486; match to protein
FT                   family HMM PF07992; match to protein family HMM TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01998"
FT                   /protein_id="ABO01998.1"
FT                   /translation="MEKFDIAVIGAGAAGMMTAAVAGQLGRRVVLLDHSPRLAEKIRIS
FT                   GGGRCNFTNLYAGPDNYLSANPHFCRSALARYTPRDFLGLLKNHRVTWHEKHKGQLFCD
FT                   HSSDAIIDVLKSECDAGGVAWRRPVTVDAVRHAQADGFALDTSAGAIGAQALVVATGGL
FT                   SIPKIGATDFAYRIAKQFGHKLVDTRPALVPLTFSADAWAPFAALSGVSLEARVSTGAK
FT                   RGGGEFVEDILLTHRGLSGPGILQISSYWRSGEPIHVDLAPQIDAANELIRAKAGSRRQ
FT                   IGTLLAEWVPARLAHAWLEAERVHADARLADLPDKTLRRIGETLSRWTLTPSGTEGYRK
FT                   AEVTKGGVDTRELSSATMMSERVPGLFFVGEALDVTGWLGGYNFQWAWASGVAAGRAAA
FT                   DGTRRLTG"
FT   gene            326260..326472
FT                   /gene="rpsU"
FT                   /locus_tag="BMA10247_A0369"
FT   CDS_pept        326260..326472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="BMA10247_A0369"
FT                   /product="30S ribosomal protein S21"
FT                   /note="identified by match to protein family HMM PF01165;
FT                   match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01595"
FT                   /protein_id="ABO01595.1"
FT                   /translation="MTIIRVKENEPFEVAMRRFKRTIEKNGLLTELRAREFYEKPTAER
FT                   KRKKAAAVKRHYKRIRSQMLPKKLY"
FT   gene            326639..327085
FT                   /locus_tag="BMA10247_A0371"
FT   CDS_pept        326639..327085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0371"
FT                   /product="GatB/Yqey family protein"
FT                   /note="identified by match to protein family HMM PF09424"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02971"
FT                   /protein_id="ABO02971.1"
FT                   /translation="MSLRDQISEDMKAAMRAKESERLATIRLLLAAIKQREVDERVTLD
FT                   DAGVTAVVDKMIKQRKDSISQFEAAGRTDLVEKEQAEVAVLSAYLPAQLSDAEVAAEVQ
FT                   AAVAQTGAAGPQDMGKVMGVLKGKLAGRADMTAVSALVKAALSK"
FT   gene            complement(327063..327191)
FT                   /locus_tag="BMA10247_A0370"
FT   CDS_pept        complement(327063..327191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0370"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03924"
FT                   /protein_id="ABO03924.1"
FT                   /translation="MRNHRWIDRKTCRPTRAAAAGAGRLNDARAPCRREVTSRAPP"
FT   gene            327180..329054
FT                   /gene="dnaG"
FT                   /locus_tag="BMA10247_A0372"
FT   CDS_pept        327180..329054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="BMA10247_A0372"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF01807; match to protein
FT                   family HMM PF08275; match to protein family HMM TIGR01391"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02266"
FT                   /protein_id="ABO02266.1"
FT                   /translation="MIPHSFLQDLLNRVDIVDVVGRYVQLKKGGANFMGLCPFHNEKSP
FT                   SFTVSPTKQFYHCFGCGAHGTAIGFLMEHAGLTFPEAVQELAQSVGLTVPHEPSPMRGG
FT                   GGSSDGHAPPAASKSVTTALSDVMQTACDYYRKQLRGAPNAIQYLKRRGLTGEIALRFG
FT                   LGYAPDGWQNLEAAFDDYRHDSLVDAGLVIVSEKTDANGVARRYDRFRERIMFPIRNVK
FT                   GQVIGFGGRVLDGGEPKYLNSPETPLFNKGSELYGLFEARLAIREHKYALVVEGYMDVV
FT                   ALAQLGFPNAVATLGTACTPIHVQKLLRQTDTVVFSFDGDAAGRRAARRALEACLPHAA
FT                   DNRTIRFLFLPPEHDPDSYVREFGTDAFSEQVKRAMPLSQFLLNEATAGKELDQPEGRA
FT                   KALFDAKPLLQALPANALRAQIMHMFADRLQIPFDEVAALAEVDARIAAPARQAPARNE
FT                   RRRVTESEKRALRNLVMHPRIAAAIDDESVATLRALPRIGELFDEVIGHARALGDGAEF
FT                   RLLSDVLRNSANAPTYDEIFREILVYNENVRDLMQQNPESDAAQEGLRERERIAGEELQ
FT                   AAVLKMRYDACCDRLNSLSKRSAPSSEELAEIKDLHQNLADMKRRLGL"
FT   gene            329498..331540
FT                   /gene="rpoD-1"
FT                   /locus_tag="BMA10247_A0373"
FT   CDS_pept        329498..331540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD-1"
FT                   /locus_tag="BMA10247_A0373"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="identified by match to protein family HMM PF00140;
FT                   match to protein family HMM PF03979; match to protein
FT                   family HMM PF04539; match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF04546; match to protein family HMM TIGR02393;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03575"
FT                   /protein_id="ABO03575.1"
FT                   /translation="MTKKLNEVSVDDDANQSDDQPTAASGKGEKAKARDRRAKEKALLK
FT                   EAFATSTPGTAEELEERRTKLRALIKLGKERGFLTYAEINDHLPDNFTETEALEGIIGT
FT                   FNDMGVAVYEQAPDAETLLLNDNAPAASSDDEVEEEAEVALSTVDSEFGRTTDPVRMYM
FT                   REMGTVELLTREGEIEIAKRIEDGLRHMVMAISACPTTIADILAMAERVANEESRVDEL
FT                   VDGLIDPNAADTDGFSEKDAEEIENEDAEAEEDDEEEEEDDDGAAQATANAAQLEALKR
FT                   ASLEKFALISEWFDKMRRAFEKEGYKSKSYLKAQETIQNELMSIRFTARTVERLCDTLR
FT                   AQVDEVRQVERQILHIVVDKCGMPRSEFIARFPGSETDLDWAEKVAAEGHSYGAILSRN
FT                   IPAIREQQQRLLDLQARVVLPLKDLKETNRQMAAGELKARQAKREMTEANLRLVISIAK
FT                   KYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
FT                   IPVHMIETINKMNRISRQILQETGLEPDPATLAEKMEMPEDKIRKIMKIAKEPISMETP
FT                   IGDDDDSHLGDFIEDTNTVAPADAALHASMRDVVKDVLDSLTPREAKVLRMRFGIEMST
FT                   DHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSDKLKSFLEGN"
FT   gene            331664..331739
FT                   /locus_tag="BMA10247_A0374"
FT   tRNA            331664..331739
FT                   /locus_tag="BMA10247_A0374"
FT                   /product="tRNA-Met"
FT   gene            332059..332172
FT                   /locus_tag="BMA10247_A0375"
FT   CDS_pept        332059..332172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0375"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02769"
FT                   /protein_id="ABO02769.1"
FT                   /translation="MALPSAMMSRHAASMTVWALTTLCSFRRCIYCSIWKR"
FT   gene            332222..333055
FT                   /locus_tag="BMA10247_A0376"
FT   CDS_pept        332222..333055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0376"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02385"
FT                   /protein_id="ABO02385.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            333274..333657
FT                   /locus_tag="BMA10247_A0377"
FT   CDS_pept        333274..333657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01843"
FT                   /protein_id="ABO01843.1"
FT                   /translation="MVCVHTGFAERLLGEEAGALTGGCVLDGEDERLLRWVDESGLSVL
FT                   AADNHAVEERPGVLKARERPGALMPLHELCLFKLGIHLGELWRLTPLAQWLREKGRSRF
FT                   LLTAPPLHIRGLVGSPVNPVATV"
FT   gene            333930..334871
FT                   /locus_tag="BMA10247_A0378"
FT   CDS_pept        333930..334871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0378"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01798"
FT                   /protein_id="ABO01798.1"
FT                   /translation="MNLRSIDLNLLVILDALLAERQVTRAGQRIGLTQPAVSNALGRLR
FT                   YVFKDEILMRTPLGMELTPRAKALACPIRQILQQIEELFVPENQFDSFTSDRRFTLRMS
FT                   DLTELLLPPPLLRNIRGTAPHIRMNVMHLNADKTVEALDSGRLDMAVCAGLDHPDAISS
FT                   QVLFQDRLVCVLSRRHPDANRPLTLERFAALDFLNVSINPVDSSLIDTMLADMRFTRRI
FT                   AFNVPHWLVVPSMLDALPLAVIMSERHALSLGDSRLAIRELPLDLEPVTWTLYWHRRYD
FT                   NSVAHEWLRNCITDVVDAIQQRGVFEEASAVG"
FT   gene            complement(334885..335025)
FT                   /locus_tag="BMA10247_A0379"
FT   CDS_pept        complement(334885..335025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0379"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03081"
FT                   /protein_id="ABO03081.1"
FT                   /translation="MRAAGRSIGARAAIGARDTCNPCNARATIGACDARHAMRGGAAPD
FT                   T"
FT   gene            335150..336841
FT                   /locus_tag="BMA10247_A0380"
FT   CDS_pept        335150..336841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0380"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02860"
FT                   /protein_id="ABO02860.1"
FT                   /translation="MRTTKSPGISVIRQRLAVALPLALTLTLASCGGDDLTPAAQRWAM
FT                   PGTELPLGPQGLAQSVSTQTLAAGVAYYQIKRGAASAADFWTVNLGFYATQAAAQADAA
FT                   NLAAAGFATRVDASAGTDLQGKVLGYWLSAGRYATQAEATAAAARIAQATQNRYKPGTR
FT                   HTSLAGAPTTGPWIVNVLAIDPSRAGAALSLALPGGNDLGAGGETVSAARARVNALAGV
FT                   NGGFFTNINPFGAPLPPRSPVGATVVDGRLVAAAIGRRPGLLLARDANGRQRATVVRNL
FT                   ATAITLTDAQGSAIAVQTLNRPILGTVVNCGAQARTPTSEPAQDTVCTNYDDLVMYDSL
FT                   YLRGGASNTLVDAGYQGARYELVVDANGAVVAGHATLGAPPPPNGYVLQGLGASAAWLQ
FT                   AHATPGTRLAVSRRLSADGADLALASGTSLVEAGPTLSVPNLAQSAAQEGFAPTVGGVD
FT                   AGEGAAANGNWYNGWYVARNGRTAAGVAADGTILLVEIDGRQPTLSVGTSIPETAAVMA
FT                   WLGATSAVNLDGGGSSNMVVGGKMVGHPSDAVGERGVGDTLMLLPG"
FT   gene            complement(336912..337085)
FT                   /locus_tag="BMA10247_A0381"
FT   CDS_pept        complement(336912..337085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02291"
FT                   /protein_id="ABO02291.1"
FT                   /translation="MLSDLRRAQRCTALRAAAAAADVDALLTQHDDELRDDDEATQDDA
FT                   SNETRLRTDLRH"
FT   gene            complement(337554..339056)
FT                   /locus_tag="BMA10247_A0382"
FT   CDS_pept        complement(337554..339056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0382"
FT                   /product="amino acid/peptide transporter"
FT                   /note="identified by match to protein family HMM PF00854;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00924"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02821"
FT                   /protein_id="ABO02821.1"
FT                   /translation="MNTRVSQTRSFTTVFLIEMWERFGYYGMAALLVLFMVDKLRFTDG
FT                   QANLTWGAFTALVYASPSIGGWIGDKVLGARRSMIIGAVVLCAGYLMLAIPNDQLAFMY
FT                   TSLGVIVVGNGLFKSNAANLVRRIYEGDNARIDSAFTIYYMAVNIGSTASMLATPWIKD
FT                   HWGWHTAFAVCCAGMALGILNFVLMHRTLAHIGSQPDAQPVHWRRLAAVAAGGVALGLA
FT                   TMYVLGHKQLAVASVWVAAFAILAIFAYMIAKSNRAERSGLIAALLLIAQVILFFIFYV
FT                   QMQTSLTLFALRNVDPRFMLFGTTLFTWSPAQFQALNPIWIMLLSPVLVAIYNGLGKRG
FT                   RDLPVAGKYALGFGVVALGYLAFSISGRFAVDGRVSSWFMVAGYGFYSLGELLVSGLGL
FT                   AMIARYVPARMGGFMMGAYFVATGVSQYLGSVVANFAQMPSNDLPATASLPLYIELFTG
FT                   LGWLAAAGMAIGLLMLPLMNKLSREHHRCEAQRRETQALAAH"
FT   gene            339208..339462
FT                   /locus_tag="BMA10247_A0383"
FT   CDS_pept        339208..339462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0383"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02436"
FT                   /protein_id="ABO02436.1"
FT                   /translation="MRARRAGKCRKWSCRQAGKRPDRARDEARRAADGPRDVAGEKRAG
FT                   GEIVAAREAAAILAACRFFVTQGNPRKRGLSSLLLMAVG"
FT   gene            339734..340273
FT                   /locus_tag="BMA10247_A0384"
FT   CDS_pept        339734..340273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0384"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF05899; match to protein
FT                   family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02066"
FT                   /protein_id="ABO02066.1"
FT                   /translation="MALGSKIRALRQRLKRTLDETATAAGISKPFLSQVERGLASPSIT
FT                   SLAGIAHALGVTVQYFVETPSEERSVCRGDQLRFFSFADSANLFARLTNVPEGRQLEAI
FT                   LVRMPPGQKRSEVTTHAGEEFLYVIEGEVSLTLEGKSFVLHAGDSAHYQSTVPHSWVNT
FT                   AKIESVVVWVGTPRLF"
FT   gene            340409..342073
FT                   /gene="oppA"
FT                   /locus_tag="BMA10247_A0385"
FT   CDS_pept        340409..342073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="BMA10247_A0385"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03491"
FT                   /protein_id="ABO03491.1"
FT                   /translation="MRRALPFRYHYQSHTMKHTHAFAAVLAALALTIAPSAPAVTVASN
FT                   VTLADQQDLTRQVPAEVESLDPAHIESWTGNTIGLDLFEGLARIDASGAVVPGVAQAWE
FT                   HKAPDTWIFKLRRDAKWSNGQPVTAADFVYAWQRLADPKTGSKYTILVEFVKNASAIIA
FT                   GKQPPGDLGIRAIDPYTIEVKTEVPVSYFPELTAMAPLTPVNKDAVAKFGDAWTRPKNI
FT                   VSNGPYTLVDWQPNNRIVMAKSDKYWNARNVVIRKVTYLPIENDETALRMYQAGQIDYT
FT                   YSIPAGGFGQISKQFGKELRPGLQLATYYYYLKNSDPALKDKRVREALAMVLDREILTS
FT                   KITQAGEVPMYGLMPKGVKGVQRPFTPDWASWPMARRVDYAKNLLKQAGHGDANPLTFT
FT                   LTYNTNDLHKKVALFAASEWRTKLGVTAKLENVEFKVLMKQRHDGKVQVARDGWFADYN
FT                   DAMTFFDLIRCGSSQNTVGYCNPKVDSLVAEANQKLDDGARAALLTQAHDLAMNDYPMV
FT                   PLFQYSADRLVKSYVGGYTLTNYIDMRASQDMYLIKH"
FT   gene            342091..343029
FT                   /gene="oppB"
FT                   /locus_tag="BMA10247_A0386"
FT   CDS_pept        342091..343029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="BMA10247_A0386"
FT                   /product="oligopeptide ABC transporter, permease protein
FT                   OppB"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03125"
FT                   /protein_id="ABO03125.1"
FT                   /translation="MLAYALRRTLWAVPTILAVVTVCYLLLHFTPGGPFDSEKQLSAAT
FT                   LANLNAKYHLDEPRWKQYLLYLGSLLHGDLGPSFRYTDWSVNDLVRKAFPVSLGVGGVS
FT                   IPLSIVLGVLLGTLAAVRRDSFVDRFVMLIGNFGNVIPPFVLGPVLVLIFAIGLKTSEG
FT                   AGWLPAGGWGDGGWRYRVLPVTLLTLINVSLLARVMRGSMIETLSSNYIRTARAKGLPG
FT                   RTIVLRHALKPALMPVVSLFGTVCISSITAAVVTESVFALPGLGQLVVNGAINRDYTLV
FT                   LGLVVLTTVCAVLFNLLVDLAYAWLDPRIRY"
FT   gene            343041..343943
FT                   /gene="oppC"
FT                   /locus_tag="BMA10247_A0387"
FT   CDS_pept        343041..343943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="BMA10247_A0387"
FT                   /product="oligopeptide ABC transporter, permease protein
FT                   OppC"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02582"
FT                   /protein_id="ABO02582.1"
FT                   /translation="MTPVTSSIELPTAADAPPRSRTPLGLAARHFVRNRAALASLAALA
FT                   LIALMCFVGPLLLPNDPAASDWSSISLAPTLANAHWFGTDELGRDLLVRTLIGGRVSLE
FT                   VGLLGTFVSGLFGVAWGAIAGFAGGRVDAAMMRVVDMMYAIPYLLIAILMMTLFGRSFI
FT                   LVVLTISAFSWLDMARVVRGQTLSLRTREFVDAARAIGVTPAAIVRRHIVPNLLGVVVV
FT                   YATVSVPAIVLTESVLSFLGLGVQEPMTSWGVLIQDGAQKLEAMPWLLLAPAVMLCVTL
FT                   YCVNFVGDGLRDALDPKDR"
FT   gene            343945..344934
FT                   /gene="oppD"
FT                   /locus_tag="BMA10247_A0388"
FT   CDS_pept        343945..344934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="BMA10247_A0388"
FT                   /product="oligopeptide ABC transporter, ATP-binding protein
FT                   OppD"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03705"
FT                   /protein_id="ABO03705.1"
FT                   /translation="MALLEVKDLGVRFTRREGEPVDAVSGVSFSLEAGRTLGIVGESGS
FT                   GKSQTVMALLGLLAGNGSTSGEALFDGENLLRMNTRQLNAVRGDRIGMIFQDPMTSLNP
FT                   FLTIERQMTESLQLHRKMSRKHALKRAIDALEVVRIPDAARRIRMYPHEFSGGMRQRVM
FT                   IAMALLLEPEILIADEPTTALDVTVQAQIIELLRELNRERGTSIVLITHDMGVVAGLAD
FT                   DVMVMYAGRTVEYASADAIFSAPSHPYTIGLLNALPRLDAPDDAPLIAIPGNPPLPGQG
FT                   LLGCAFAKRCAHASERCGVERPDLIAYSDAGAVRACHRPIAEITGGLR"
FT   gene            344931..346064
FT                   /gene="oppF"
FT                   /locus_tag="BMA10247_A0389"
FT   CDS_pept        344931..346064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="BMA10247_A0389"
FT                   /product="oligopeptide ABC transporter, ATP-binding protein
FT                   OppF"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03209"
FT                   /protein_id="ABO03209.1"
FT                   /translation="MSAATDLISSTSSFVSASAGAPGGGEASGADAPGADARGGGASPH
FT                   ADALLSVRDLKVHFRVPLGGYPWSPKGTLRAVDGVSFDVKRGETVGLVGESGCGKSTLA
FT                   RALIGLAPVTAGTVQWRGVPIVSSARRDARRIRREMQMIFQDPLASLDPRMTIEQVVAE
FT                   PLVTHQPGIGRDEVRRRVLTMLERVGLSAHHLLRYPHEFSGGQCQRVGIARALIGEPHL
FT                   VICDEPVSALDVSIQAQIVNLLRDLQRELSLSYLFVAHDLAVVKAISQRVLVMYLGRVM
FT                   EFGTRREVYGAPQHPYTRALLAAAPTPEPARERARRPLLLASEMPSPLDPPSGGAFRTR
FT                   CPDAIDACAREVPQPEVRGVTGARVACIRAGTGGAAR"
FT   gene            346099..347682
FT                   /locus_tag="BMA10247_A0390"
FT   CDS_pept        346099..347682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0390"
FT                   /product="outer membrane porin, OprD family"
FT                   /note="identified by match to protein family HMM PF03573"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02394"
FT                   /protein_id="ABO02394.1"
FT                   /translation="MWTARTIFAPREDASLRRRVGVSPAARRGRRVGSQHKKRSAMTQH
FT                   RSMKRVARAVVLAWGLPMLAGVSIAGAARADDAAPAAPAQAPLAATLAQQATTPNALVN
FT                   ADATQAVLPQPPMSSQAKSKGFIADSHFDVLLRNYADVLDAKGGPHRHAWVQGVMANFE
FT                   SGYTGGLIGFGVDASIYAALKLDGGAGGGNMVHVAKGGGGSNQLAWAFPGIYDVKARIS
FT                   NTVIKYGLQAVDNPFMEQHDNRALPPTFLGATIVSNEFKNVMLEAGSFTKTNARGHTTL
FT                   TNLTTQYGGTRVDRFTYVGGTWDYSQTGSASFYAGQADDVWRQYYGSVKQSYGSPQTVK
FT                   WTGFGNFYSTHDTGDARQGKIDNNAYSLSLAAQHGPHELLLGYQQVLGDQFFDYLNETN
FT                   GIFLVDSMDVDYNAPHEKSLQLRYTFYGKEAGLPGFKAMVWGVTGWGADGSASAALDPT
FT                   RSSIYWKDGAPVQGRHHEFGFIPSYTIQSGKLKDTKITFIAMWHVGSAHYSDSTNQEYR
FT                   LVVNVPVKVF"
FT   gene            347707..348003
FT                   /locus_tag="BMA10247_A0391"
FT   CDS_pept        347707..348003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0391"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01840"
FT                   /protein_id="ABO01840.1"
FT                   /translation="MAIRLPLPGVGAVVVPPSRCHGGDVAAVWRVRSCASAMPRGFVRF
FT                   GRFRARRCPRVRRGPAAPPFDRANQVDWAGVDRIRRTGRLARAASLARMARTA"
FT   gene            complement(348014..349006)
FT                   /locus_tag="BMA10247_A0392"
FT   CDS_pept        complement(348014..349006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0392"
FT                   /product="dedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03441"
FT                   /protein_id="ABO03441.1"
FT                   /translation="MLHDLVARFGPLIVFVNVLAAAIGLPVPAMPTLVLFGAMATLHPD
FT                   ALGAQLAPVLALAVLAALIGDTVWYVAGRHFGGRALKTLCKLSLSRDSCVKKTERFFGR
FT                   WGVRVLAVARFIPGLSLISVPMAGALGTRYRVFVGYDGLGALLWAGCGVAIGFAFAKQI
FT                   DWLFAGANQLGRAVLVVIVALLAVYTAVRWMRRRALIRQLANARIDVDELERLLRAEPA
FT                   PVVFDARSPEHRKLDPYAIPGAQFADERDLRDIVAHYPATQKFVIYCSCPNEVSAALMA
FT                   QRLKQAGFADALALRGGLDAWRDTGRQLIELAPQPPSEAPVLAAAPKTA"
FT   gene            348998..349126
FT                   /locus_tag="BMA10247_A0393"
FT   CDS_pept        348998..349126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0393"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03795"
FT                   /protein_id="ABO03795.1"
FT                   /translation="MKHDETLDDCREARAAWSAWMRRLSAIFGKEVMPRANARRVR"
FT   gene            complement(349161..349433)
FT                   /locus_tag="BMA10247_A0394"
FT   CDS_pept        complement(349161..349433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03586"
FT                   /protein_id="ABO03586.1"
FT                   /translation="MRTTGSSEAMTLLTEFDQADGRELRSLRLVATEDGKSVLLIEVDE
FT                   RKPGIHREVRYEITPAELIAAIRSHGAELPGETHGTVPLARTTAP"
FT   gene            complement(349764..351167)
FT                   /locus_tag="BMA10247_A0395"
FT   CDS_pept        complement(349764..351167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0395"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03600"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02468"
FT                   /protein_id="ABO02468.1"
FT                   /translation="MSFVIVLAALAFLMFAAYRGYSVILFAPVAALGAVLLTDPAAVAP
FT                   VFSGIFMEKMVGFVKLYFPVFLLGAVFGKVIELSGFSEAIVAAAIRYIGRSRANAVIVA
FT                   VCALLTYGGVSLFVVVFAVYPFAAELYRQSNIPKRLMPGAIALGAFSFTMDSLPGTPQI
FT                   QNIIPTTFFKTTAWAAPALGTIGSVFIVVVGLSYLEWRRRSALARGEGYGTSLVNEPER
FT                   VETKSLPHPILAVSPLVLVGVANFALTKLIPVWYGGASYTVPPDVLPGVHTPITTPIKT
FT                   VVAIWSVEAALLLGILLVVITAFKRVHERFATGTKAAVGGALLAAMNTASEYGFGGVIA
FT                   ALPGFIVVGDALKNIPNPLVNAAVSVSSLAGITGSASGGMSIALAAMSDLFIKGAQAAQ
FT                   IPMDVLHRVVAMASGGMDTLPHNGAVITLLAVTGLTHRESYRDIFAVTVIKTLAVFFVI
FT                   AVYYLTGLV"
FT   gene            351193..351357
FT                   /locus_tag="BMA10247_A0396"
FT   CDS_pept        351193..351357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03145"
FT                   /protein_id="ABO03145.1"
FT                   /translation="MGSGAPADGATLRHALPQDSCHPACGGTRRPHGGLARGDGCAGCV
FT                   RFYRKRLFV"
FT   gene            351454..352992
FT                   /locus_tag="BMA10247_A0398"
FT   CDS_pept        351454..352992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0398"
FT                   /product="sigma-54 dependent DNA-binding transcriptional
FT                   regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM PF07728; match to protein family HMM PF08448"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02548"
FT                   /protein_id="ABO02548.1"
FT                   /translation="MDKKEKVETNASISGGWVRLPADYGDVLRRAAESLFKTFEHSSVG
FT                   TLIVDKDARVVWINQRYAARFGFADPQQAIGRDCEAVIPHSLMREVVATGRPILLDIME
FT                   TGREPLVVTRLPLTDDAGETVGAIGFALFDELKTLTPLFSRYMQVQQELIATQRSLAQA
FT                   RRAKYTFASFVGTSAVSLETKRQGRRAAQVDSPVLLLGETGTGKELLAHAIHAASARAL
FT                   KPLVTVNVAAIPDALLETEFFGAAPGAYTGADRKGRVGKFELADGGTLFLDEIGDMPVP
FT                   LQGKLLRVLQDKEFEPVGSNRIVRANVRIIAATSAELPALVAEGRFRADLYYRLNVLTI
FT                   HAPPLRERASDIEALVYTMLEELAAQHGLAEHCELTDDALRLLCAYPWPGNVRELRNTL
FT                   ERALMLSDRALIDARALAPFIGPARGAGGGVGAGGGAGAGGVGPAAVAIAAQTAMADTR
FT                   AAASSYADAFAAWERQFLIDALAASNGKVTEAAARIGIGRATFYKKLATLGIDT"
FT   gene            complement(352956..353423)
FT                   /locus_tag="BMA10247_A0397"
FT   CDS_pept        complement(352956..353423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03302"
FT                   /protein_id="ABO03302.1"
FT                   /translation="MRRSTEAAEATEAVDAADVVEADEAGKAGEADADADATGSAFAFD
FT                   TDDADEAGEENEEDEEDEEDDAGNTGNSAATVDTTIASRANANALANACAATANATHDA
FT                   ANPMRFITTSMRMREHRCDCRDRWDRCERKRIPRVARAARYVSMPSVASFL"
FT   gene            353344..353844
FT                   /locus_tag="BMA10247_A0399"
FT   CDS_pept        353344..353844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03251"
FT                   /protein_id="ABO03251.1"
FT                   /translation="MPASSASTTSAASTASVASAASVERRNWYDDPFWALSHSIAECPT
FT                   PLGPLMTRAQMEDDAHYRVERGTTCWLAHRYSKPNAYLYDKPIAGELKKRFTDGDPALA
FT                   GTSIWITIQRRFVYAEGCVSASFDRDALRRRLEALPDVERVFLRLTDDPRGRAPYKTLV
FT                   APD"
FT   gene            354020..354199
FT                   /locus_tag="BMA10247_A0400"
FT   CDS_pept        354020..354199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03407"
FT                   /protein_id="ABO03407.1"
FT                   /translation="MFTSDGRATTMVQCPEGGPWDTCIQNARGICGGDFDTIKQSVDNG
FT                   ARNLLFACKARNGF"
FT   gene            354302..354592
FT                   /locus_tag="BMA10247_A0401"
FT   CDS_pept        354302..354592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0401"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01702"
FT                   /protein_id="ABO01702.1"
FT                   /translation="MATYRQLTAQLEKLQQKIDKEREKAITDAIADIKAKIEEYDITPE
FT                   ELGFRSVKAAAKPKRALPPKYLNPKTGETWSGRGRAPAWLGKNRNRFLIKD"
FT   gene            354735..354875
FT                   /locus_tag="BMA10247_A0402"
FT   CDS_pept        354735..354875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0402"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02974"
FT                   /protein_id="ABO02974.1"
FT                   /translation="MRRFGDKTDAFGRMSRDPAVDSNLANRSECFTPPHPFGTPFAILP
FT                   R"
FT   gene            complement(354919..356031)
FT                   /locus_tag="BMA10247_A0403"
FT   CDS_pept        complement(354919..356031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01993"
FT                   /protein_id="ABO01993.1"
FT                   /translation="MPFGRIAEPRKRPHHRRTHFAAAAEPAASRPHALNGASLLFRNGA
FT                   TRNERMERTSRGPACGEPCLAPGGMPRAARRRRDGRAMRFWPAVTARAATRLAAALRRC
FT                   MHARARRPGLDCNVRQRKKPARRGPVPRIATTRCTTFEARLVGAETAVSKHRSGRLGDR
FT                   KWRTGKFDALPNSGQSPRRAKNRRAIKRTTWPTTDQIRIQRSMPLRDLGQIRKQWRYPA
FT                   RVSSEPAIAPAHRGAARDPSAAAFAASVEIARAGMASGRRTPFRRKQRYFIHAGHSAAR
FT                   FDCRPNEKAVSEMSSTRIRRPCALALSASRLADQNRQMALSRLIGAPPLFRYRGRTRPR
FT                   CPHRMRNGTPKAPRRYAPCSAKGERFRESR"
FT   gene            356134..358497
FT                   /locus_tag="BMA10247_A0404"
FT   CDS_pept        356134..358497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0404"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02492"
FT                   /protein_id="ABO02492.1"
FT                   /translation="MTVRNLDALFHPTSVAVVGASPRPGSVGAMVWACVLDGRFGGAIW
FT                   PVNPKYGELNGHKVYPYVDQLPSAPSVALICTPPATWPGIVRKLGGLGVRAAIIVGEAR
FT                   SGADRAALERALAAAKPYLLRVVGPGSLGVVSPALGAHFGAPACIVKAGGVAWVSQSNA
FT                   LTNAVLGWAHARGLGFSHAVALGGEADVDAADVLDYLASDAETRAILLELDTVKSARKF
FT                   MSAARAAARNKPVLALRAGRGDSGDLLYTAAFQRAGMVRVDALDDLLDEIEALGVGRAA
FT                   ATSGGVTLVTSDRGVAKLAVDALAAAGETLAQWPRAAVDEVGGALPAGIVAGNPLLLGD
FT                   DARPEYFGAALKALAQHPPTGTVFVVHATSHSAPAVDVARVLIESRKFARRGMLACFFG
FT                   GVDAATRDALHVHGIPVHTTPQRLARAHARLVDYQLGRELLMQTPEGTPPQPAASISAA
FT                   RHTARAALAQGRDGFEGDAALEWLAGFGIERATDADVDMGDTIVDITVGMYDDPNFGPV
FT                   FRYSVPPADGVSAPFVVYGLPPFNTVLARAVVARSPYAHRAPPEPLLQALTALSQAVCD
FT                   VREIVEMSLVLRVRPTRVVALGPHIRLATGRSRLAIVPYPRYLEQQLDWRGERITVRPI
FT                   RPEDEAAHRELLSAMTPDDLRMRFFGAIRNFDHSQIARMTQIDYDREMALIATLDDADG
FT                   RAHTLGAVRAVTDPDNEATEFAIAVRPDQKGKGLGRMLMTRIIDYARSRGTAWMIGEAL
FT                   RENTAMISLAKDSGFAVSSTEEPGVVAFRLKLQP"
FT   gene            358494..358607
FT                   /locus_tag="BMA10247_A0405"
FT   CDS_pept        358494..358607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0405"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03197"
FT                   /protein_id="ABO03197.1"
FT                   /translation="MRRRLGFVGCTMQAVDGSARRSPWRVVDVGGNLKSGM"
FT   gene            complement(358773..358901)
FT                   /locus_tag="BMA10247_A0406"
FT   CDS_pept        complement(358773..358901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03227"
FT                   /protein_id="ABO03227.1"
FT                   /translation="MFTGIGRCIAAADASGGPPCARHFAPSNRFPKNLTVDRIRFP"
FT   gene            complement(359002..359553)
FT                   /locus_tag="BMA10247_A0407"
FT   CDS_pept        complement(359002..359553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03912"
FT                   /protein_id="ABO03912.1"
FT                   /translation="MDVMAKLLTDLEFQRFSELQQKQASFTITPEEADELRDIVARAQK
FT                   KRDDRASAMRAIEAYIAQFDITPDELFSPEQIGEAARTYGLIAAGKKERSLPPSLTFNG
FT                   KPYQWTKTLPDEVRLPLFDAFKAGESIKRFIAMPKDAARCALTVARLERETGAVYADTL
FT                   LDELAISRKHVEEAAAKLAA"
FT   gene            complement(359608..359742)
FT                   /locus_tag="BMA10247_A0408"
FT   CDS_pept        complement(359608..359742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0408"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02449"
FT                   /protein_id="ABO02449.1"
FT                   /translation="MKRACLPGARVTLIRGSFDARVTRLWCSPRAGLAHESAARAALR"
FT   gene            complement(359739..361103)
FT                   /locus_tag="BMA10247_A0409"
FT   CDS_pept        complement(359739..361103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0409"
FT                   /product="indole-3-acetamide hydrolase-related protein"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01994"
FT                   /protein_id="ABO01994.1"
FT                   /translation="MRAIADAVNGRRVRALEQAEAALERLALVEPLAAMTHVAPEIARR
FT                   AAANVDAQIASGRRLPLAGVPFVIKDNLFTADMPTRAASPALLGFDATRNATAVQQLLD
FT                   AGAVPLGKANMHELAFGITSANGYFGAVRNPHDPARIAGGSSGGTACAVAAGIAFGLGT
FT                   DTGGSVRIPAAFCGVAGLRPTPRRYSTEGVLALSPTRDTVGPIAHGIDDLLLLDAVLTG
FT                   DAGEPAPVALAGLRVGVPDAPYFDGLDPAVAELTERALAALTDAGARLIPLAAHALHEA
FT                   DEACGFPIAGFEALAYWRRFSAERLDLPFAEFVARLGSDDVRHLFRMLIDAPPSSDAYA
FT                   AAIDVLQSTVRWYDQAFHRTGVDCIALPTVQCDAPLVTDSGHDLPSDAAYALFARVIRQ
FT                   TGPATLGGVPSVSIPAGLSKHTGVPVGLMLEGPAGNDRRLLAIAREVERLLARAP"
FT   gene            complement(361240..361407)
FT                   /locus_tag="BMA10247_A0410"
FT   CDS_pept        complement(361240..361407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0410"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01801"
FT                   /protein_id="ABO01801.1"
FT                   /translation="MKSFRPVHADNGLASAPWRPPRGPGAERRAGGGETRRLPRRTTLS
FT                   RGRHGALASF"
FT   gene            complement(361433..362359)
FT                   /locus_tag="BMA10247_A0411"
FT   CDS_pept        complement(361433..362359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0411"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03686"
FT                   /protein_id="ABO03686.1"
FT                   /translation="MTYESTIHRRNRRSRAARAAEAFDASRPRTTDPPMKPRKDAPAGA
FT                   AQAPHDCEEIERYRAPALDKGLDILELLAEQKEGLTRTEITKELGRNASEIYRMLERLV
FT                   ARQYVIRSPGGDRYTLSLKLYSLAHRHPPLKRLIAEALPPMQRFADAAEQSCHLCVYDR
FT                   GNLLVIAQVDGPGAWGISVRLGSRVGLVDTASGPVLLAFQTPEQRARMLVEHTKVEGEI
FT                   ALDMREFDALLHEIRATGRLRQKSRQAFGVTDIAYPVLGPSGHAIAALTCPYVRRIDTH
FT                   AAPCAEDVDAQLRATARHLSMLKEAAA"
FT   gene            362518..362631
FT                   /locus_tag="BMA10247_A0412"
FT   CDS_pept        362518..362631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0412"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02791"
FT                   /protein_id="ABO02791.1"
FT                   /translation="MAARRRAGTGEAGRDGGARRRDAIAAGESAHRQRLLQ"
FT   gene            complement(362635..362769)
FT                   /locus_tag="BMA10247_A0413"
FT   CDS_pept        complement(362635..362769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0413"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02282"
FT                   /protein_id="ABO02282.1"
FT                   /translation="MAGDLFSSGQTSYGAPVERRDGAGRGPVAAFVPSAAHDETLHRG"
FT   gene            362768..363616
FT                   /locus_tag="BMA10247_A0414"
FT   CDS_pept        362768..363616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0414"
FT                   /product="FAH family protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03174"
FT                   /protein_id="ABO03174.1"
FT                   /translation="MKLLRYGPVGQEKPGLLDADGRIRDLSSLIDDVAGGALSDASLAR
FT                   LAAADPASLPLVAGEPRIGACVGRIGKFVCIGLNYADHAAEAGLAVPAEPVVFGKWTSA
FT                   VSGPHDGIEIPRGSVKTDWEVELGVVIGRACKNVDEADALSHVAGYCVVNDVSEREWQI
FT                   ERGGQWDKGKGFDTFGPIGPWLVTRDEIADPQALDLWLDVDGRRYQSGNTRTMVFTVAR
FT                   LIAYLSRCMSLQPGDVISTGTPPGVGMGVKPSPVYLKPGQTVRCGVAGLGEQQQRTRAA
FT                   A"
FT   gene            complement(363800..364942)
FT                   /gene="lldD"
FT                   /locus_tag="BMA10247_A0415"
FT   CDS_pept        complement(363800..364942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldD"
FT                   /locus_tag="BMA10247_A0415"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.2.3"
FT                   /note="identified by match to protein family HMM PF01070"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02507"
FT                   /protein_id="ABO02507.1"
FT                   /translation="MSVPITCIEDLRVLAKKRIPRMFYDYVDTGSYTESTYRANEADFR
FT                   KIRLRQRVGVDISNRNLRTTMAGQDVAMPVALAPTGLVGMMRADGEILAARAARHFGVP
FT                   FTLSTMSICSIEDIVAHVGGPFWFQLYMMRDRAFIERLIERASAAGCPALVLTMDLQIA
FT                   GQRHKDVKNGLSAPPRITLPNLLDMMRKPGWCLGMARTRRRHFGNIVGHVKGVTDMWSL
FT                   DSWTREQFDPTIGWRDAEWVRRRWNGKLIVKGVLDADDALRAADAGADAIVVSNHGGRQ
FT                   LDGAMSSIEALPAIVEAAGKRVEVWLDGGVRTGQDVLKAVALGARGTMIGRAFLYGVAA
FT                   LGEQGARRALELIARELDTTMALCGCTDIRSVNADVLARR"
FT   gene            complement(365007..365930)
FT                   /locus_tag="BMA10247_A0416"
FT   CDS_pept        complement(365007..365930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0416"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02116"
FT                   /protein_id="ABO02116.1"
FT                   /translation="MNPSDLRDLRLPSLDGLLAFVAAARHGTFERAAEELCVTGSAVAK
FT                   RVAALEQLLGVQLLVRSGKALTLTAAGNEYLHQVHAPLHLLAAVPLHRRNAGKTERLRI
FT                   CAPPTFARQILVARLDAFTLAHPGVELEVMLASPFPDAPPTGADLWIRGGGPIVSGATV
FT                   LMVDALTPLAAPSLVERFAPLRRPADLAALPLLCTPLEPWTPWFRVAGLDWPEPANGPK
FT                   LLDLGLLLEAAVSGQGVALGSPALARPWLAAGALVPLFPRIVRPAAPYYLMPYAPRAAA
FT                   GAFAAWLADVCERAVRDGAEFLSRHG"
FT   gene            365956..366186
FT                   /locus_tag="BMA10247_A0417"
FT   CDS_pept        365956..366186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03862"
FT                   /protein_id="ABO03862.1"
FT                   /translation="MPRRARGGDERRDRAIARSRCKRMPAAAFRQPIMGWAGRDADRRS
FT                   WGAAACGSIWPDSWAAFIGGRVEAGFVEGTH"
FT   gene            366376..366519
FT                   /locus_tag="BMA10247_A0418"
FT   CDS_pept        366376..366519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0418"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03378"
FT                   /protein_id="ABO03378.1"
FT                   /translation="MYLCGGTAAFVPNDHLIARRAARGARRAASGEWRVASGEWRVASG
FT                   EQ"
FT   gene            complement(366617..367951)
FT                   /locus_tag="BMA10247_A0419"
FT   CDS_pept        complement(366617..367951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0419"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02899"
FT                   /protein_id="ABO02899.1"
FT                   /translation="MPTPTPGTPRPPRTPQPVRAALAAFIGTTVEFYDYYTYATAAALV
FT                   LGDVFFPSDNPFVSTMASFATFFVGFVARPLSGAVFGHLGDRIGRKKMLVLTMFLMGAA
FT                   TTGIGLLPGYATIGVWAPVLLVLLRILQGIAVGGEWGGAVLMASEHASAGRRTLFASFP
FT                   QMGSPAGLILSLLAFRYVTSLDHARFVAWGWRLPFLASFVLLLIGVAVRLGVNESPEFE
FT                   RVRDSHAVARFPVAEVLRTAWYPIVLAAAATTIGSAGFFFTNTFMISYVTTYLGMSKSF
FT                   ILDCLFAVTLIQLLSQPVSALLAQRFGETRFLVCAALLSMLTPYPMFVLVRTHDPVAIV
FT                   AGIAFAVVALSAVYAVIAGFMSAAFPTRVRYSGISIAYQLCALVAGGTTPLVGTMIAQR
FT                   YRGEWLPLALFFSLLAFVSLVGIVGLGRYRRNLHAVAPRTWAVNP"
FT   gene            368079..368228
FT                   /locus_tag="BMA10247_A0420"
FT   CDS_pept        368079..368228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0420"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02307"
FT                   /protein_id="ABO02307.1"
FT                   /translation="MLAFTSGFCFVLRFETWVTPVYSLRIACASTAERAKRRDARRHSR
FT                   APPP"
FT   gene            368458..368802
FT                   /locus_tag="BMA10247_A0421"
FT   CDS_pept        368458..368802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0421"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01781"
FT                   /protein_id="ABO01781.1"
FT                   /translation="MDGLGVSVLAAMHGVSLSITTFSKNGGAVTVSGGAGDGGDIGMPS
FT                   SDVAEERTPPNEVFGGVFGVEEMAIDACRLPEMKWRNVERIWMKPVPLRVRSMRDRSAV
FT                   RLAGGVRCVS"
FT   gene            complement(369293..370414)
FT                   /gene="iscS-2"
FT                   /locus_tag="BMA10247_A0422"
FT   CDS_pept        complement(369293..370414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS-2"
FT                   /locus_tag="BMA10247_A0422"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="4.4.1.-"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01041; match to protein
FT                   family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03438"
FT                   /protein_id="ABO03438.1"
FT                   /translation="MTHIYLDYNASTPIDPAVANAMRPLLPEAFGNPSSGHWASVPAKV
FT                   ALDRARAQVATLIGAAPDEIVFTSGGSEANNLALKGTVLASSNAGGHVITQSTEHPAIL
FT                   KPLQFLERLGTKVTCVPVDGNGRVDPDAIRRAITPRTTLITVMHANNETGTIQPIEDIG
FT                   TIAREHGIRFHTDAAQSIGKIPADVDALGVDLLSIAGHKLYAPKGIGALYVRKGVGLEP
FT                   LIHGAGHENGRRAGTESALLAAGFGEACALARDLAAMDGIRALRDRLWHALQDRFDDRV
FT                   RLNGHLEYRLPNTVNVSFVGRVGTDVLAALDGVAASTGSACHAGRMTLSPVLAAMGIAE
FT                   QVGMGAIRFSLGRHTTADEIDTVIAKLSAIARG"
FT   gene            complement(370461..371702)
FT                   /locus_tag="BMA10247_A0423"
FT   CDS_pept        complement(370461..371702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0423"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02905"
FT                   /protein_id="ABO02905.1"
FT                   /translation="MSKSTMPAGGAAIRLGLKENWRQFALLVLINAFVGGMVGIERTVV
FT                   PLIGSETFHIQSTTLITSFIVSFGLVKAVANLISGQLADTWGRKRVLVAGWLLGLPVPF
FT                   MIIAAPNWEWVIAANVLLGLSQGFAWSMTVIMKVDLVGPKARGLAVGLNEFAGYFAVGL
FT                   TAFLTGYLASRHGLRPAPIYLGVAYAIAGLTLSILVVRDTRDHVCLEAGKPKEATSLSF
FT                   HDVFLLASLKDRNLFAASQAGLINNLNDGMSWGIFPLFFTGLGLGVERIGILKAAYPIV
FT                   WGVFQVVTGPLSDRWGRKGLIVAGMWVQAAGLVLTASMGEFRWWLVASVLLGLGTAMVY
FT                   PSLIAAVSDASDPRWRARALSVYRFWRDLGYAIGALSAGLIADRFGFADAILSIAAVTF
FT                   LSGAVVAIVMHARH"
FT   gene            complement(371707..372447)
FT                   /locus_tag="BMA10247_A0424"
FT   CDS_pept        complement(371707..372447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0424"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02362"
FT                   /protein_id="ABO02362.1"
FT                   /translation="MILRQFLHCDPVGISYLLGCGGKSTGVVVDAVAEPGTYLQAAADA
FT                   GMKIDYVIDTHVHADHLSTGPALADAAGAAYVLSTKADVVLPFKGVEDGDEIRVGNVVI
FT                   KVLETPGHTPEHISLLVTDRTRAEEPWLALTGHTLMIGDLGRTELAESAEAGARNLFRS
FT                   VRTLKSLPDYLPLLPGAFAGSACGRGLSATPLSTIGFEKRHNAAFGIDDEAAFVRFMLS
FT                   DMPPAPPEAARLRAANSGRNPDEI"
FT   gene            372502..373194
FT                   /locus_tag="BMA10247_A0425"
FT   CDS_pept        372502..373194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0425"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF00581;
FT                   match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01773"
FT                   /protein_id="ABO01773.2"
FT                   /translation="MTREAQVSSAGPKQEIYESLAEVAQAVGHPNRLELLEHLAQRERS
FT                   VEDLTALSGMSFANTSRHLQILRRARLVDTERRGKNVVYRLAGDSEVVGLMKALGRLGE
FT                   RNVAEVNRVLGDYFHARDSMEPVSRNELTARLADGLVTLLDVRPHDEFAQGHLPGALNI
FT                   PLAALEARLSELPADTEIVAYCRGPYCVLAFEAVAALRARGFKAARLEDGFPEWKAAGF
FT                   VVETEPAN"
FT   gene            373282..373431
FT                   /locus_tag="BMA10247_A0426"
FT   CDS_pept        373282..373431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0426"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03713"
FT                   /protein_id="ABO03713.1"
FT                   /translation="MASSVDGEIGDDSHDRRRAPALALSVQVTVHRRHMLTVVHNRQWR
FT                   WHVV"
FT   gene            373837..373959
FT                   /locus_tag="BMA10247_A0427"
FT   CDS_pept        373837..373959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03183"
FT                   /protein_id="ABO03183.1"
FT                   /translation="MYTDAWKASAYETFGTFPSITYFESPAVVDNATNAIFSDE"
FT   gene            374062..374226
FT                   /locus_tag="BMA10247_A0429"
FT   CDS_pept        374062..374226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0429"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02454"
FT                   /protein_id="ABO02454.1"
FT                   /translation="MRNAPPIPAQPDFSRRSIRHPMLVYRTAAAQVARAWGARRACAYG
FT                   RACVCRRAA"
FT   gene            complement(374190..375131)
FT                   /locus_tag="BMA10247_A0428"
FT   CDS_pept        complement(374190..375131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0428"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03240"
FT                   /protein_id="ABO03240.1"
FT                   /translation="MDIKLDTPLLGALRCFEAAGRLGSFTKAADALHLTQSAISQQIRQ
FT                   LEARLGYPLFVRHARGLALTPKGGALHEATVAAFASLGRTLRQLSAPDAPLQVSCLPSF
FT                   ALQWLMPRLTEFHRLHPQTPVRLRAEFHAIDRETMSADDIDIAIRWDPFSYGALHVEPL
FT                   FDESLVAAAAPAYLDRHPPRATAKWVSSVVPLHDASAWPEAPRYVEWRTWLDAVVPGYA
FT                   SALRGPEFNLASLAIAAAVAGQGVVVCREALVDDEIARGRLVNVFARRVPAPAQYKAIC
FT                   ARPEDARVKAFVGWLRAESDSYAARRQTQARP"
FT   gene            375228..376543
FT                   /pseudo
FT                   /gene="dsdA"
FT                   /locus_tag="BMA10247_A0431"
FT                   /note="D-serine ammonia-lyase, authentic frameshift; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error; identified by similarity to SP:P00926"
FT   gene            complement(376702..377616)
FT                   /locus_tag="BMA10247_A0432"
FT   CDS_pept        complement(376702..377616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0432"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02927"
FT                   /protein_id="ABO02927.1"
FT                   /translation="MPARKPGRLPPLNALRAFEVSARHLNFRAAADEIGVTQGAVAQQV
FT                   RHLEDALGVALFERLPRGLALTADGLAYFADVRRALNLIGDATDRLAKRRANVTISTTP
FT                   SFASRWLIPRLASFGDEHRGVDLRVIADSQFATFQGDGVDLAIRYGKPPFGKGLVTRLL
FT                   FPVDIYAVCSPALLAPPGALARARDLAGHALLHDAHDLWPEFLAALPERVAIDPAKGPR
FT                   FNQSSLAIDAAIAGHGVALASDQLVARDIEAGRLRRLFDFALPLSVGYYIVRPSEPRRP
FT                   GDIAQTEAWLIRQAQLDARRDGA"
FT   gene            377545..377658
FT                   /locus_tag="BMA10247_A0433"
FT   CDS_pept        377545..377658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0433"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02277"
FT                   /protein_id="ABO02277.1"
FT                   /translation="MPRGHLERAERIQRRQAAGLSGGHVEAGQIVDIAEIE"
FT   gene            377798..378502
FT                   /locus_tag="BMA10247_A0434"
FT   CDS_pept        377798..378502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0434"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03189"
FT                   /protein_id="ABO03189.1"
FT                   /translation="MAVEKVALITAAGKGMGAAIARELASAGYRVALMSPSGSAVALAG
FT                   ELDGLGLRGSVTEEADLDRLVRETLARYGRIDAVVNNTGHPPKGELLSIADASWHDALD
FT                   LILLNVAGLMRRVTPVFQAQGGGAAVNISSFAAVAPEQPMPVSSVLRAALGAWTRLYAE
FT                   RYAAENIRMNAVLPGFVDSWPETPGIVARIPAGRFGRTREIAKTVAFLLSDGAGYVTGQ
FT                   SIRVDGGIVRAM"
FT   gene            378499..378822
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0435"
FT                   /note="protamine P1; this gene contains a frame shift which
FT                   may be the result of a sequencing error"
FT   gene            complement(378984..379151)
FT                   /locus_tag="BMA10247_A0436"
FT   CDS_pept        complement(378984..379151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0436"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01723"
FT                   /protein_id="ABO01723.1"
FT                   /translation="MEPGKPDVSYGLHKLKGSQASVGGKGGAMPFGEPRAARERVDALE
FT                   RWIGNGAPNN"
FT   gene            complement(379209..379526)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0437"
FT                   /note="putative chorismate lyase, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts;
FT                   identified by similarity to SP:Q3KIF2"
FT   gene            379506..379631
FT                   /locus_tag="BMA10247_A0438"
FT   CDS_pept        379506..379631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0438"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03346"
FT                   /protein_id="ABO03346.1"
FT                   /translation="MLRAVTHGCASRRITTSRTQIGESGSTPSSDASAAQAAAWR"
FT   gene            complement(379836..381158)
FT                   /locus_tag="BMA10247_A0439"
FT   CDS_pept        complement(379836..381158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0439"
FT                   /product="monooxygenase family protein"
FT                   /note="identified by match to protein family HMM PF01494"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03843"
FT                   /protein_id="ABO03843.1"
FT                   /translation="MIISDQSTYIYIIEYSPKYARDSFNCHEKIVVVGAGIAGLTLALT
FT                   LHSRGLAVRVFEAAPRIEPLGVGLNIQPYAVRVLHELGLLETLARQSITTKEMVFFTRY
FT                   GQRIYSLPLGKYGGHNFPQLSIHRGILQLALLKAATERLGPDFLVNGHSFVSCTQNSRS
FT                   VNAVFSGAPGGADLVSVECDALIGADGVHSKVYRSLYPDGPRTKGNGVLMWRGVTIAPP
FT                   FLTGASMVRMGVPSHGKLVVYPIRSDVNAQGDQLINWVAELDEAVYREGANAAPGNGKD
FT                   FIRFFASRTFDWLDVPALLERAASPIIAMPMADRDPLPRWQTGRVTLIGDAAHPMVPVG
FT                   SNGAGQAMLDAHSLGTRLAETADIEAALATYEHERRAYTSNIVLGDRLDLPDRLIQEVD
FT                   CRSHGKPFSDIGEIIASDEASRLALPDYHGRPLAPTQAGGA"
FT   gene            complement(381345..381530)
FT                   /locus_tag="BMA10247_A0440"
FT   CDS_pept        complement(381345..381530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01926"
FT                   /protein_id="ABO01926.1"
FT                   /translation="MEGEGGFGTRRARGGDVRARRSSQCRPRARGRQGGVGWRGASPVF
FT                   PSVFRARRAFDSSPAA"
FT   gene            381567..383447
FT                   /locus_tag="BMA10247_A0441"
FT   CDS_pept        381567..383447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02587"
FT                   /protein_id="ABO02587.1"
FT                   /translation="MSCAACASLFIAAAGASPLDADSADADAAPAAVVSDVHVFVVQRD
FT                   GSVDEHDDSTLRANTASGIDDVAQRYVWFNKDIDRVELLRAETIDRAGVAHPVGPEAIR
FT                   DVQEPRSAGAPFFEDGVLRSVIFPGVDAGARTRLVFRKSRTKPRDPGYFGYFAAPSRMP
FT                   VEAQRLIFDLPADMPLYADARGYVARAPVTENGRTRYAFDYRHGPYPRIEEGSVGYTTY
FT                   GDRLMVSTLRDFAAFAGRYRAAAADASAADPAVARLAQAIVANADAAGPRAKARAIYDW
FT                   VRTHVRYVALFLGETAAAPHKVTDILRNRYGDCKDHVALFGALLAAAGIRSEPALLNLG
FT                   AVYTLPDVPGYGGGAISHAITWLPDLGLFADTTVGGVEFGYLPPVVMDRPVLLVDDGVL
FT                   SRTPAAQPRTRDARLRIDVAPDGDARYQYHVEDGGWPAEFERGAFRQAARERVRQLAAD
FT                   RLRQSGLRGTARLGTSERDVTGGPFSTSMTGALERFAWPDGTTALPALSSLAGGIATQV
FT                   QGWLAEPVRTQPWLCIGADFDETAQIALPENLRVTDLPADAGVHDRFFDYESHYVFDAP
FT                   ARVVQITRRLRARFAHQVCAPEDFAAARASLEHIERDALAQIVVRAKPRD"
FT   gene            complement(383490..384926)
FT                   /locus_tag="BMA10247_A0442"
FT   CDS_pept        complement(383490..384926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0442"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498;
FT                   match to protein family HMM TIGR03354"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02833"
FT                   /protein_id="ABO02833.1"
FT                   /translation="MQLTVIEHAGEPVGTDGRNAVVFHAPGGTIGRDSDNHLVLRDDTR
FT                   QISRLQALLQVADDACLLKNLSSVSTIEVNRVPIGYAQAQRLNMGDIIRIGPYLLRAEP
FT                   DDATIERTVEAAATAAAAAAPAASAAQAQAKGAGNKLWGLLHERFGLGKAQGAGEQSGA
FT                   RAAPARHHDSPASAAPRDLNQLSTDPLDLFAQPHGDPDARAGAAREGEGRAPPTVTQPD
FT                   HAPEWTQHVRVQPAQSAPPAASRPGAPAARSGDIPAAGDASDMPSRVRASPAPAPATPE
FT                   TLLQAFFEGAGLDTAAEQHHWSAEQLFVAGQLLALFANGTVELLSSRSILKREVKADMT
FT                   MLLDRENNPLKLLPNGSAVLRQMFGLPLPGFMTPQSAVSDAFQDLHAHQIGMVAGMRAA
FT                   LMDLLTRFSPQRLRERDAAPQWYEKRVPALYKARLWDRYATTHRDTLFAIEDDFASVFG
FT                   KAFLSAYDAEVESYRGRCRR"
FT   gene            complement(384981..385340)
FT                   /locus_tag="BMA10247_A0443"
FT   CDS_pept        complement(384981..385340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0443"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03437"
FT                   /protein_id="ABO03437.1"
FT                   /translation="MAGMGGCGTGATSPASTPTVAQATLDSARAAYDAGDYRRTIALLG
FT                   GHAREIDGADVNTQVAAHKLLAFSYCLTRRTTQCRAEFSRILDLNPRFDLSPAEKGHPI
FT                   WGPAFEYARRKHALS"
FT   gene            385686..385826
FT                   /locus_tag="BMA10247_A0444"
FT   CDS_pept        385686..385826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0444"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01847"
FT                   /protein_id="ABO01847.1"
FT                   /translation="MLTEDGRRRGACAGRRSRGRLGPPPRIRPARRVRLCPEAIQLIEF
FT                   T"
FT   gene            386022..386540
FT                   /locus_tag="BMA10247_A0445"
FT   CDS_pept        386022..386540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0445"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM TIGR03352"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02300"
FT                   /protein_id="ABO02300.1"
FT                   /translation="MRPRFSVSVVLGCALLLAGCGATERSVAVPYSITLDVAPDVNPDL
FT                   NRKPSPIVLKVFQLKTASAFESADFFSLQDKPQSVLGADLLGVDRIILRPGDARTLHYR
FT                   GNVDAGAIGIVAEYRVLEKNRWRMTVPLPRAKQLNLYRFWQTSPGEMKLQVAVKNGGIG
FT                   LGGDSRVRQ"
FT   gene            386537..387940
FT                   /locus_tag="BMA10247_A0446"
FT   CDS_pept        386537..387940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05936;
FT                   match to protein family HMM TIGR03353"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02561"
FT                   /protein_id="ABO02561.1"
FT                   /translation="MNEPVLSATPAAALRQRVIWTEGMFLRPQHFQQLERHWERYVGMR
FT                   CLPLQGFYWGYDELQIDRELLALGKVALLAATGVMRDGTPFDLSHPDDRPEPLDVPADA
FT                   KDQLVVLALPLWRGGAQEVSFGAGGNGEGHGGDGNAHAGFARYVVREYEVADANEVALG
FT                   PALLQTGRLNVRLMLESELTGDWQALGVARVVERRTDGRLLVDDGYIPPRLVAQRDPVL
FT                   LRHTRELHGLLTQRSEALGERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVAAH
FT                   PETLFCDWLKLACDLSTFTAAGRRPQSLAVYRHDDLRASFGELMAELRRSLSTVLEQNA
FT                   IQIELRDVGNGMKVATIADPALRDTAGFVLAVRADVPADSLRARFPAQAKLGPVERIRD
FT                   LVQLQLPGIAMRQLPVAPRQIPYHAGHTYFEIDKGGEMWKQLERSGGLAFHFAGEFPGL
FT                   SMEFWAIRG"
FT   gene            387956..389272
FT                   /locus_tag="BMA10247_A0447"
FT   CDS_pept        387956..389272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0447"
FT                   /product="ompA family protein"
FT                   /note="identified by match to protein family HMM PF00691;
FT                   match to protein family HMM TIGR03349; match to protein
FT                   family HMM TIGR03350"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03061"
FT                   /protein_id="ABO03061.1"
FT                   /translation="MNTSSDSFSAGSGGFVPPNPGGAHPAAAPAAGAAAFQPRPGRWAA
FT                   SGTNPLVAAANPLLNLVPQIRSTVHHPNPAWLREHLVVEIRQFEERAQQAGVASEAIIG
FT                   ARYCLCTALDEAAALTPWGGSVWSSHSLLVSFHNETWGGEKFFHLLERLSQQPRQHLDL
FT                   LELLYFCLALGFEGRYRVLDNGRAQLDAVRRQLAQTIRSVRGEFDPALSPHWRDVVTRD
FT                   VTRRFTVPLWVCVALALLVGFGVFAGLRIALAGHSDRLFASIDALHVPKLQPAPPAPHP
FT                   APAPRVAKFLEPEIAAGLVSVRDEADRSVIVLRGDGLFGSGSTSVIDRYMPVLTRVADA
FT                   LNQVQGNVRVSGYTDDTPVHTARFASNWDLSRERAQAVRSLIAARLDRPERITAEGRGT
FT                   LDPVAPNDSPANRARNRRVEITLMLAPGSDAARATKEAP"
FT   gene            389275..392904
FT                   /locus_tag="BMA10247_A0448"
FT   CDS_pept        389275..392904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0448"
FT                   /product="ImcF-related protein"
FT                   /note="identified by match to protein family HMM PF06744;
FT                   match to protein family HMM PF06761; match to protein
FT                   family HMM TIGR03348"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03483"
FT                   /protein_id="ABO03483.1"
FT                   /translation="MSHAVARIVRPLPSRDIWTFAGLVVLACFVWLAGPLFAFAEFRPF
FT                   ESGAVRAATIVALFVAWGARIAWRGWRAGQLNAQLLNQLREAAPRPAATGDPAQAQLDE
FT                   LRSRFDEAATLLKKVRFGEADGARKGLPRWLEQMSRQYLYQLPWYVFIGAPGSGKTTAL
FT                   VNSGLSFPLAEQFGRAAIRGVGGTRHCDWWFTNDAVLIDTAGRYTTHESNRALDEAEWK
FT                   GFVDLLKKYRARQPLNGAMLTISVADLLGASEAERTQHAMVLRKRLLELRAQLGIRFPV
FT                   YLLVTKADLLAGFAEYFGGFGRAECAQVWGFTFPLAESEAPGFELRAAFDREYRLLHQR
FT                   LNDGLPELLASQTDARQREMTYLLPQQIADLQDMLGQFVAEVFSVSSFEPMPMLRGVYL
FT                   TSGTQEGTAFDRVMSGIKRFLKIEGVPPAAQTGSSGRSFFLKSLLQDHIFREAALAGSN
FT                   LRWHQRQRVLQIVGYAAIALLCVAVLFAWLRSYSRNRDYLDEVAARVPAVDAQIGRAKF
FT                   TGAADIVQLLPVLDELSGLPNAGGVDLRHPPLAYRWGLFQGEKIEEASDAVYRRALDDV
FT                   LLPIAASRMEQALRDARPDEVEYAYAALKAYLMLYDSAHYDPAFVQAVVDLEMERALPA
FT                   DFSSAQRSALRAHLGALFGNRVAVSPFPMNERLVADVRERLRQVPFSQRLYRQLARTLH
FT                   ASTASYDFSVARAVGPDASLVFRRQSGKSLADGVPGLYTRSGYRNVFAPRLPGAIDSYG
FT                   REEVWVLNLGASEIPNPADAAAWARDIRQLYLNDYIKTWDDYLADIRLQRTSTLAQSIQ
FT                   VARTLSSADSPLTRLMVALARDTPLGDAPGGARNLASRAQDKVDEARNSLAQIFAGQPG
FT                   GEAGAAAAPPASPEQIVDSHFAGLRAFAPGGGDQAASFDAVLKAIDALYTYLTATDDAL
FT                   RSGAAPPPSDAPARLRAQAGRLPTPVREVLDDLSNVANGSIASVEQRNVAQRAGANVGD
FT                   FCRQAIAGRYPFARGAARDVAPSDFAQLFAAGGLMDDFFQKNLQTLVDTTAHPWRFNNR
FT                   NAEADPSAAAMLGSFEKAAVIRDVYFGGGARTAQIKVEIVPLEMDPSISEMLLDVDGQI
FT                   VRYAHGPQVPTAVQWPGTRGSNQVRLQVTEQSGATGGFTTEGPWALHRLFDRAGVSGGR
FT                   GPEQMVARFAVDGKPIVLQVTASSVRNPFRLPQMESFTCPPKQ"
FT   gene            392901..393806
FT                   /locus_tag="BMA10247_A0450"
FT   CDS_pept        392901..393806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0450"
FT                   /product="type VI secretion-associated protein, BMA_A0400
FT                   family, authentic frameshift"
FT                   /note="identified by match to protein family HMM TIGR03373"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02322"
FT                   /protein_id="ABO02322.2"
FT                   /translation="MSTMQTTPACDGEPPAWYGKIPGAGDFVNHRLSHELAGWWERWLQ
FT                   QGMAAMRQRGDDELARYYTVAPVWNFLIPAGAGAQCVQPGCLAPSCDRVGRYYPVIATL
FT                   PMRTADYWSALPDAADAFYWQVGSALLDAIRHARAPVQLEQALAKVRLVPGAAAGSAWF
FT                   GGAGDGPGERDWRGGARDAARESDAGWAIGGAGDIDGAGVRGAGDEGDGGDRGEAGGMS
FT                   SVGAADGGDARNGALAQPMPSPPATPAWPGLSQYFDPHGATSFWWTNRADGSPLRTHAH
FT                   TGAPDSRLFLRLFGGVQHGV"
FT   gene            complement(393791..394018)
FT                   /locus_tag="BMA10247_A0449"
FT   CDS_pept        complement(393791..394018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02690"
FT                   /protein_id="ABO02690.1"
FT                   /translation="MCHLVIPRIAAGSRRLRAPARRVPARSRAPLVALPLHYRYTVTSA
FT                   SHAPVACIPACARRMHPPHARPPRARYTPC"
FT   gene            394056..396614
FT                   /locus_tag="BMA10247_A0451"
FT   CDS_pept        394056..396614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0451"
FT                   /product="non-specific serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01985"
FT                   /protein_id="ABO01985.1"
FT                   /translation="MTRGGGAEFAVRPLPLGHRLGELQLDEVLGVGGFGIVYRAFDRTL
FT                   RRAVAIKEYMPSMLATRGGDYTVSLRSVRFAQAFDAGRSAFLNEARLLAQFDHPGLVKV
FT                   LHFWESHGTAYMVMPFYEGRTLKQLLDGGAQIGETQLRHIVAALLGALDTLHRAQCFHR
FT                   DIALDNILIRPDGNPILLDFGAARKRIGDLVDDSAMMIKPGYAPIEQYTDDPAFSQGPW
FT                   TDLYALGAVMHAMVTGELPPAAVVRSIQDTYRPLAARELTAREPYSPAFLAAIDHALQL
FT                   KIADRPESVAEFAAELGLREFDRPPYVAPMPAGAPQPREARDAGAAEDDARRAAASGSP
FT                   EARRRGDADVDADARPDGERARQPEQPPPARQSAAHRLGDSAQADGEGAGDESGAAAAR
FT                   WQGDDERADERPDESTDEPAARAERAMAAQSGAQPAQTPPPPQASERGAAATRSDADSG
FT                   APSPRPWAADGRDGESSGPRVDHMQSQSQSPPSRSREHAGERDPRPARPGVADASRQAA
FT                   PASRDGGAPPPEASGPRVSDAPVSRDAAGADAEAAMSAAAAGAGAPARAGASNASASSG
FT                   APAVCAASTASTASAASRSTAPAGPPGNARARLRDRRTIAYAGGALAVLVALGIGVAHL
FT                   VKPSGRTEATAANALAPLSPAAPPVPGSVSALAQRGEPPPALAPPPAPADTAVREPAPS
FT                   VATTTAGASATPTTSPGAAPPPSAQIANHDAGAASAHGAQASNLAPNGSLDATETVVAN
FT                   PPAGAEPPVSPSVAQEAAAAAEQRPPDMQETIPVRLHVRPWGDVYVSGVKRGASPPLRT
FT                   LSLAPGVYQIEIRNGTLPPLRRTVKIDPGSKPVSIDYAFE"
FT   gene            396667..397746
FT                   /locus_tag="BMA10247_A0452"
FT   CDS_pept        396667..397746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0452"
FT                   /product="ImpA-related N-terminal family protein"
FT                   /note="identified by match to protein family HMM PF06812;
FT                   match to protein family HMM TIGR03363"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03448"
FT                   /protein_id="ABO03448.1"
FT                   /translation="MQSSDPIESLLAGVAPDAPCGANLEYEQDFLRLQESATPRPEQQY
FT                   GDTVIPAEAPDWSAVERLALELTARTKDLRVAAHLARSWTELRGMPGYADGLRLVAGML
FT                   DRWWDDVHPRLDADGDHDPAPRANALAEIAGAHDCARAARRQALFDGGPSVRDAERVFD
FT                   GRDGGEHGYPGGRERLIADLVRARDGGQPTLQAAFAALDALDAIRARVASALGGEWVPD
FT                   ASDFEKALRRIVRDGLPPPAAAPAATNGAANVANAAHGGAANGVTNSAANGAASGGAPA
FT                   FAANGRAWRDAELTSRDDVQLGLEKMCRYFELHEPSHPAPILLRRAQRLLSLDFYEIIR
FT                   DLAPESLPKLDLLSGQRNE"
FT   gene            397809..398387
FT                   /locus_tag="BMA10247_A0453"
FT   CDS_pept        397809..398387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05591;
FT                   match to protein family HMM TIGR03358"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03046"
FT                   /protein_id="ABO03046.1"
FT                   /translation="MTSKYKASASGQKFIARNRAPRVQIEYDVETYGAERKVQLSFVMG
FT                   VIADLAGKRAEPLPDLPERKFLEIDVDNFDERMKSIAPRVAFQVPNTLSGDGMLSVDMT
FT                   FESIDDFSPAAIARNVDALRRLLDARTELSNLLSYMDGKHGAEQLIENAINDPALLASL
FT                   VRQPLAADAEGGARQPVTGTEDDPEIRHE"
FT   gene            398380..399888
FT                   /locus_tag="BMA10247_A0454"
FT   CDS_pept        398380..399888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05943;
FT                   match to protein family HMM TIGR03355"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02877"
FT                   /protein_id="ABO02877.1"
FT                   /translation="MNERAQTQADTRAAAQPVVARDEFAALLQKEFKPKTAEARESVER
FT                   AVRTLAQQALEHTVGMTTDAYGSVKQIIAEIDRKLSEQINLILHHQEFQTLEGAWRGLH
FT                   YLVTNTETDELLKIKALPASRNELARTLKRYKGVAWDQSPLFRKVYEEEYGQFGGEPFG
FT                   CLVGDFHFNHSPPDVEMLGELSKIAAAAHAPFIAGASPELMQMDSWQELANPRDLTKIF
FT                   QNTEYAAWRSLRQSEDSRYVGLAMPRFLARLPYGARTNPVDEFDFEEDTGAASHDRYTW
FT                   ANSAYAMAANINRSFKLYGWCSSIRGVESGGAVQGLPCHTFPTDDGGVDQKCPTEIAIS
FT                   DRREAELAKNGFMPFVHRKNSDFAAFIGAQSLYQPAEYHDPDATANARLSGRLPYLFAC
FT                   CRFAHYLKCIVRDKIGSFRERDDMERWLNDWIMNYVDGDPANSSQETKARKPLAAAQVV
FT                   VEEIDDNPGYYASKFFLRPHYQLEGLTVSLRLISKLPSAKAAGE"
FT   gene            399948..400439
FT                   /locus_tag="BMA10247_A0455"
FT   CDS_pept        399948..400439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05638"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03382"
FT                   /protein_id="ABO03382.1"
FT                   /translation="MGVAMFMKVDGVTGESADAQHKGWTDIQSFSWGASQPGAMASGSG
FT                   GNAGKASFNDLVVAAYMDKGATAIIKNCASGKHLPTVEISACKTGGSQIEFMRVTLQEV
FT                   LVTSAQIAGVDPGDAADRLMMQYGFQAAKVKKQYWQQNDNGGKGAEVSVGWNIKENTEM
FT                   "
FT   gene            400458..401018
FT                   /locus_tag="BMA10247_A0456"
FT   CDS_pept        400458..401018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04965;
FT                   match to protein family HMM TIGR03357"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02079"
FT                   /protein_id="ABO02079.1"
FT                   /translation="MNDDVRAAGGGAGGVRAAHDRLQPALLDRLTDAERERRTEPPDAQ
FT                   AIGGERLRAAVLRDLAWLLNTRNGEDGFVDWSAFAHAQASVLNYGMRPLVGKPMSGVER
FT                   MSVEASIRDAIVRFEPRIAPDSVEVRSVLDAPGGAAGERRHNVLMFEIKGTLWSIPHPV
FT                   EFVLRSDLDLETGAMALHPAAGG"
FT   gene            401023..402894
FT                   /locus_tag="BMA10247_A0457"
FT   CDS_pept        401023..402894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05947;
FT                   match to protein family HMM TIGR03359"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02636"
FT                   /protein_id="ABO02636.1"
FT                   /translation="MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRMHESGPPDPY
FT                   VERLLEGFSFLTARVQLKMDAEFPRFTQALLDAVYPGYVAPLPSMAIVQFTPMMNEGSL
FT                   AQGYRLPAGTALRARPAAAEQTACEFRTAHDLTLWPLELADASVTGAPAYLPRSATAAR
FT                   RDVRGALRIRLKARGGAGLAQLPIDRLMFHLAGPERDALHLLELIAGHTIGVVCHDAAQ
FT                   PPRWLHALGAHALAHQGFDADQALLPDEGRSFHGYRLLREYFAFPARFLFFSIEGLRPA
FT                   LARATGDTFELTLLLDRHDAALENSVDARHLALNCTPAVNLFARRADRIPVHPGAREHH
FT                   VVVDRSRPLDYEVYAVRRLAGEQRDDGQTRAFRPFHASFAGDGGNYGAYYTVRREPRLV
FT                   SAQARANGTRTGYVGSETFVSLVDSACAPYDESIRYLSVDTLCTNRDLVLLLPAGDANA
FT                   FTLRVSAPVERIAMIRGPSRPRPPLADAQSAWRLVSHLGLARHTLTDVDDEEGARVLRE
FT                   LLGLHADPADAAMRRQIDGVHRVAFAPVFRRLPAAGPLMFGRGVQVDVTVDDHAFSGDS
FT                   PYLLGAVLEQFFARHVSINSFAECVLSSAQRGRLAQWPARVGRRPAI"
FT   gene            402891..404369
FT                   /locus_tag="BMA10247_A0458"
FT   CDS_pept        402891..404369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06996;
FT                   match to protein family HMM TIGR03347"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02392"
FT                   /protein_id="ABO02392.1"
FT                   /translation="MTTNPKPEPAGVDAGSHANSNAGRRAGAAANVEANAEPDAMPNAV
FT                   RGAAADVAPSAAPSATPSATSQAAAARRDAWWRRLRAAPHGYDLFHALRWLDALSPEHA
FT                   PSGYASRPRDEPVRFGQAPSLAFAAAMLADVRDDGPRPRVAIHGFGLFGPNGPLPSHLT
FT                   EYAYERATQHDDPTFAAFADLFHHRLILLFYRAWADAQPTVSLDRPARARFDRYVASLI
FT                   GPCDALLADSPRGSRPDSSFASSSDSLPDSLPDSPPDSSPDSPPDSRSDSPSDARLDPH
FT                   PDSPRGAGALAPHAKYHQAGHLVRHTRNPEGLVQILRRYFGVRVRIVEHVPHWVMLDRA
FT                   QRCAIRATRPTQPLGGAVLGRAVRDAQSRFRIVLGPLTLDEYRRFLPGGVHARQLAQWV
FT                   REYVGIEFDWDVQLELARGEVPTLALGSRHGLGRTAWLGERLDPGPARDLVLGYDERMR
FT                   ASRARSGAADQAAAAGALIANLPEREPPCPISAE"
FT   gene            404348..407002
FT                   /locus_tag="BMA10247_A0459"
FT   CDS_pept        404348..407002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0459"
FT                   /product="putative ATP-dependent Clp protease, ATP-binding
FT                   subunit ClpB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02861; match to protein
FT                   family HMM PF07724; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR03345"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02970"
FT                   /protein_id="ABO02970.1"
FT                   /translation="MSDIGRVTLFGKLNTFLYETLEQATGFCRLRGNPYVELAHWLNQM
FT                   LRRPDSDVHRILRRFDIDAAAIDRGIVSALDRLPRGAGSVSDLSAHIDDAVERAWVYAT
FT                   LKYDAAQIRGAVLLLALVKTPQLRNVLYAIARDFERIVPDVLADELERIVAGSPEAPSP
FT                   AARAAAGAIGDAGAAPSAAREGSALARYAIDLTARARAGEIDPVVGRDGEIRQIVDILL
FT                   RRRQNNPLLVGEAGVGKTAVAEGFALRIVAGDVPPPLRDVELYLLDIGLLQAGASVKGE
FT                   FESRLRGVIDEASSSERPVILFIDEVHTLVGAGGAAGTGDAANLLKPALARGLLRTIGA
FT                   TTWSEYKQYIEKDPALTRRFQLVQVREPEEGAALAMLRGLAAKLEAHHRVLVLDDALQA
FT                   AVTLSHRYIPARQLPDKAISLLDTACARVAVSQHAVPAPIEDVRRRIDSLRVERELIAR
FT                   ECALGAGDAQRLDAIDASIAGEQTTLDALDARWQAERDALGKIVDWRASLLADDSSRVL
FT                   DEAARADVQAKLSAALRALAELQGETPLVLPAVDTHAVAAVVSDWTGIPLGRMVRDEMQ
FT                   SVLKLAETLAERVVGQPHAVELIAERIQTARARLDDPAKSHGVFLLCGPSGVGKTETAL
FT                   ALAEMLYGGEHNAITINMSEFQEAHTVSTLKGAPPGYVGYGQGGVLTEAVRRRPYSVVL
FT                   LDEIEKAHRDVHEIFFQVFDKGWMEDGEGRYIDFRNTVILLTSNVGSERVMQLCRDPQR
FT                   LPDAQTLTDALREVFPAALLGRLTVVPYYPLTDEMLARIVALQLARIERRIEAHHGIAL
FT                   RCADSATALIAERCRTIESGGRMVDAILTHTVLPRISQEILRATIEGRALRAIDVSAED
FT                   GQFVYRFEEEGAT"
FT   gene            406999..409203
FT                   /locus_tag="BMA10247_A0460"
FT   CDS_pept        406999..409203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0460"
FT                   /product="Rhs element Vgr protein"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM PF06715; match to protein
FT                   family HMM TIGR01646; match to protein family HMM
FT                   TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03142"
FT                   /protein_id="ABO03142.1"
FT                   /translation="MTRVFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSL
FT                   KELLGKPVTVRIRQQDESERHLNGIVARAALVGRRAERHYGYQLIVRPWLWLATRRSDC
FT                   RIFQNKTVPEIVQDVLGTYGFPIENHLTDTYAPRDYCVQYNETDAAFVSRLMEFEGIYY
FT                   YFKHAAQTHTLMLCDAMASHVALPGYEHIPFIARDRTAIADEEHIDSWLPAQEVSIGKH
FT                   ETSDYDYTKPRADLSAQKIDPRGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAEH
FT                   ERALARTDVRGIAPGYLFTLEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHES
FT                   QTLVQPSSLPYRSPRATPRPRTNGPQTATVVGPKGEEIWTDQYGRVKLQFRWDRYGQSD
FT                   QNSSCWVRVSSPWAGGGFGGVQIPRIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGL
FT                   PGSATQSGLLSRSSPGGTAEHSNAFRFEDKKGAEQLWMHAERNFDAETEQDHTLSVGHD
FT                   HSHSVGNNEMMSVANDRQRSVGQNETVNIGKHRVAQIGGNETHGVAGNRTRQVGQNEAV
FT                   TIGANREATIGGNHVETVAKDKTETIGQGKTLNVTQHYQTTSKSMKTAVAEHHAEEIGS
FT                   RTSTIEKAHELNVGGSQSVNVGASHTMSVKNNVHVGAGDQISLVCGDASITLKKDGTIA
FT                   INGVTVESSASGSHSVRGKTVTSSATGEHTVEGTILKLNP"
FT   gene            409278..409931
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0461"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            409861..410919
FT                   /locus_tag="BMA10247_A0462"
FT   CDS_pept        409861..410919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0462"
FT                   /product="YD repeat protein"
FT                   /note="identified by match to protein family HMM PF05593;
FT                   match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02634"
FT                   /protein_id="ABO02634.2"
FT                   /translation="MGRTVGRASAMIDPAGRTTAWEYDAYGSLLVQTLPDGSAVRTEFD
FT                   LDHRPVCMTLIGGRQWGYEWNTFGNLLAQSDPSGAISRYTYDEYGQLVEHTGPRGASTR
FT                   FDYHPDGNLAAQIDALGHRTQYRYDARGYLGEAIDALGQQSQYEYDRNGHLTRAIEPGG
FT                   REIHCAYDADGNLSRHRDPMGHVTQMEYSALGQVSRRLAPDGTTVEYRYDTEEQLIGVV
FT                   NERSELYALERDALGRIVVETDYWGQARRYRYGAAGELLCSTDPLGQTVEYRYDWLGRI
FT                   VQKRVPHPEQDEALQIDSFAYDRHGDLVLAENPSCRVEFDYDAAGRMIEERQGDDFTIA
FT                   SDYDEAVTCPLR"
FT   gene            complement(410947..411780)
FT                   /locus_tag="BMA10247_A0463"
FT   CDS_pept        complement(410947..411780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0463"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02094"
FT                   /protein_id="ABO02094.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(411804..412067)
FT                   /locus_tag="BMA10247_A0464"
FT   CDS_pept        complement(411804..412067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0464"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03047"
FT                   /protein_id="ABO03047.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            414238..415662
FT                   /locus_tag="BMA10247_A0465"
FT   CDS_pept        414238..415662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0465"
FT                   /product="permease, cytosine/purine, uracil, thiamine,
FT                   allantoin family"
FT                   /note="identified by match to protein family HMM PF02133"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02188"
FT                   /protein_id="ABO02188.1"
FT                   /translation="MPNATDAQRRALRERRTIDYIPDHERHGKLSSQFTLWLGANLQVT
FT                   AIVTGALAVVLGGDVSWSLVGLALGQLLGAAVMALHGAQGPQLGLPQMISSRVQFGIYG
FT                   AVIPLVLVCLMYVGFSASGTVLAGQALAQLFGVADPVGIFAFIAVVVVLAVFGYRTIHA
FT                   LGRISSIVGVVAFVYMFVRLLAGHDVGALLAIRHFSLSSFLLAISLSASWQIAYGPYVA
FT                   DYSRYLPRSTSARRTFWAIGLGSVLGAQASMAFGVFAAALAGKQFAGHEVQFIVSLGAS
FT                   GATAALLYFAIAFGKLTITTLNAYGSVMSVATIVTGFSGRAQITQRARMAYVLAMVAAV
FT                   AWLALVGRHAFLKDFSAFILFLLAFFTPWSAINLVDFYWVTRERYDVPALYDPDGRYGR
FT                   WNVAGVSIYAIGVLVQMPFIATEFYTGPLVAKLGGTDISWIIGLVVPGVLYYVTARRQT
FT                   AHVPERLILPDEPSLP"
FT   gene            415659..416597
FT                   /locus_tag="BMA10247_A0466"
FT   CDS_pept        415659..416597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0466"
FT                   /product="transcriptional regulator, Sir2 family"
FT                   /note="identified by match to protein family HMM PF02146"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01730"
FT                   /protein_id="ABO01730.1"
FT                   /translation="MTVSAVVSPQPQPPSSSSSPDAAPFADPRALDALHAFVERHPRLF
FT                   VLTGAGISTDSGIPGYRDRNGAWMRSQPIQYREFLDSDHARRRYWARSMLGWPVVGRAQ
FT                   PNASHHALARLGAAARIGRLVTQNVDGLHQRAGSVDVIELHGGIGGITCLDCGAHHARA
FT                   SIQHVLEAENPELLGARAQPAADGDAHLEWSALDHFRVPACPACGGLLKPAVVFFGENV
FT                   PRERVAAAARALDDADAMLVVGSSLMVYSGYRFCVWANDQRKPIVAINLGHTRADPLLT
FT                   LKVEASCGQALAALIARLGLAQRDAHGLPHV"
FT   gene            416560..417237
FT                   /locus_tag="BMA10247_A0467"
FT   CDS_pept        416560..417237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06080"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03601"
FT                   /protein_id="ABO03601.1"
FT                   /translation="MRSATRTACLTSDSIFPIHFVMPIDSASRQWAPAAERNREPILAV
FT                   LKRLLPARGAVLEIASGTGQHAVHFAAALPDLVWQPTDVDAAARESIAAWAADAALPNL
FT                   RAPLALDVCVEPWPLAAADAIVCVNMIHIAPWAAVCALFVGAARALPDGGVLYLYGPYR
FT                   RGGAHTAESNAQFDAQLRRRNPAWGVRDLEAVVELGGASGLALDEVVEMPANNLSVVFR
FT                   KRA"
FT   gene            complement(417561..417704)
FT                   /locus_tag="BMA10247_A0468"
FT   CDS_pept        complement(417561..417704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0468"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02881"
FT                   /protein_id="ABO02881.1"
FT                   /translation="MFAHCSILRKKQGATHRGRAHRRKDKGNHASAPRMKDARRRLDGG
FT                   SV"
FT   gene            417693..419108
FT                   /gene="gnd"
FT                   /locus_tag="BMA10247_A0469"
FT   CDS_pept        417693..419108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="BMA10247_A0469"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /note="identified by match to protein family HMM PF00393;
FT                   match to protein family HMM PF03446; match to protein
FT                   family HMM TIGR00873"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03280"
FT                   /protein_id="ABO03280.1"
FT                   /translation="MGKQAIGVVGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAE
FT                   FPDRKLVPAHTLEAFVASLETPRRILLMVKAGEATDATIAALKPLLDKGDVLIDGGNTH
FT                   FTDTIRRNQELAQAGLHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILEQIAAKA
FT                   PADGEPCVAYMGPDGAGHYVKMVHNGIEYGDMQLIAESYAVLKQVAGLTNDELGAVYAE
FT                   WNQGELDSYLIEITAKIFGKKDDETGEHLVDVILDRAAQKGTGKWTSQNALDLGVPLPL
FT                   ITESVFARVLSSLKAQRVAASEVLSGPSPAPLEGDRAAFVESVRRALYLSKVISYAQGF
FT                   AQLDTASKEYGWNLDLGTIAKIFRAGCIIRARFLQKITDAYAKNAALANLLLDPYFQDI
FT                   AANYQSALRDVVIAAVKAGVPVPAFASAVAYFDSYRSARLPANLVQAQRDFFGAHTFER
FT                   TDKPGSFHASWAE"
FT   gene            419307..419639
FT                   /locus_tag="BMA10247_A0470"
FT   CDS_pept        419307..419639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0470"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02521"
FT                   /protein_id="ABO02521.1"
FT                   /translation="MKSLIATVAVAAALAVPAVSFAQQSNGPVTRAQVRAELIQLEQAG
FT                   YNPASDRVNYPEEIQAAEAKIHGQQNVAAQADTSGYGAQPTAAAESGSPNKVKRIADGA
FT                   PVYKGR"
FT   gene            420033..420395
FT                   /locus_tag="BMA10247_A0471"
FT   CDS_pept        420033..420395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0471"
FT                   /product="cupin domain protein"
FT                   /note="identified by match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03680"
FT                   /protein_id="ABO03680.1"
FT                   /translation="MVPRDRRAGRRDTTGMSMKIVRSKSFTASRAWGAVDIANMRGITT
FT                   RLHWTDQPYKWHVNDGEEVFVVLDGRVEMRYRDAGVERSAVLEAGDIFFASVGTEHVAC
FT                   PLGEARILVVETEGSV"
FT   gene            420686..421438
FT                   /locus_tag="BMA10247_A0472"
FT   CDS_pept        420686..421438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0472"
FT                   /product="putative lipoprotein NlpD"
FT                   /note="identified by match to protein family HMM PF01476;
FT                   match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03154"
FT                   /protein_id="ABO03154.1"
FT                   /translation="MRSILFVQRAGIGRTVRAALVAAGAALVGGCTVTPWTDSWQPTHV
FT                   PSQPAPRASSGVPAGYYRVNSGDTLASIASAFGQRTLDIASWNHMAPTDMVMPGQVLRV
FT                   APPPSTATFAPPPAAEPQPEAAASALAWPAHGTVTTPFGAGRNHGIVITSTGGDRTVRA
FT                   AAPGRVVYAGTGVAAYGPLVILKHENGLITAYGHNEKLLVNEGDAVSAGQPVAEMATDA
FT                   SGRSTFEFEVRRNGKAVDPLGLLPRNGS"
FT   gene            complement(421569..422204)
FT                   /locus_tag="BMA10247_A0473"
FT   CDS_pept        complement(421569..422204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0473"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02327"
FT                   /protein_id="ABO02327.1"
FT                   /translation="MQKAAFVAAYRLVGCGLILSATCHSIARRWNAPTFRLDNFLSYFT
FT                   QLSSLYTAIVLLAGLWLATKPPSRRYESARGAVVLYMAITGIVYELLLAHLDAVHHATP
FT                   YYTNWILHRVIPIAVFLDWLYVAPRVRIDWSQLARWLAFPVAYLGYTLVRGALIDWYPY
FT                   PFVDPRAHGYLMVAAYSGAIAAGSIGFAALIVLLGNRTGAPAPQAEHA"
FT   gene            422473..423009
FT                   /locus_tag="BMA10247_A0475"
FT   CDS_pept        422473..423009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0475"
FT                   /product="putative cytochrome b561"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02983"
FT                   /protein_id="ABO02983.1"
FT                   /translation="MNRILAGQERYNRPAVFFHWAIFLLVALAYLAIEVRGPKGTDSRV
FT                   FWSNVHYLAGSLVLALAVLRIVWRFAGGAPRELPQPAWLALFAKLAHLALYAFIVAQPL
FT                   LGIMTLNFGGKPVTLAGIDWSFTLFAPNAALRSTVKEAHELIGNVFYYVIGLHALAALW
FT                   HHFVKRDATLRRMTF"
FT   gene            complement(422964..423077)
FT                   /locus_tag="BMA10247_A0474"
FT   CDS_pept        complement(422964..423077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0474"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01814"
FT                   /protein_id="ABO01814.1"
FT                   /translation="MRARPAHAHRCIRNDARRGRRARQNVIRRSVASRFTK"
FT   gene            423170..423565
FT                   /locus_tag="BMA10247_A0476"
FT   CDS_pept        423170..423565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02166"
FT                   /protein_id="ABO02166.1"
FT                   /translation="MPNRFRKLTAWLGMLAIALAIVAPLVSQASARSAAPSSGAVICGD
FT                   EHRAQPAEAGIAHDGPVHDGVAHHALHLDACGYCAFFAHSPAIGAAAPSLFAIHVAAVA
FT                   PPIPSGAAAPSLERHTHAYPRAPPTDA"
FT   gene            423653..425890
FT                   /locus_tag="BMA10247_A0477"
FT   CDS_pept        423653..425890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0477"
FT                   /product="TonB-dependent copper receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01778"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01646"
FT                   /protein_id="ABO01646.1"
FT                   /translation="MTSTFLRHAPAAREGHARRRRRAITLTVPALAAGAFHLAPAVAQT
FT                   SEAVHGHGTLGASGVASRAETDAASAKSDGAVREAASRTATGAAPDATTLPTIEIVAAP
FT                   ESTPLVVVTDPKTPRQPLPASDGADYLKTIPGFASIRSGGTNGDPVLRGMFGSRLNILA
FT                   NGMPTLGACPGRMDAPTSYIASESYDKVTLVKGPQTVLYGPSASAGTVLFERVTPRFKT
FT                   PGMRFDGSVVGGSFGRNDQNVDVTAGTPDFYGRVSANHAHSQDYEDGNGRTVPSQWDKW
FT                   NADAALGWTPDDNTRLELTAGTGDGYARYAGRGMDGAHFRRETFGLKFDKKHIGDVLDR
FT                   IEAQVFYNEADHVMDNYTLRMPDPTSSMPMRMASEVRRRTLGARVAATLRLTDAFKLVT
FT                   GVDAQSNRLDSRSAMGMQNYGDKPWNPQANMWNAGAFGELTWYASDASRVIGGARIDYA
FT                   AARDKRATTGGMKMSMRNPTFDDLRSRVLPSGFVRYERDLASLPVTWYAGIGHAQRFPD
FT                   YWELFSAKRGPNGSINAFSAIKPEKTTQLDIGAQYKSDKLDAWVSAYAGYVQDFILFDY
FT                   ATGPMGQITRATNVNAQIMGGEVGASWRPLAPWRFEGSLAYAWGRNVQSGAPLPQMPPL
FT                   EARFGVEYTRGPWSAGGLWRVVAPQHRYALNEGNVVGKDFGPSAGFGVLSLHAQYNVSK
FT                   TVQISVGVDNVLDKTYAEHLNLAGNAGFGYPANLPVTEPGRTAWVRLSTKL"
FT   gene            426241..427266
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0478"
FT                   /note="triacylglycerol lipase; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00561; match to
FT                   protein family HMM PF05057; match to protein family HMM
FT                   PF07819"
FT   gene            427311..428345
FT                   /locus_tag="BMA10247_A0479"
FT   CDS_pept        427311..428345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0479"
FT                   /product="lipase chaperone"
FT                   /note="identified by match to protein family HMM PF03280"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01974"
FT                   /protein_id="ABO01974.1"
FT                   /translation="MKGEGSVARRVALYCVAGAVAAGAVWYVVGAPAKRDAGASPASPE
FT                   LAASAPVAVAARADAGSAASGLPASLAGSSAPRLPLDAHGHLAKARAVRDFFDYCLSAQ
FT                   SELSAQALDALVTREIAAQLDGTLAQGEALDVWKRYRAYLDQLAQLPDGGAPGNKLDLA
FT                   ALQLALDQRASIASRALGDWAEPFFGAEQQRQRYDLARLRIVRDASLTDAQKAARLAAL
FT                   EQQLPLDQRAEQAREKQQNDAVARIAQLQKSGASPDEMRAQLAQSLGPEAAERVAKMQQ
FT                   ANDAWRAKYDEYAAQRAQIDAQHLSPQDRDTQIAQLRQRYFTQPGEALRAASLDRGGAA
FT                   TQTQ"
FT   gene            complement(428447..429976)
FT                   /locus_tag="BMA10247_A0480"
FT   CDS_pept        complement(428447..429976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0480"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02498"
FT                   /protein_id="ABO02498.1"
FT                   /translation="MDTVILSDWLAARLERHSAEPMYRQLLRLMQQAILSGELTPGTKL
FT                   PSSRTLATDLAIARNTVLHVYDQLTTEGYVLTTTGSGTYVADTRPDAAAMRAQTGAPAH
FT                   PSDETRDAQQRAHGALSARGAQLIRHAGVSRRQWGAFMPGVPDVSEFPTRTWSRLQARL
FT                   WKEANPELLTYAPGGGYRPLRRALSDYLRVARSVKCSPDQIIITTGIHQSIDLSVRLLA
FT                   DVGDRAWVEEPCYWGVRSVLQAAGLALAPVPVDQEGLAPRAQDLKRPPRLVLVTPSHQY
FT                   PLGMVMSLARRRMLLEYARQHQCWIIEDDYDSEFRYGSRPLASLQGLDDAGRVIYVGSL
FT                   GKMLFPSLRLGYMVVPEHLVETFRTGLSELYREGQLMQQAVLAEFIMDGYLTSHVRRMR
FT                   ALYGERRQLLIDAIHARFGDALPVMGDEAGLHLVIGLPNGCDDRAITQTAFDAGVIVRP
FT                   LTTYYNHADTAREGLLLGYACVPNERIAPAFDTLAQIIEAHLNRRAKQRAA"
FT   gene            430085..431185
FT                   /locus_tag="BMA10247_A0481"
FT   CDS_pept        430085..431185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0481"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03023"
FT                   /protein_id="ABO03023.1"
FT                   /translation="MKTDDAIVSFRGVRKTYDGETLVVKALDLDIRRGEFLTLLGPSGS
FT                   GKTTCLMMLAGFEFPTGGEIRLDGELLNNVPPHKRNIGMVFQNYALFPHLSVEQNVDYP
FT                   LNVRRMPAAERAARVAAALAMVQMERFAKRYPAQLSGGQQQRIALARALVFEPKLVLMH
FT                   EPLGALDKQLREHMQYELKALHEKLGLTFVYVTHDQGEALTMSDRVAVFDKGIVQQLDT
FT                   VDRLYESPCNEFVANFIGDSNRLRGTVASVHGEFCEFRLEDGTRLVGLNAGNAQAGASG
FT                   VACIRPERMSVAPGSGRAANGAANALAGEARSLIYFGDHVRMRCALPGQDECFVKVPLG
FT                   TGALDAFAPGVPISLEFQPEHLRVFA"
FT   gene            431182..432306
FT                   /locus_tag="BMA10247_A0482"
FT   CDS_pept        431182..432306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0482"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   periplasmic spermidine/putrescine-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03697"
FT                   /protein_id="ABO03697.1"
FT                   /translation="MNAKPRVARRASYNHHASSSVTRGNIMHHTFNTPRRAVALLSLAA
FT                   FCATAGAAELTVVNFGGANGDAQKAAFNQPFEKATGNKVTAVEYNGEQAKVKAMVEAKH
FT                   VNWDVVEVESGDLNRGCDEGLYEKLDWAKIAKKSDLIAESPQTCGVGFFVWSTALAYDA
FT                   DKLKRAPAGWADFWDVKKFPGKRGMHKGARYNLEFALMADGVAPKDVYKVLATKAGQDR
FT                   AFKKLDELKPNIQWWEAGAQPPQFLVAGDVVMSTAYNGRISAAQKEGKNLKVVWSGSIY
FT                   DLDYWAIPKGTPNKALAEKYIAYTLSSKPQQDYAQHIAYGPANVAAIKALDAKTLANLP
FT                   NSPANGKNAVLQNITFWTDHGDELEQRFAAWASK"
FT   gene            432322..432456
FT                   /locus_tag="BMA10247_A0483"
FT   CDS_pept        432322..432456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03471"
FT                   /protein_id="ABO03471.1"
FT                   /translation="MKQTAARAVAACATFLRTAFRPETTVEYDDDRYAVGAADSIAQA"
FT   gene            432407..433666
FT                   /locus_tag="BMA10247_A0484"
FT   CDS_pept        432407..433666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0484"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03323"
FT                   /protein_id="ABO03323.1"
FT                   /translation="MTIATQSAPPTQSLRRELKAAEARRRTMALLLVAPLAIFLLLVFV
FT                   VPIGALLTRAVQNPEIATALPRTVAALSNWDRKAAPADAAYAALAADLTQIADGEAMGA
FT                   LARRLNTEIPGYRSLVAKTARAMPLTGDANAPLAPAQTRAKLIELDERWGDAAYWQAIA
FT                   KNGGRYSPFYLLAALDHKQDGFGSIVPADPDQSIYLAVFGRTLLIGFAVTLFALALGYP
FT                   LAYWISTLPERRANLAMILVLIPFWTSVLVRVAAWIVLLQSEGLVNRALIDTGLISQPL
FT                   ALLFNRVGVYISMTHILLPFMILPLYSVMKSIPPSYQRAAVSLGSHPFAAFWRVYVPQT
FT                   YPGVGAGALLVFILAIGYYITPALLGGPNDQMVSYYVAYFTNVTINWGMACALGGLLLA
FT                   ATLVLYAIYGRFTRSQLSLG"
FT   gene            433667..434523
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0485"
FT                   /note="polyamine ABC transporter, permease protein,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error"
FT   gene            complement(434618..435076)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0487"
FT                   /note="serine protease, subtilase family, truncation;
FT                   comparison of this gene to its homologs suggests this gene
FT                   has been truncated"
FT   gene            complement(435098..435931)
FT                   /locus_tag="BMA10247_A0488"
FT   CDS_pept        complement(435098..435931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0488"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02310"
FT                   /protein_id="ABO02310.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(435955..436218)
FT                   /locus_tag="BMA10247_A0489"
FT   CDS_pept        complement(435955..436218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0489"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03306"
FT                   /protein_id="ABO03306.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            436514..436786
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0490"
FT                   /note="transposase, truncation; comparison of this gene to
FT                   its homologs suggests this gene has been truncated;
FT                   identified by similarity to GB:CAA60622.1"
FT   gene            436798..438474
FT                   /locus_tag="BMA10247_A0491"
FT   CDS_pept        436798..438474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0491"
FT                   /product="hemolysin secretion/activation protein,
FT                   ShlB/FhaC/HecB family"
FT                   /note="identified by similarity to SP:P16465; match to
FT                   protein family HMM PF03865; match to protein family HMM
FT                   PF08479"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03740"
FT                   /protein_id="ABO03740.1"
FT                   /translation="MTLAMTVLLAGRSAPASAFGPTVQDRERDLGEKARRQQMIEQHRR
FT                   GHAAEPAAGLPAPVQAPELGGARFPITQIEVRGGARHSREIDRIVERYRGATMGQAEIF
FT                   ALLRDLMNFYYGRGYITTGVSLAEQNLSSGKLIVVVHWGYVKGWRVNGKAPEGMRERLM
FT                   LSSAMPGIEGSVLNIHDIDQAIENLNGLGRAAKINVVPAEEAGYSYLDVVLQRSKPFAV
FT                   SASVDNSGLGDRAGDGLYRYGVDIAVAHLLGWNDVLTLSAGRRYYQDPAHHAYDSLAVS
FT                   YGWRVGRWSADLRYIAQPTKSLLSGTYGDYQLSGNTQDVNLRVSRVLRRWRTGTDAVYV
FT                   AIDRKRVRNYIDDTLIEINSNTHTSVTAGVNRLDSLFGGVVFADGGWTRGVGWLGASED
FT                   PVSAGQGPLSRYDKFNLNLNWSRDFTAGSLRARYTAAMGAQYSKDDLYYDSKFVIGDQY
FT                   TVRGFKIRSAYGDSGVSVSNTLSFPFPTSIGTVTPLVGVDWGAVGNNGEADNGGWIGAV
FT                   AGGLRVSTKWANAAVTIGKPFRALPGMGYGVVWYLSASATY"
FT   gene            438557..441292
FT                   /locus_tag="BMA10247_A0492"
FT   CDS_pept        438557..441292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0492"
FT                   /product="hemagglutinin, homlog"
FT                   /note="identified by match to protein family HMM PF05860;
FT                   match to protein family HMM TIGR01901"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03118"
FT                   /protein_id="ABO03118.1"
FT                   /translation="MQRNEVVNRNVFRLVLNRVAGMPVPMPAAEVSRGRGKLGCGGVRA
FT                   QRRGGAACAELLGVAGPSLAFAAVVADPNGGAQRPGMATTANGTDLVNIVAPDATGLSH
FT                   NKFNEFSPVGRGVVLNNSVRPGESQIGGMAAQNPNLMQPATRALLEVTQQRSVLQGTLE
FT                   AFGGKLDVLVANQHGVTINGLTTLNVGRLGVTTGQVLPQVAGQLRLGVTQGDVLIDHGG
FT                   IDTQGLDMFDVVSRSIAVRGPIHDSSRAAGADVRLVAGATAYDPQTGHYEAIAADESKA
FT                   PVQEGISGELLGAMHGRHIVLVSTESGVGVRHDGPIKSANDIRVSANGEVTLGGPQQAA
FT                   QEAVAGAQAVGGAGMQNVIAGGTVSVCARGHVAIQGAVIAGQDVDLQGKSVKAGRMSAQ
FT                   RDALVTAADGVTLDGPVDAKRHVWIGAHDDVVIREAAAGQNVVLLGRSVTAGRLDAQRD
FT                   VLAAARDGVTIHEAAAAGQDVVLQGSSARVGQMSAQRDVLVMAADGVTLDGPVSAQRAV
FT                   WVETQGDVAGSEWIKAGRDVQIGAAADLAGAVTAEEMQQLKAHGDAANRRRVKAGRNEP
FT                   AGTAAERPAAAEQTVAVADAMREIGVGGDRLSGLDAAPGTPFGAHPQAMFDDPAAQIAR
FT                   SARSTATAGGHAGSFMRVGDGHIAKMTTSREAEIYENYRLALAGVIPDTVPPEEVDWRV
FT                   GVTARQRQAMATFKGWAEMKGQRVVVMQALGAEIAPEDKIELDVKIGASTVSRTELIGA
FT                   GRTRWQALSKKVRLTAADLLRGSRSLVGDDRGYTLAGRTSGGIALDARNSRNSVGRSSE
FT                   SLIREALDRSPDTRWRNAQHLLGQLQTIREKMHALPLTFVASSVLIAIDKRKPENSVAR
FT                   LIDLAHPVQPFENEADYEKVNHRFEDGLDKLIRLFQQVEK"
FT   gene            complement(441539..444256)
FT                   /gene="acnA"
FT                   /locus_tag="BMA10247_A0493"
FT   CDS_pept        complement(441539..444256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="BMA10247_A0493"
FT                   /product="aconitate hydratase 1"
FT                   /EC_number="4.2.1.3"
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM PF00694; match to protein
FT                   family HMM TIGR01341"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02685"
FT                   /protein_id="ABO02685.1"
FT                   /translation="MAHNLHKTLKEFDSGSGKGKFYSLPKLGKELKTKIERLPVSIRIV
FT                   LESVLRNYDGKKITEEHIEQLANWKPNAKRVDEIPFVVSRVVLQDFTGVPLLADIAAMR
FT                   GVAKRAGKNPKKIEPLVPVDLVVDHSVQIDYFRQKDALDLNMKLEFQRNNERYQFMKWG
FT                   MQAFDTFKVVPPGVGIVHQVNLEYLARGVHKKKDDGDTVYYPDTLVGTDSHTTMINGIG
FT                   VVGWGVGGIEAEAGMLGQPVYFLTPDVVGVELKGKLREGVTATDLVLTITEMLRKEKVV
FT                   GKFVEFFGEGTKTLALPDRATIANMAPEYGATMGFFPVDEKTIDYFKGTGRTKAEIAAF
FT                   ENYFKAQELFGIPKAGEIDYTKTLTLDLSTVAPSLAGPKRPQDRIEIGNVKSTFTDLFS
FT                   KPVAENGFAKKADDLTAEYRTSNGVAVKNGDVLIAAITSCTNTSNPSVLLAAGLLAKKA
FT                   VEAGLTVAPHIKTSLAPGSRIVTEYLTKTGLLPYLAKLGFEVAAYGCTTCIGNAGDLTP
FT                   ELNEAITKNDIVAAAVLSGNRNFEARIHPNIRANFLASPPLVVAYAIAGNITKDLMTEP
FT                   VGQGKGGRDVYLGDIWPSSDEVQALLKFALDPEKFEKNYSHLTKKGDLWSKIEGESGQV
FT                   YDWPKSTYIAEPPFFGSDFSMEPAASIATVKGARALGIFGDSVTTDHISPAGSIKEDSP
FT                   AGKWLKANGVQKADFNSYGSRRGNHDVMMRGTFANVRIKNLMIPAKADGTRVEGGLTIH
FT                   QPSGEQLSIYDAAMKYIDADTPTVVFAGEEYGTGSSRDWAAKGTQLLGVKAVIARSFER
FT                   IHRSNLVGMGVLPLQFKGSDSIQSLGITGDETYDIEGLGDDFKPQQDVTLVIHRKNGET
FT                   KRVPVLLRIDTPIEVDYYKHGGILPFVLRSLLAA"
FT   gene            complement(444304..445755)
FT                   /gene="prpD"
FT                   /locus_tag="BMA10247_A0494"
FT   CDS_pept        complement(444304..445755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="BMA10247_A0494"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number="4.2.1.79"
FT                   /note="identified by match to protein family HMM PF03972;
FT                   match to protein family HMM TIGR02330"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01999"
FT                   /protein_id="ABO01999.1"
FT                   /translation="MSAPIPNVRPAPDSVLVEIADYALNHRIDSALALETARHCLIDTL
FT                   GCGLEALSYPACTKLLGPIVPGTIVPHGAKVPGTSLQLDPVQAAFNIGAAIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILATADWLSRTAVASGKRPLAMKDVLVAMIHAHEIQGCLALENS
FT                   FNAVGLDHVLLVKVASTATVGCLLGLTRDELINALSLAFVDGQALRTYRHAPNTGSRKS
FT                   WAAGDATSRAVRLALIAKTGEMGYPRALTAKTWGFYDVSFGGKPFRFQRPYGTYVMENV
FT                   LFKLSYPAEFHAQTAVEAAMTLHARLAAAGRTADEIRRVTVRTHAAAMRIIDKQGPLAN
FT                   PADRDHCIQYMIAVPLLFGRLTAADYEDAVAADPRIDALRAKIACVEDPQFTQDYHDPA
FT                   KRSIANALTIEFDDGSTLAEVAVEYPIGHMRRRAEGMALLIDKFRTNLARRFPAKQQQA
FT                   ILDVSLDQAKLEAMPVDEYVDLYVI"
FT   gene            complement(445832..446341)
FT                   /locus_tag="BMA10247_A0495"
FT   CDS_pept        complement(445832..446341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03416"
FT                   /protein_id="ABO03416.1"
FT                   /translation="MKKLLIATVIGALSATMLAAAPSAFAQDSSATAKKATPKRPAPKR
FT                   HLIPRSKKAQARAAAKTDPVPEGAVKWACKDGLSYELAGDMKRDQIVTVHWANKNYKLP
FT                   RQQTTTGADMFYDPASGMKLVVIPTKGMLFSDKDDSRLADECQTPEMAAGNGLAPTQSN
FT                   ELKPSN"
FT   gene            complement(446498..447517)
FT                   /locus_tag="BMA10247_A0496"
FT   CDS_pept        complement(446498..447517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0496"
FT                   /product="putative lyase"
FT                   /note="identified by match to protein family HMM PF03328"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02743"
FT                   /protein_id="ABO02743.1"
FT                   /translation="MSALTPAEVLYEGVAPPAILPCCDHYAGSEKLMLKSLALQAELGP
FT                   VFDITLDCEDGAAVGREAEHAARVAALVGGEANRFGRVGVRIHDISHPHWRDDVRVVLR
FT                   AARPPAYLTLPKVGGAADAAEMCAFIEASRVELGIAQPIPVDVLIETHGALADAARIAA
FT                   LPIVATLSFGLMDFVSAHHGAIPDDAMRAPGQFDHPLVRRAKLEIAAACHAHGKTPSHN
FT                   VTTEVRDMRVVANDARRAREEFGYTRMWSIHPAQIREIVAAFAPRADDIARASRILLAA
FT                   QAADWGPTRHDDALHDRASYRYYWAVLRRARATGQPLPAESAPLFGDAGERAARGREK"
FT   gene            complement(447715..448698)
FT                   /gene="mdh"
FT                   /locus_tag="BMA10247_A0497"
FT   CDS_pept        complement(447715..448698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="BMA10247_A0497"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="identified by match to protein family HMM PF00056;
FT                   match to protein family HMM PF02866; match to protein
FT                   family HMM TIGR01759"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02347"
FT                   /db_xref="GOA:A3MBR2"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MBR2"
FT                   /protein_id="ABO02347.1"
FT                   /translation="MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP
FT                   QAQAAVKGVVMELDDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLS
FT                   ANAEIFTVQGAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLPKKNFTAMLRLDHNR
FT                   ALSQLAAKSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLKLINDDVWNRDTFIP
FT                   TVGKRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNGKWVTMGIPSDGSYGIPEDIIY
FT                   GVPVICENGEYKRVEGLEIDAFSREKMDGTLAELLEERDGVAHLLK"
FT   gene            448997..449797
FT                   /locus_tag="BMA10247_A0498"
FT   CDS_pept        448997..449797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0498"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02935"
FT                   /protein_id="ABO02935.1"
FT                   /translation="MTSNQASAPNPNGQAGSTQPGGEAAAAPSPTFSPLYRQIKALITQ
FT                   SLEAGEWKPGEIIPSEVELAGRYKVSQGTVRKAIDELAADNLLVRRQGKGTFVATHSEE
FT                   RAQFRFLRLLADDGAEHPHVSRLLECRRMRAPAEIARQLDLKPADPVVQVRRVLEFDGV
FT                   DTVLDEIWLPGAMFRGLTFERLSEYKGPLYAMFESEFGTRMIRASEKIRAIAAEPAVAD
FT                   VLRVPPGFPLLSVERVSYTYGDRPVEVRRGWYVTTGYYYQNDLS"
FT   gene            450072..450413
FT                   /gene="sdhC"
FT                   /locus_tag="BMA10247_A0499"
FT   CDS_pept        450072..450413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="BMA10247_A0499"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="identified by match to protein family HMM PF01127;
FT                   match to protein family HMM TIGR02970"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02400"
FT                   /protein_id="ABO02400.1"
FT                   /translation="MPLAARVSILHRVSGALLFLFLPFLLYLFDQSLTSELSFEVFKAF
FT                   LSNIIVKLIVLALSWAFLFHFCAGIRHLMMDMNHDAVSKERGKKTSVVVFAVSTLLTIA
FT                   VALKLFGAF"
FT   gene            450418..450786
FT                   /gene="sdhD"
FT                   /locus_tag="BMA10247_A0500"
FT   CDS_pept        450418..450786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="BMA10247_A0500"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="identified by match to protein family HMM PF01127;
FT                   match to protein family HMM TIGR02968"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01766"
FT                   /protein_id="ABO01766.1"
FT                   /translation="MAANNRIGSKRLVVGAHYGLRDWLAQRVTASVMAIYTVILLVWFF
FT                   IARDFSYEGWASIFATQWMKLATFVTLLSLFYHAWVGVRDIWMDYIKPVGVRLLLQSLT
FT                   IVWLLACAGYAAQILWRV"
FT   gene            450791..452566
FT                   /gene="sdhA"
FT                   /locus_tag="BMA10247_A0501"
FT   CDS_pept        450791..452566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="BMA10247_A0501"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF02910; match to protein
FT                   family HMM TIGR01812; match to protein family HMM
FT                   TIGR01816"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03470"
FT                   /protein_id="ABO03470.1"
FT                   /translation="MAAIKTSLPRRKFDVVIVGAGGSGMRASLQLSRAGLSVCVLSKVF
FT                   PTRSHTVAAQGGIGASLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPNVVYEL
FT                   EHFGMPFDRNADGTIYQRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKT
FT                   QFFVEWMALDLIRDADGDVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFI
FT                   NTGDGLGMAARSGIALQDMEFWQFHPTGVAGAGVLITEGVRGEGGILRNANGERFMERY
FT                   APTLKDLAPRDFVSRSMDQEIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALK
FT                   FANVDCIKEPIPVVPTIHYQMGGIPTNIHGQVVGTSRDHKEPINGFYAVGECSCVSVHG
FT                   ANRLGTNSLLDLVVFGRAAGNHIVEHVKNQRDHKPLPADAADFSLSRLAKLEKSTSGEY
FT                   TQDIANDIRATMQKHAGVFRTSALLKEGVEQMAGLKERAAAVHLKDKSKVFNTARVEAL
FT                   ELANLIEVARATMVSAEARKESRGAHAHSDYEHRDDENWLRHTLWYSEGDRLDYKPVQM
FT                   KPLTVESVPPKARTF"
FT   gene            452588..453289
FT                   /gene="sdhB"
FT                   /locus_tag="BMA10247_A0502"
FT   CDS_pept        452588..453289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="BMA10247_A0502"
FT                   /product="succinate dehydrogenase, iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="identified by match to protein family HMM TIGR00384"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02707"
FT                   /protein_id="ABO02707.1"
FT                   /translation="MAKRIFEIYRYDPDKDAAPRMQTYELEIQHERMLLDALVKLKSVD
FT                   ETLSFRRSCREGVCGSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLICDFT
FT                   QFFNQYHSIRPYLINDEPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPDK
FT                   FVGPAGLLQAYRFIADSRDRATGERLDNLDDPYRLFRCHTIMNCVDVCPKGLNPTKAIG
FT                   KIKELMVRRAV"
FT   gene            453291..453563
FT                   /locus_tag="BMA10247_A0503"
FT   CDS_pept        453291..453563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0503"
FT                   /product="TPR repeat protein"
FT                   /note="identified by match to protein family HMM PF03937"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02014"
FT                   /protein_id="ABO02014.1"
FT                   /translation="MSESSHQSDPHRRARLRWRARRGLLENDLIFERFFARHEHDLSDA
FT                   DVSALSRLLDLSDNDLMDLLLACKEPEGDLAGPDMSRLLEMLRSV"
FT   gene            453616..454917
FT                   /gene="gltA"
FT                   /locus_tag="BMA10247_A0504"
FT   CDS_pept        453616..454917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="BMA10247_A0504"
FT                   /product="citrate (Si)-synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="identified by similarity to SP:P0ABH7; match to
FT                   protein family HMM PF00285; match to protein family HMM
FT                   TIGR01798"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03764"
FT                   /protein_id="ABO03764.1"
FT                   /translation="MTPSDVKATLSFSDNSPSVELPIYKGTMGPDVIDIRKLYGQTGKF
FT                   TYDPGFMSTASCNSAITYIDGDKGELLYRGYPIDNLAQNADFLESCYLLLKGELPNAAQ
FT                   KKEFVATVTKHTMVHEQMQFFFRGFRRDAHPMAILVAAVGALSAFYHDSLDINDPRHRE
FT                   VSAIRMIAKLPTLVAMAYKYSIGQPFVYPRNDLSYSANFMRMMFANPCEEYQVNDVLVR
FT                   ALDRILILHADHEQNASTSTVRLAGSSGANPFACIAAGIACLWGPAHGGANEAALNMLE
FT                   QIGTPENIPEFIKQVKDKNSGVKLMGFGHRVYKNYDPRAKLMRETCYEVLNELGLHDDP
FT                   LFKLAMQLEKIALEDEYFVSRKLYPNVDFYSGIVQRALGIPTSMFTCIFAMARTVGWIA
FT                   QWNEMIADPEQKIGRPRQLFIGETPRTAKPIEQR"
FT   gene            complement(455014..455988)
FT                   /locus_tag="BMA10247_A0505"
FT   CDS_pept        complement(455014..455988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0505"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02422"
FT                   /protein_id="ABO02422.1"
FT                   /translation="MKPRYERVAIPDGCSVRVYRRRLAQIPFEWHHHPEYELTLTLNSL
FT                   GKRFVGDHVADYAGDDLVLVPPNLPHTWVSDERLDPGEPLVALVLWFDGDWAQRVADCC
FT                   PEFAGLRTLLRRAAPGLAFAPQAAADVRARLPALVDRAPRVRLAAALDVLACLADAPAT
FT                   PLATAAAYRAASGAALAPEAERLDRVLDLLDRRFHEPLRVAELAALAHLSERSLQRRFA
FT                   RHVGESIGSYLQRLRLSHAARLLASTDWPVSLVATRSGYANLANFNRQFLAARRVTPRA
FT                   YRRFLAEHGRAPDDMPAHEASIDVRPPSLDHGPPRAGKNKIAR"
FT   gene            456064..456207
FT                   /locus_tag="BMA10247_A0506"
FT   CDS_pept        456064..456207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0506"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03113"
FT                   /protein_id="ABO03113.1"
FT                   /translation="MFSHVCMGVTDVERAFAFYAPLMEALRLDLKFRDPPDLPPSIGPM
FT                   GF"
FT   gene            complement(456218..457051)
FT                   /locus_tag="BMA10247_A0507"
FT   CDS_pept        complement(456218..457051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0507"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03799"
FT                   /protein_id="ABO03799.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(457075..457338)
FT                   /locus_tag="BMA10247_A0508"
FT   CDS_pept        complement(457075..457338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0508"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01883"
FT                   /protein_id="ABO01883.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            457507..457692
FT                   /locus_tag="BMA10247_A0509"
FT   CDS_pept        457507..457692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0509"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03752"
FT                   /protein_id="ABO03752.1"
FT                   /translation="MTAFLAADRATVDRVYALALRAGGASEGAPGLRPHYHPDYYGAYF
FT                   RDLDGNKLCVCCHEPA"
FT   gene            457973..458236
FT                   /locus_tag="BMA10247_A0510"
FT   CDS_pept        457973..458236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03335"
FT                   /protein_id="ABO03335.1"
FT                   /translation="MQRRATQPAPGRPAANCRQWARPVALGARDGASSGRVRAFVAMAA
FT                   YDAATASNTSRARETARSLGDEHRAAMFSSRHVMFAWPTMAR"
FT   gene            458550..459794
FT                   /locus_tag="BMA10247_A0511"
FT   CDS_pept        458550..459794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07350"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02247"
FT                   /protein_id="ABO02247.1"
FT                   /translation="MPFPIDDLPAAIRTTKAVLRAAMPNRAPVFRALEGDIARQADAIL
FT                   TDRAQGRDTIPVLRFADIAADRVDPASLAALRTRGACVIRGVFDARQASDWNDEIAAYV
FT                   EANRLDDKLARRAEDRYFGTLASSRPQIYGIYWSKPQIAARQSPALTRARVFLNRLWRA
FT                   QSEGRVHFDPARAPAYADRIRRRPPGSSSLGLSPHVDGGSVERWLEPNYRRVYRHVLAG
FT                   DWRAYDPFDAAFRPDVEEIPSPAVCSMFRTFQGWTALTPQGPGDGTLQLIPVANAMAYV
FT                   VLRALQDDVPDDDLCGAQPGRALSVLPAWHAPLLAALVPIPPMEPGDAVFWHGDVVHAV
FT                   EDAHRGTGYSNVMYIASAPGCAKNDAYLKRQLPSFLRGESPPDFPADHFETDFTGRARA
FT                   DDLSALGREQMGFEP"
FT   gene            complement(460046..462769)
FT                   /locus_tag="BMA10247_A0512"
FT   CDS_pept        complement(460046..462769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0512"
FT                   /product="2-oxo-acid dehydrogenase E1 component"
FT                   /note="identified by match to protein family HMM TIGR00759;
FT                   match to protein family HMM TIGR03186"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01593"
FT                   /protein_id="ABO01593.1"
FT                   /translation="MNDLSNGIRPVLATARRHDDTDPQETAEWLDALDGVVAHAGAERA
FT                   QYLLAQLAEHAARRRLAPPHAGATPYVNTIPVDEEPPYPGDLQLEERLAAVLRWNALAM
FT                   VVRANRAYGELGGHIASYASAADLFEVGFNHFFRAAGDASGGDLVYFQPHSSPGVYARA
FT                   FLEGFLSDAQLEHYRREIAGPGLCSYPHPWLMPDFWQFPTGSMGIGPINAIYQARFMRY
FT                   LQNRGLLRTEGRKVWGFFGDGEMDEPESIGALSLAAREGLDNLVFVINCNLQRLDGPVR
FT                   GNGRIVDELESQFAGAGWNVIKVLWGSDWDALFARDATGALARAFAQTVDGQFQTFSAN
FT                   DGAYNRARFFGQNDALAALVAHLRDEDIDRLRRGGHDARKLYAAYERAVRHEGRPTVIL
FT                   AKTMKGFGLGAIGQGRMTTHQQKKLDVEHLLAFRDRFRLPLTDEDVAQLRFYRPEKDSP
FT                   EMRYLHARRAALGGCLPRRRAAATAALTVPSLPSWGQFALDGGREMSTTMAIVRMLGGL
FT                   LKDAALGPRIVPIVADEARTFGMANLFRQVGIYSPLGQRYEPEDLGSMLYYREDTRGQI
FT                   LEEGISEAGAISSWIAAATSYSVHDLPMLPFYIYYSMFGFQRIGDLIWAAADQRARGFL
FT                   IGATSGKTTLGGEGLQHQDGTSHLAASTVPNCRAWDPAFAYEIAVIVDEGMREMVERQR
FT                   DTFYYLTVTNENHAQPTLPADRLDAVRGGILKGMYPLDAAALPAARVQLLGSGAILGEV
FT                   QAAARLLRDDWRIDAAVWSVTSFTELQRDGIAAERAQRLFDADDANERSPTPHVTSALA
FT                   ATQGPVIAATDYARALPELIRAYVPRRYVTLGTDGFGRSDTREALRAFFEVDRGSIVIA
FT                   ALRALADDGEVTRTVVRDAIARYGKRDASRTPPWER"
FT   gene            462930..463457
FT                   /locus_tag="BMA10247_A0513"
FT   CDS_pept        462930..463457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0513"
FT                   /product="Bkd operon transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03626"
FT                   /protein_id="ABO03626.1"
FT                   /translation="MSAPSRRLDRIDIGILNQLQQNARITNAELARAVNLSPTPCFNRV
FT                   RALEKLGLIKQQVTLLDPQPLGLRINVFIQVSLEKQAEDALRRFEEAIDKRPEVMECYL
FT                   MSGDADYLLRVVVPSMKSLERFILDQLTTIPGVSNIRSSFALKQVRYRTALPLPADGLT
FT                   LADADDAPQEWV"
FT   gene            463448..463687
FT                   /locus_tag="BMA10247_A0514"
FT   CDS_pept        463448..463687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02981"
FT                   /protein_id="ABO02981.1"
FT                   /translation="MGVSEAFAARSRRAMRAHCPPRCDLMPHGRAPLRCGIVRAGRAAR
FT                   RVAQAAGGARARAAVTVRCLACRGIAGATRQSGR"
FT   gene            463641..463757
FT                   /locus_tag="BMA10247_A0515"
FT   CDS_pept        463641..463757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0515"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03068"
FT                   /protein_id="ABO03068.1"
FT                   /translation="MPAAALPAQRDNRDDSLAVFFEAFDRMIIRMTRAIGYR"
FT   gene            463941..464075
FT                   /locus_tag="BMA10247_A0516"
FT   CDS_pept        463941..464075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02649"
FT                   /protein_id="ABO02649.1"
FT                   /translation="MGRRLRAAGAQARAAASGSVDTRPSAMLGRIAIFQSPACVAPIF"
FT   gene            464177..465124
FT                   /locus_tag="BMA10247_A0517"
FT   CDS_pept        464177..465124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02092"
FT                   /protein_id="ABO02092.1"
FT                   /translation="MTRYEMKRQGGTQAEGPPVDFGRMHEEFRRAEDADLRALVDENLR
FT                   RAEREWRRIQPAIDRSAGDGDAALGAARPCACEAPGACGQPDLPDVPDPPIASDPADAP
FT                   LAPSSGAHARAASCGHATKTLIPGYPVLDADRPSVGEFVAFVADMRNSSARFSEAAAFP
FT                   HVRCGLQRIFYETSALIPAIAHTAARAGGQATELLGDGLLILFHIERGKREQVIARACA
FT                   AAARCIDSSIACVNDLLWQRHRLPPLKIGIGLAYGPAIVKVVDANGRHPKVIGQCIWDA
FT                   TKLSGGENAIGLSRPLQDFLRAKGFNERFEVIHA"
FT   gene            465117..466412
FT                   /locus_tag="BMA10247_A0518"
FT   CDS_pept        465117..466412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0518"
FT                   /product="putative EDTA monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02440"
FT                   /protein_id="ABO02440.1"
FT                   /translation="MHEHRQMHLNCHIVGVGQHPAGWRTLRNTRAIVDPDFYRRVARVA
FT                   EQGKFDALFFSDSLSLHGHAHGPSQMLDPLVVASALALVTERIGLICTASTTFSDPFSL
FT                   ARRFLSLDQMSGGRAGWNAVTTYNPAAAANFGPVALPSAAERYARADEFIDVTIKLWES
FT                   WGERALVADAASGVFADPAQVRRIDHHGRHFDIAGPLNVPRSPQGRPLLVQAGASEAGL
FT                   ELAARHADMVFTSQHSLEGAQRFYADLKSRVHAKGRDPDQFGILPGLYPVIGSTMAEAR
FT                   ARKDEMDALRDPGGDIEMLARQFGIRPEDLALDAPLPYERIARASRDHVSHGFAAQMIG
FT                   FARGKNLTVRELIDHNLGMHRIVVGTPESIADDMTQWFEQGAADGFNLNFDVFPDGLQT
FT                   MVEHVVPLLQKRGLFRSDYSARTLKGHLGVRS"
FT   gene            complement(466486..466641)
FT                   /locus_tag="BMA10247_A0519"
FT   CDS_pept        complement(466486..466641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0519"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02815"
FT                   /protein_id="ABO02815.1"
FT                   /translation="MRREQAIGRARRDGTRGKAASVTRRRAARRGARRLTTRRSCARAF
FT                   THSSAR"
FT   gene            466804..468213
FT                   /gene="leuC"
FT                   /locus_tag="BMA10247_A0520"
FT   CDS_pept        466804..468213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="BMA10247_A0520"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM TIGR00170"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02973"
FT                   /db_xref="GOA:A3MBT5"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MBT5"
FT                   /protein_id="ABO02973.1"
FT                   /translation="MAQTLYDKLWNSHVVHTEEDGTALLYIDRQLLHEVTSPQAFEGLK
FT                   LAQRPVWRISANLAVSDHNVPTTDRSHGIADPVSKLQVDTLDANCDAYGITQFKMNDVR
FT                   QGIVHIIGPEQGATLPGMTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLLQKKS
FT                   KNMLVKVEGQLPRGCTAKDIVLAIIGQIGTAGGTGYAIEFGGSTIRALTMEGRMTVCNM
FT                   AIEAGARAGMVAVDDTTVEYLKGRPFVPTGAEWDQAVEYWKTFRSDEGAQFDRVVELDA
FT                   AQIVPQVTWGTSPEMVTSIDGRVPDPEREKDPVKRDAMERALAYMALAPNTPIEAIKVD
FT                   KIFIGSCTNARIEDIRAAAYVVKKLNRRVAPNVRLAMVVPGSGLVKAQAEREGLDKVFT
FT                   EAGFEWREPGCSMCLAMNADRLEPGERCASTSNRNFEGRQGQGGRTHLVSPAMAAAAAI
FT                   EGHFVDIRRLG"
FT   gene            468210..468359
FT                   /locus_tag="BMA10247_A0521"
FT   CDS_pept        468210..468359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0521"
FT                   /product="entericidin"
FT                   /note="identified by match to protein family HMM PF08085"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03648"
FT                   /protein_id="ABO03648.1"
FT                   /translation="MSVNASVFRRIAAAFALAGCVLGLAGCNTVAGVGEDLNAAGRAIK
FT                   RAAD"
FT   gene            468437..469087
FT                   /gene="leuD"
FT                   /locus_tag="BMA10247_A0522"
FT   CDS_pept        468437..469087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="BMA10247_A0522"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by match to protein family HMM PF00694;
FT                   match to protein family HMM TIGR00171"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02072"
FT                   /db_xref="GOA:A3MBT7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MBT7"
FT                   /protein_id="ABO02072.1"
FT                   /translation="MEKFNVHTGVVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNAFDE
FT                   WRYLDHGEPGQDNSKRPLNPDFVLNQPRYQGASVLLARKNFGCGSSREHAPWALQQYGF
FT                   RAIVAPSFADIFFNNCYKNGLLPIVLTEQQVDHLFNDTYAFNGYQLTIDLDAQVVRAPD
FT                   GREYPFEITAFRKYCLLNGFDDIGLTLRHADKIRQFEAERLAKQPWLDNRLVG"
FT   gene            469136..470203
FT                   /gene="leuB"
FT                   /locus_tag="BMA10247_A0523"
FT   CDS_pept        469136..470203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="BMA10247_A0523"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="identified by match to protein family HMM PF00180;
FT                   match to protein family HMM TIGR00169"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02578"
FT                   /protein_id="ABO02578.1"
FT                   /translation="MKIAVLPGDGIGPEIVNEAVKVLNALDEKFELEQAPVGGAGYEAS
FT                   GHPLPDATLALAKEADAILFGAVGDWKYDSLERALRPEQAILGLRKHLELFANFRPAIC
FT                   YPQLVDASPLKPELVAGLDILIVRELNGDIYFGQPRGVRAAPDGPFAGAREGFDTMRYS
FT                   EPEVRRIAHVAFQAARKRAKKLLSVDKSNVLETSQFWRDVMIDVSKEYADVELSHMYVD
FT                   NAAMQLAKAPKQFDVIVTGNMFGDILSDEASMLTGSIGMLPSASLDQRNKGLYEPSHGS
FT                   APDIAGKGIANPLATILSAAMLLRYSLNRAEQADRIERAVKAVLEQGYRTGDIATPGCK
FT                   QVGTAAMGDAVVAAL"
FT   gene            complement(470385..470546)
FT                   /locus_tag="BMA10247_A0524"
FT   CDS_pept        complement(470385..470546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02700"
FT                   /protein_id="ABO02700.1"
FT                   /translation="MTNPLLELPRLFRPRRDRAGKQAGTTDDDQIFVIVFVMMVILPMT
FT                   MARAPARA"
FT   gene            470545..471666
FT                   /gene="asd"
FT                   /locus_tag="BMA10247_A0525"
FT   CDS_pept        470545..471666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="BMA10247_A0525"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774; match to protein
FT                   family HMM TIGR01745"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03172"
FT                   /protein_id="ABO03172.1"
FT                   /translation="MNVGLVGWRGMVGSVLMQRMQEEGDFDLIEPVFFSTSNAGGKAPS
FT                   FAKNETTLKDATSIDDLKKCDAIITCQGGDYTSDVFPKLRAAGWNGYWIDAASSLRMKD
FT                   DAVIILDPVNLNVIKDALVNGTKNFIGGNCTVSLMLMALGGLFRENLVDWMTAMTYQAA
FT                   SGAGAQNMRELLAQMGALNGAVAAQLADPASAILDIDRRVLAAMNGDAMPTSQFGVPLA
FT                   GSLIPWIDKDLGNGMSKEEWKGGAETNKILGKPAMGEPGSIPVDGLCVRIGAMRCHSQA
FT                   LTIKLKKDVPLDEINGMLASANDWVKVVPNEREASMRDLSPAKVTGTLSVPVGRLRKLA
FT                   MGGEYLSAFTVGDQLLWGAAEPLRRMLRILLDK"
FT   gene            471802..474429
FT                   /locus_tag="BMA10247_A0526"
FT   CDS_pept        471802..474429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03504"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01641"
FT                   /protein_id="ABO01641.1"
FT                   /translation="MTPRLLSSTTIFDGLPRARRAVALAVLALAGASAAYAAPDAASAA
FT                   SAEQAAPLTITVRPGQSLNDIAVAVTQSHDPGVLARAGRALFDANPQAFMKRDPSRLKI
FT                   GAQLMVPALDATAASAAASAASAASTSAVTGAAPHPSASASAPAAASRPAAASGASHAA
FT                   TASGAAAFAASGVAAGSASGANGASAPGVSAPGAASAHAPSAVAPAAPVASSGAGSAHV
FT                   WSGSIQQAPAGANGASAAGAEALLAPGAANRAPSGSGAQAAGASQARPSSLQQLLALKN
FT                   RVLMELQKHGIGKPAANVAPAPAAGSAQKPQASAAAGAAASATAAATTASETIASEAAA
FT                   GSAASATPASAAPAASMPAAAPRVSAPAHAAAPQAPFNTGAAVAIGAALAALIVGFALR
FT                   RRKKGASADAIEPGAFTPAPALDPDAAAAIADAPAGPNAAEDARHDEAEPDKAAAARRA
FT                   SSAAPLAEAKRPPAQHGSEPPSADEDAAPAREPQAPAAQPLTLKTPRPDEQGGAPQSAG
FT                   DEPSGAKPAPYAWRQAFPSDAIAALDSLDMPLPPREAGATADRPEQSQHAEPAGSRGAQ
FT                   SATNGLPAAPPPMGAENAREGQTHGEAGSATDFEGAGSFDNDARVAPQRPEGATPRPVT
FT                   APDAMGRDEAAARAAESSPTESTRDAPRTPGAPAAESRLSTAGAGAAHSPMPDAAAAAE
FT                   AAAPHAATPSDAAPHDDGQTQAAPRPLDGGPQPPAVARHEAAPAHAEIPNAPLAPAAPA
FT                   WAAPQPPGMSFAEPAPAEPGDVPAAPDRAPAANPPPLGVAQFGALNLDFDLELPSGPSA
FT                   SLPAFTPEALAQIARNKLELASEYVELGDLAGARTLLHEVIEADHADTRDEARVMLAKL
FT                   ADLS"
FT   gene            474426..475241
FT                   /gene="truA"
FT                   /locus_tag="BMA10247_A0527"
FT   CDS_pept        474426..475241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BMA10247_A0527"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02169"
FT                   /db_xref="GOA:A3MBU2"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MBU2"
FT                   /protein_id="ABO02169.1"
FT                   /translation="MMRIALGIQYDGAAFCGWQSQPHGKTVQDALERSLAEFAQTSLHT
FT                   TVAGRTDTGVHGLGQVVHFDTDLDRADFSWVRGTNAFLPPTVAVQWAKPMPDTFHARFA
FT                   AFERTYYYALYVHPVRSPMLAGRAGWVHTPLDVDAMREAAAHLVGEHDFSAFRSSECQA
FT                   KSPVKHLYQIGIRPDGDFIHFRFRANAFLHHMVRNLMGCLVAVGRGRYPSSWLAEVLES
FT                   RDRDCAAPTFMPEGLYLAHVGYPAEFAVPPAQLGSVPWSSVWADLDGRT"
FT   gene            475241..476002
FT                   /gene="trpF"
FT                   /locus_tag="BMA10247_A0528"
FT   CDS_pept        475241..476002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="BMA10247_A0528"
FT                   /product="N-(5'phosphoribosyl)anthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="identified by match to protein family HMM PF00697"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03807"
FT                   /protein_id="ABO03807.1"
FT                   /translation="MTDTPDATLPADAPPNDAPAAGARRDTGGDGSRDAPPPRTRIKLC
FT                   GLSNAADIDWAAELGADAIGLVFYPKSPRAVTLEQAAALAARVPPFVSVVGLFVNPTED
FT                   EIARVANAVPLTLLQFHGDETPGQCASLAAAARLPWLRALRVGVATQPADLVESALHYP
FT                   AARGLLFDTLVEHYGGSGKVFDWSLIPAELARRAVLSGGLNAQNVGDAIRQVRPFAVDV
FT                   SSGIEAPGAKGVKDRARMAAFVRAVREADAG"
FT   gene            476074..477267
FT                   /gene="trpB"
FT                   /locus_tag="BMA10247_A0529"
FT   CDS_pept        476074..477267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="BMA10247_A0529"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR00263"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02835"
FT                   /protein_id="ABO02835.1"
FT                   /translation="MYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEKFKNDPEFVA
FT                   EYNRELKHFVGRPSPIYHAQRWSETLGGAQIYLKREDLNHTGAHKVNNVIGQALLAKRM
FT                   GKRRVIAETGAGQHGVATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVE
FT                   SGSRTLKDALNEAMRDWVTNIERTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPEL
FT                   AGRQPDAVIACVGGGSNAMGIFYPYIDDAAVQLIGVEAAGDGLDTGHHAASLIAGSPGV
FT                   LHGNRTYLLQDDDGQIIETHSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDEEALKAFH
FT                   DCCRIEGIIPALESSHAIAYGAKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGITL"
FT   gene            477277..478125
FT                   /gene="rsrIM"
FT                   /locus_tag="BMA10247_A0530"
FT   CDS_pept        477277..478125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsrIM"
FT                   /locus_tag="BMA10247_A0530"
FT                   /product="DNA modification methylase RsrI"
FT                   /EC_number="2.1.1.72"
FT                   /note="identified by similarity to SP:P14751; match to
FT                   protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02576"
FT                   /protein_id="ABO02576.1"
FT                   /translation="MRDLIEEPAGGAASDAQATHAACALPAGIELHNRDFLHEAASLPD
FT                   ASIDLIVADPPYGLGKDYGNDSDKRSGDEHLAWTREWLELAVPKLKSTGSMYVFCTWQY
FT                   APEIFSFLKTKLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIGFFAVSKGYYFDLDPVRI
FT                   PYDADTKKARSRKLFEGSKWLELGYNPKDVWSVSRLHRQHAERVDHPTQKPLEIIERMV
FT                   LASCPPGGRVLDPFMGSGTTAVACARQRRGFVGYEINESYCAIARERVASLAAVSAPAD
FT                   A"
FT   gene            478169..478984
FT                   /gene="trpA"
FT                   /locus_tag="BMA10247_A0531"
FT   CDS_pept        478169..478984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="BMA10247_A0531"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00290;
FT                   match to protein family HMM TIGR00262"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01893"
FT                   /db_xref="GOA:A3MBU6"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MBU6"
FT                   /protein_id="ABO01893.1"
FT                   /translation="MSRIQNTFAALAAQGRKGLIPFITAGDPDPAKTVELMHALAEGGA
FT                   DVIELGVPFSDPMADGPVIQRSSERALAKGVTLHSVLDDVKRFRARDQKTPVVLMGYAN
FT                   PIERMGADAFAAAARDAGVDGVLVVDYPPEESHDFAAKMRAAGIDPIFLLAPTSTDDRI
FT                   AAVGQVASGYVYYVSLKGVTGAANLDVSSIAGKIPAIKSRVPLPVGVGFGIRDAATARA
FT                   VAEVADAVVIGSRLVQLLEQAVPERAAAELAGFVAELRAAIDGAAKPAA"
FT   gene            479064..479936
FT                   /gene="accD"
FT                   /locus_tag="BMA10247_A0532"
FT   CDS_pept        479064..479936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="BMA10247_A0532"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM TIGR00515"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03160"
FT                   /protein_id="ABO03160.1"
FT                   /translation="MSWLDKLLPPKIKQTDPKSRKGIPEGLWVKCPSCEAVLYRNDVDA
FT                   NQHVCPKCDHHMRIGARERLDALLDPEGRYEIGQEIVPVDTLKFKDSRKYPDRLKEAMD
FT                   ETGETDAMVVMGGAIHTLPVVAACFEFSFMGGSMGSVVGERFARGAQNALEQQVPFICF
FT                   ASSGGARMQESLLSLMQMAKTTAMLTKLSEAKLPFISVLTDPTMGGVSASFAFLGDVVI
FT                   AEPKALIGFAGPRVIEQTVREKLPEGFQRAEFLLQKGAIDMIVDRRKMRDEIAQLLALL
FT                   QRQPADALA"
FT   gene            479976..481361
FT                   /gene="folC"
FT                   /locus_tag="BMA10247_A0533"
FT   CDS_pept        479976..481361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="BMA10247_A0533"
FT                   /product="bifunctional protein FolC"
FT                   /EC_number="6.3.2.17"
FT                   /EC_number="6.3.2.12"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03656"
FT                   /protein_id="ABO03656.1"
FT                   /translation="MRRAARLFFGVFASMRRFDSKLDSMSTFPTLDAWLSHLESAHPVG
FT                   IDMGLARIGQVKDALKLAFACPVITVGGTNGKGSTCAFIETILVRAGYKVGCHTSPHLL
FT                   RFNERARLDGRIVDDEELLPHFEAVEAARTSLPEAVSLTYFEFTTLAIMHLFASRGLDA
FT                   VILEVGLGGRLDAVNVIDADCAIVTSIDVDHIEYLGDTREKIAFEKAGIFRPGKPAICG
FT                   DPAPPQTLVDHAGAIGADLWLVGRDFRFSTQPGSERQQWTYAGRDKRYPALAYPALRGA
FT                   NQLLNASAALAALEALRERLPVSAQDIRLGLANVELPGRFQVLPGKPLVLLDVAHNPHA
FT                   AAVLAQNLDSMGYYPYTHAVFGAMADKDLAGIVERLKGAIDHWHLTDLPLPRAAAADVL
FT                   ERVLRGAGVEHGAQHNITRHAGPADAFLDALKSASDNDRIVVFGSFYTVAGVMPVVDRR
FT                   HDH"
FT   gene            481481..482206
FT                   /locus_tag="BMA10247_A0534"
FT   CDS_pept        481481..482206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0534"
FT                   /product="sporulation-related repeat protein"
FT                   /note="identified by match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01591"
FT                   /protein_id="ABO01591.1"
FT                   /translation="MERRPRRTERPDTDALLLDPTLPEKQRARRRLVGAIALVVAAVIV
FT                   LPMVLDSHPKPVTDDVQIDIPNRPSHQAAAANDEDASDVQAGVAHDEPPASEPAAAPTP
FT                   AVAAKAQAKPDAKEAKKPQTAAAKAPSAAQKPAAQPAQDTAAASVRAPAATATADGDAS
FT                   SPASPPGARFALQLGAFRDDATARNWATKLKAAGVPAYVEHRKQADGSTATLLRAGPFA
FT                   DRAAASAAIAKVREAGLTQ"
FT   gene            482213..482707
FT                   /locus_tag="BMA10247_A0535"
FT   CDS_pept        482213..482707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0535"
FT                   /product="CvpA family protein"
FT                   /note="identified by match to protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02729"
FT                   /protein_id="ABO02729.1"
FT                   /translation="MLTAFDYAVLLVIGLSALRGAWRGFVGEIFGLIGWIAAFLIACRF
FT                   VGVVLPYIPATWPGGALTQWVIAFALIIIGVVLVAGVANALLSRIAQATGLGGVDRSLG
FT                   MMFGLVRGVLLVLLLVAAAGLTELPKQEFWRDALLRPFAEQGVRELKPLLPDGLAAYIH
FT                   V"
FT   gene            482760..484295
FT                   /gene="purF"
FT                   /locus_tag="BMA10247_A0536"
FT   CDS_pept        482760..484295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BMA10247_A0536"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02926"
FT                   /protein_id="ABO02926.1"
FT                   /translation="MCGIVGVISQSPVNQLVYDSLLLLQHRGQDAAGIATADGSNFHMY
FT                   KANGMVRDVFRTRNMRSLPGTAGIGQVRYPTAGSASSEAEAQPFYVNAPFGIILAHNGN
FT                   LTNWQQLKDEMFRIDRRHINTNSDSEVLLNVLAHELQLSTTGLELDPDSLFKAVAGVHR
FT                   RAHGSYAIVSLIAGYGLLAFRDPFGIRPLCIGKLETEQGTEWMVASESVAVEGIGFEFV
FT                   RDVQPGEVVFIDVNGKFHSRQCADKPSLNPCMFEYVYLARPDSCLDGVPVYNVRLRMGD
FT                   YLAEKIRRELPNVPIDVVMPIPDSSRPAAMQVAAKLGVEYREGFFKNRYVGRTFIMPGQ
FT                   AVRKKSVRQKFNAMSIEFKDKHVLIVDDSIVRGTTSHEIVQMARDAGAKSVIFASAAPP
FT                   VKFPNVYGIDMPTRGELVAHGRTDEEVAKIIGADYLIYQDVGDLRRAVRDINPSLEGFE
FT                   ASCFDGDYITGDVTPEYLDAIERARLAPASQADRDPSGEGAERSQMNLQLSVE"
FT   gene            484470..485741
FT                   /gene="metZ"
FT                   /locus_tag="BMA10247_A0537"
FT   CDS_pept        484470..485741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metZ"
FT                   /locus_tag="BMA10247_A0537"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="4.2.99.-"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM TIGR01325"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03481"
FT                   /protein_id="ABO03481.1"
FT                   /translation="MSGLFVGLRIRRATRTAAMRLKTDERNMDDSLNFDTLAVRSGTLR
FT                   SEFNEHSEALFLTSSFCYASAAEAAERFKHSEDYYTYSRFTNPTVTMFQDRLAALEGGE
FT                   ACIATASGMAAITSVVMAALQVGDHLVSSRSLFGSTLGLFGQIFAKFGIETTFVDPADL
FT                   DAWRAAVRPETKMFFLETPSNPMTELADIEAVGRIAKAAHALFVVDNCFCSPVLQQPLK
FT                   LGADVVMHSATKFLDGQGRVLGGALVGSKAFIMEKVFPFVRTAGPTLSAFNAWVLLKGM
FT                   ETLSLRVNRQSENALEIARWLEAHPAVKRVFYPGLESHPQHALAKRQQKSGGSVVSFEL
FT                   NGDTPERQRANAWRVIDGTKIVSITANLGDTRTTITHPATTTHSRIAPEAREAAGITEG
FT                   LIRLAVGLEDPADIRDDLARGLAG"
FT   gene            complement(485835..486446)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0538"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(486433..487449)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0539"
FT                   /note="putative GDP-6-deoxy-D-lyxo-4-hexulose reductase;
FT                   this gene contains a frame shift which may be the result of
FT                   a sequencing error; identified by match to protein family
FT                   HMM PF01073; match to protein family HMM PF01370; match to
FT                   protein family HMM PF04321; match to protein family HMM
FT                   PF07993"
FT   gene            complement(487436..488479)
FT                   /gene="gmd"
FT                   /locus_tag="BMA10247_A0540"
FT   CDS_pept        complement(487436..488479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmd"
FT                   /locus_tag="BMA10247_A0540"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /EC_number="4.2.1.47"
FT                   /note="identified by match to protein family HMM PF01370;
FT                   match to protein family HMM TIGR01472"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03879"
FT                   /protein_id="ABO03879.1"
FT                   /translation="MTQARKAIITGITGQDGAYLAKLLLDKGYEVVGTYRRTSSVNFWR
FT                   IAELGVDKHPGLTLVEHDLTDLGSSLRLVERTQPHELYNLAAQSFVGVSFDQPATTAEV
FT                   TGLGALHLLEAIRVVNPKIRYYQASTSEMFGKVQAIPQIESTPFYPRSPYGVAKLFAHW
FT                   TTLNYRESYGIFGSSGILFNHESPLRGREFVTRKITDTVAKIKLGKASRLELGNMGAKR
FT                   DWGFALEYVEGMWRMLQADEPDTYVLATNRTETVRDFVRMAFAAAGYQLEWSGKGEDER
FT                   GIDTATGNVLVSVNPKFYRPAEVDLLIGCADKARDKLGWVPKTTLEALCRMMVEADLTR
FT                   NRHHETF"
FT   gene            complement(488515..489573)
FT                   /locus_tag="BMA10247_A0541"
FT   CDS_pept        complement(488515..489573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0541"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03508"
FT                   /protein_id="ABO03508.1"
FT                   /translation="MTRDTFVAPPAHTGRIVQLDGLRAFAVLAVFFQHALKAPLWIGVD
FT                   LFFVLSGLLITGILLERKARGESYFGYFYARRVRRIVPPYLLLLVVSSILFGVEWARHW
FT                   PWYAFFSTNIGLSLGGIGHESLNVLWSLAVEEQFYIFWPFVVLLVPERALARVAAALIV
FT                   AAPLLRAIATPWFDSFWPIYYLTPFRMDLLAAGALLAVALRRDRRALEPYYGAAIAAAC
FT                   AALAVLAWLHLSFPRFRAANTPLSNATLYSVSLVLCTSIVVIALRGRGLAQRVLTHPAL
FT                   VYVGTVSYTIYLIHLSVLYALWPLHPNRYLTAALAFGVTLAYASASWYGFERRLTRGAP
FT                   RQALAGAARASA"
FT   gene            489527..489667
FT                   /locus_tag="BMA10247_A0542"
FT   CDS_pept        489527..489667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02988"
FT                   /protein_id="ABO02988.1"
FT                   /translation="MRPVWAGGATNVSRVIGHEAGDDDSIAARAARASRYRFRIVVRPL
FT                   K"
FT   gene            489668..489979
FT                   /locus_tag="BMA10247_A0543"
FT   CDS_pept        489668..489979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02782"
FT                   /protein_id="ABO02782.1"
FT                   /translation="MKDRIEIDSREKKSAKKRIAFRSIFSAEGAAGRIGGVARTGGGRC
FT                   AASDPGYAGRACRGAAFSLRRRGLPGALADARPCATNRMDHSIRDRAPKYPQIFPNFL"
FT   gene            490145..492154
FT                   /locus_tag="BMA10247_A0544"
FT   CDS_pept        490145..492154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02260"
FT                   /protein_id="ABO02260.1"
FT                   /translation="MAVAVCAATALAGAARAENVLPATTSWIGNTYGYGDGTWTQIDIR
FT                   AIAVAPDGKVYTNAPWDESGAEASVYQDGKMLGFAGGTHGWGNAGGSAIAVNSRYAYVA
FT                   IAVGNEKGRLVAPGVWPDKGRQWYGILRREIGDVKQAAPFRGAKAGDARAKLAASFLMV
FT                   NEVPTDTRAEVAGLAASDSVLYASDPLHDAVNVYDTPALPPDAQAVDVATDAKGRVLLA
FT                   DNGPRQQILIFSKSADGGYAMSGTLGERGGIFSGVAGRPGPQRFNGLTGVGVDRAGNVY
FT                   VATNGIGPRHGTIGAGLGSTLESYAPDGRLRWQVQGLLFVDGAWIDPGRPNSVYTGNKR
FT                   FELDLSKPAGKEWKYAGFLSNRFKYPDDPVFNTDQWPGMPFARKVAGRTFLYLTDMHAD
FT                   HLKIYRFDPKRDGETAIPSGLLAGRARPVDKVPNRPPGGDWIWRDANGNGRIDEGEFEL
FT                   NTTGKEMAGGWGWWIDTGGDIWRTSDTRGIRRFRFGGLDKAGNPIYSYDKLTTYPSPAP
FT                   FTELRRALYDASSDTLYVTGYTADAPRVGGLSKEVGRVLVRFDKWSSGAPVMRYQVALP
FT                   WRLDAKPIFTLIGLTQEGRYLFGVEPVGTVHVYDKDNGRELGVIKPGPEVGRASGWVDV
FT                   PFGISAYRRENGEYLVFVEEDARGKVMMYRWRPQ"
FT   gene            492215..493669
FT                   /locus_tag="BMA10247_A0545"
FT   CDS_pept        492215..493669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0545"
FT                   /product="polysaccharide biosynthesis family protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01794"
FT                   /protein_id="ABO01794.1"
FT                   /translation="MLKNVAINFFGLVLPTFVSLVTVPAYIKALGVERYGVVSLVWTLI
FT                   GYFGILDLGMSMAAQNHISKALASGDAKESARVFWSAFWLNLATGIAGGLLIYFGAFMY
FT                   TAYFTKVSAELQHEVYLALPWLALAIPLANVSWVFAGAINGAERFGVFNTNQTIGTFLF
FT                   QLMPLFAAWLVAPTLQVVLAAAVGARFIAAVMLGAASMKVLGIRRIAPPQLGTAKGLFN
FT                   FGGWMLIASTTGMIADTLDRVMLGAGLGAKYVTYYTVPQNLVTRLNMLPNALVRTLFPR
FT                   LSALGRDHADTLVKQSLEFLNGVFTPIAIAAIFALGPFLALWVGRDLAELSAPVGRVLV
FT                   ISVWLVGQASVTRILIQSQVNPARAAAAGLVQMPFFVGALWFGIHHFGLIGAAVVVAAR
FT                   ALVDYGVLLYLSAIRMRAIVLDMVAHLAFLLASLYVAHALPGLAAAIAACAAALALNVG
FT                   WSITMTPGMRALARSALMRLNPRKSV"
FT   gene            493666..496128
FT                   /locus_tag="BMA10247_A0546"
FT   CDS_pept        493666..496128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0546"
FT                   /product="glycosyltransferase, group 1 family domain
FT                   protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03668"
FT                   /protein_id="ABO03668.1"
FT                   /translation="MNRDLAEHPLQRAATFQDVERAARDARSADALPPAHRARDAARPL
FT                   RVAIVHDWLVTYAGAERVLEQIVACFPDADLFGLVDFLDDRTFLRGKPVTTSFIQRLPY
FT                   ARTKYRSYLPLMPLAIEQLDVSGYDLVISSSHAVAKGILTGPDQVHVSYVHSPIRYAWD
FT                   LQHQYLEQSQLTRGVKSALARLILHYIRNWDVRTSNSVDRFVANSAFIARRIRKVYQRD
FT                   AAVVFPPVDVDAFALSTRKEDFYLTASRMVPYKKIDLIVDAFAQMPGRRLVVIGDGPDM
FT                   RKIRAKAAPNVEIMGYQPFAVLQDRMRRAKAFVFAAEEDFGISVVEAQACGTPVIAFGK
FT                   GGALETVRDAASHERPTGVFFDEQSVRAIVAAVDDFERAPARFKPEDCRANAERFSAAH
FT                   FRRRFVAQIDALLPNAQARAKLAGAMRPAGRASLAASGLRALVLDQSGVLGGAELSLLE
FT                   IMKHLRESADVVLFDDGPFRAALDDAGVHVDVVGQRALAGVHKQGGVSLRAAGSLLALV
FT                   REVARRARDADVIYANTQRAMVVGALAGRLARKPVVWHLRDIVSDAHFGPKQRLAIKQC
FT                   ARLGVTRVIANSDASARAFLELTGFERRAVQVVFNGISAEPFVALEPVRPAALRVRFGL
FT                   PADAWIVGSFSRLAHWKGQHVLLEAARLYPDMHVALVGAPLFGEDEYAAELRGFVALHG
FT                   LGERVHFLGFQRDVAACMKAVDVVAHTSITPEPFGRVIVEGMLAKRPVVAARAGGVVEI
FT                   VDDDVNGLLCEPGDAHALADALAALRTDAVLCGRLVANGYDTAVNRFGTQIYVEQVERI
FT                   LVETARRR"
FT   gene            complement(496242..496643)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0547"
FT                   /note="acyltransferase 3; this gene contains a frame shift
FT                   which may be the result of a sequencing error"
FT   gene            497634..497777
FT                   /locus_tag="BMA10247_A0548"
FT   CDS_pept        497634..497777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03314"
FT                   /protein_id="ABO03314.1"
FT                   /translation="MDMHWIASGAVLLVMAVLSAYRDALKNEPINRSGLGRGGAPYSEE
FT                   FE"
FT   gene            497963..498940
FT                   /gene="galU-2"
FT                   /locus_tag="BMA10247_A0549"
FT   CDS_pept        497963..498940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU-2"
FT                   /locus_tag="BMA10247_A0549"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01099"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02717"
FT                   /protein_id="ABO02717.1"
FT                   /translation="MRAVRRARRRPARAPELWRAAIRQHFRDAIMLKVTKAVFPVAGLG
FT                   TRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSFEI
FT                   ESELEARGKEKLLELVRGIKPSHVDCFYVRQPAALGLGHAVLCAEKLVHGEPFAVILAD
FT                   DLLHGDQPVLKQLVDVFNHYHSSVIGVETIEREDSRSYGIVEGREWEEDIIKLSGIIEK
FT                   PAPEHAPSNLGVVGRYVLMPSIFEHLRKIKPGAGGELQLTDAVQSLLTEEQVLAYRYYG
FT                   TRFDCGSKLGYLKATVELALRHPEVGREFEAYLRNCLPALAAVA"
FT   gene            complement(499471..500598)
FT                   /locus_tag="BMA10247_A0550"
FT   CDS_pept        complement(499471..500598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0550"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01986"
FT                   /protein_id="ABO01986.1"
FT                   /translation="MRAVKHVRGLDGLRAVAVTLVFLSHRAHFGAVDVGQIGVWTFFLI
FT                   SGFLIVGELHRSRLAIERGASSRRYAFWLFAGKRALRILPVYYLLLAALAIAHRSVYQR
FT                   GVDLGLRWHAVFLSDYWIGVVKEGWPGSTSHFWSLAVEQQFYLIAPIVLLATRASRHLT
FT                   ICAAAVALAAAAHLLLYRLHVSPVAVYAFSPWNFALIALGGIGGILRSGGIAAPEGVAG
FT                   ALAPWIGTAGAAFCATLALWAAPLPATAGGLADIGLGLSLGTLLFWIVSRPEHPAVSLL
FT                   EWAPLAYLGTISYGFYLFHNLIPERIGVVPGLYERLRVPSAWQELLPEILQFALAALLA
FT                   HLSWQYLEKRVLDYKKPLDAALRRRFALSERPAAR"
FT   gene            500894..501316
FT                   /gene="bph2"
FT                   /locus_tag="BMA10247_A0551"
FT   CDS_pept        500894..501316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bph2"
FT                   /locus_tag="BMA10247_A0551"
FT                   /product="histone H1"
FT                   /note="identified by match to protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03864"
FT                   /protein_id="ABO03864.1"
FT                   /translation="MAKKAAAPAKKVAAKKAAPAKKVVAKKAVAKAPAAPTPLKDKFTK
FT                   ASLATHIAERAAVEVKAVKAVLAALENVVLGSIHKKGAGEFTLPGLLKITAQAVPAKKK
FT                   RFGKDPFTGAERWFPAKPASVRVKARALKKLKDAAA"
FT   gene            complement(501776..502243)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0552"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(502851..502964)
FT                   /locus_tag="BMA10247_A0553"
FT   CDS_pept        complement(502851..502964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0553"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02209"
FT                   /protein_id="ABO02209.1"
FT                   /translation="MDDGEAEDGELADRRIGGPETSAAISHPQGPHWRSRA"
FT   gene            complement(503102..504256)
FT                   /locus_tag="BMA10247_A0554"
FT   CDS_pept        complement(503102..504256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0554"
FT                   /product="putative outer membrane porin"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01648"
FT                   /protein_id="ABO01648.1"
FT                   /translation="MKKLALSTLSLALLGAAGAAQAQSSVTLYGVIDTSITYVHGNDGK
FT                   ANNAWLMGSGNLQGSRWGLKGTEDLGAGLKAIFQLENGFNSNDGTLGQGKRMFGRQAFV
FT                   GLQHDQYGTLTLGRQYDPLVDLVQPVTADNYFGSLFATPGDVDNNDNSLRVNNTVKYTS
FT                   PVFAGFQFEALYGFSGIAGSPGQGQTWSAAAAYNNGPIGVAAGYFYTSNPSPTAGSRST
FT                   WSGSSDAIFDGAINSGYTSAKSIGIAQVAGQYVFGPVTVGLGYSNAQYKPDGFSGFSST
FT                   EKYNTGRGFVRYQATPALLLGLGYAYTKASGDTDAKYHQVSIGADYALSKRTDVYLAGA
FT                   YQHASGTQRVDATTTQTAQASIGSYGVNGTKSQEMVALGLRHKF"
FT   gene            complement(504714..505637)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0555"
FT                   /note="putative ribonuclease BN; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF03631; match to
FT                   protein family HMM TIGR00765"
FT   gene            complement(505897..506130)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0556"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            506813..507835
FT                   /locus_tag="BMA10247_A0557"
FT   CDS_pept        506813..507835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04952"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02503"
FT                   /protein_id="ABO02503.1"
FT                   /translation="MTDTPRFRNPIRSEVDLDANGKHAGYLRVPHSVHRSAYGWIPVPI
FT                   VSIRNGSGPVVLVMAGNHGDEYEGQIVVSRIVREIDAPHVRGQLIFLPMANFPAADAGT
FT                   RVSPIDGGNLNRSFPGDPAGAPTAVIADYIEHTLLPRVQYLIDLHSGGSSLLYQGGNLL
FT                   ALEPRDAAERARVRALLAAFGLPRAFLHAPNPVHASSAARRQGALSILTELGGGGMSDP
FT                   ALIRDARRGLLHFLGFVGALRGPLVPDSPPATTRFMRVSGAHHYVYAYDKGLYEPLVEL
FT                   GARVRAGQPAALIHFPDTPLREPVTQCFASDGEVVCKRVPAQVQRGDCLFQLAEDDAPA
FT                   "
FT   gene            508348..508515
FT                   /locus_tag="BMA10247_A0558"
FT   CDS_pept        508348..508515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0558"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02358"
FT                   /protein_id="ABO02358.1"
FT                   /translation="MPLAAARVFARRNMPACPPAAFRLLPAARGWTENDACLWRVAMSI
FT                   ANRKPQTANH"
FT   gene            508764..509417
FT                   /locus_tag="BMA10247_A0559"
FT   CDS_pept        508764..509417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0559"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02555"
FT                   /protein_id="ABO02555.1"
FT                   /translation="MPDRRPDSVDRTGAPRRRAGGIGCARPFAFDDIAMTDSIIDTAPH
FT                   DARAKPLIDALIDEYATRYHAYRPDSRASAQAELARYPAELFAPPEGAFILLIRGGETI
FT                   GSGAFKRYDAQTAELKRIWTRADLRRQGLARRVVRELELRAARQGYRRVYLTTGFRQPE
FT                   AWALYLDTGYAALFDRDVDPQIYVHLPFGKDLIEPGRIGALDDLRAPVPAAPVE"
FT   gene            509470..510456
FT                   /locus_tag="BMA10247_A0560"
FT   CDS_pept        509470..510456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0560"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 3"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03100"
FT                   /protein_id="ABO03100.1"
FT                   /translation="MRRGPPPQELSMKLPYTKSKSFAASLARAVVAFALAGIGAAAFAA
FT                   TFDLSPEQPGRVRGARDDAVIRALPASFKFVEPDTLTVGIAPSQPPISAYATDARTVVG
FT                   FDADLAQLLADSLGRKLKIVALAWPDWPLALESGRVDAVLSNVTVTEERKAKFDFSTYR
FT                   KDQVGFYVKSDSKIASIRQPRDVAGLRVITDAGTNQEKILLEWDRENVAHGLKPVTVQY
FT                   YDDHAVKSVALQAGRADAIFSVNSVLAYQAAQQHRTKLVGAVSGGWPRTADIAVTTRRG
FT                   SGLAAPFTLAINGFIRNGTYRRVLERWSLGSEAIDASRTNPPGLPKT"
FT   gene            510517..510747
FT                   /locus_tag="BMA10247_A0561"
FT   CDS_pept        510517..510747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0561"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03357"
FT                   /protein_id="ABO03357.1"
FT                   /translation="MKKGKPAAPEAGARRRRVAPPLDEVSRDGAARDAAVRRRRGPDTD
FT                   ARSRRERSRAQAGRPGGAFGWRAAGSPVSFD"
FT   gene            510776..511777
FT                   /locus_tag="BMA10247_A0562"
FT   CDS_pept        510776..511777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0562"
FT                   /product="luciferase-like monooxygenase"
FT                   /note="identified by match to protein family HMM PF00296;
FT                   match to protein family HMM TIGR03558"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02070"
FT                   /protein_id="ABO02070.1"
FT                   /translation="MSYSLSLLDKSPIAEGATAADALRFTVALAQRAEALGYRRFWIAE
FT                   HHGAPGLASSAPEIVVSHVLAHTSSIRVGSGGVMLQHYSPFKVAETFKLLASLAPGRVD
FT                   LGVGKAPGGLPLTTRALQSLHDKPRRPAFAEQLAELDAFLNWGVAEDHPLAGALALPVP
FT                   PEAPERVLLGGSPESAALAARLGWQFCYAGHFNGDEANVERSLDAYRSATGRAPLLALY
FT                   AVAAPTKGDAERLIGALRIFKLKLASGQSVNLGSAQAAAEFARQSGATDYRIDELRPHV
FT                   IAGAPDDVHRELDALSRRYGLAEFVVDSPVTHYPARLASVELLAPQRQPAGT"
FT   gene            511833..513155
FT                   /gene="ntaA"
FT                   /locus_tag="BMA10247_A0563"
FT   CDS_pept        511833..513155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntaA"
FT                   /locus_tag="BMA10247_A0563"
FT                   /product="nitrilotriacetate monooxygenase component A"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03102"
FT                   /protein_id="ABO03102.1"
FT                   /translation="MTQSTIPFGIMLQGAGSHMNAWRHPSNPPDASVNLDFIVRIARQA
FT                   EANGIAFAFVADGLYINEKSIPHFLNRFEPISLLSALATATSRIGLAGTVSTSYSEPFT
FT                   VARQFASLDLLSGGRAGWNVVTTPLEGTAKNYGTRHPEHDLRYEIADEYLSVAQGLWDS
FT                   WDDDAFVRDRASGRFFDRDKLHALDHAGRFFEVAGPLNIQRSPQGQPVIFQAGSSDAGI
FT                   ALAGKYADAVFTHAPSLDETRVFARRVKDSAIAHGRRADDVKIFPGIGPIVGRTAAEAE
FT                   EKYRAIRELLTIDEALAYLGRYFDHHDFTQYPLDAPFPELGDVGRNSFRSTTDRIKAEA
FT                   RAKGLTLRETALAVATPRPQFIGAAHDVADALIRWIDAGAGDGFILGFAVQAQGLDDFV
FT                   ELVIPALEARGRYRRTLVGSTLRDHLGLPRKESRRAAAAPA"
FT   gene            513152..513274
FT                   /locus_tag="BMA10247_A0564"
FT   CDS_pept        513152..513274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0564"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01829"
FT                   /protein_id="ABO01829.1"
FT                   /translation="MTAHAAPALRRMHAALRADVAAGAFGMRAARHRFSKEPRS"
FT   gene            513271..515181
FT                   /locus_tag="BMA10247_A0565"
FT   CDS_pept        513271..515181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0565"
FT                   /product="amino acid ABC transporter, permease/ATP-binding
FT                   protein, His/Glu/Gln/Arg/opine family"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00528; match to protein
FT                   family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02095"
FT                   /protein_id="ABO02095.1"
FT                   /translation="MSDITHAVGGAPPTSGLPAARADAPRFRIVPARHRARTAGTVLAA
FT                   VLIALVLNSVLGNPQWGWPVFAEWFLSEPVLSGLARTLLLTALGALFGFALGVPLALAR
FT                   VSRSPLLAACAWAFIWLFRSIPLIVLLLILNNLGYLYDHVRLGVPFTGITFAEVATTDL
FT                   ISPFCAAVLGLTLNHAAFAAEGIRGGILSVDQGQLEAAAALGLPRARQATRIVLPQAMR
FT                   AFLPVAFNDLIALAKGSSMVYVLAMPELFYTVQVIYRRNLEVIPLLMVATVWYLIILTV
FT                   LSIVQAQVERRYARGAVREPERSPAAALVGRLAGALPRRRVGAAGRSDAAGDARPASKA
FT                   AGAPSAADAPGAAAPGASASFAASRAPGRARSPGAARTPASGRRGSEIAVQRVSKRFGA
FT                   HKVLDDVSFVAPAGSVTVILGQSGSGKSTLLRTINHLERVDGGFIDIDGELIGYRREGD
FT                   TLYELKEKDVLRRRADVGMVFQNFNLFAHLTVLENIVEAPVASGRATRAEAERDARELL
FT                   ARVGLAAKAHAYPRQLSGGQQQRVAIARALALKPKVLLFDEPTSALDPELVNEVLDVIK
FT                   ELARSGTTLVIVTHEIGFAREVADTVLFMEHGRIVEAGPPAQVLGAPAHPRTRAFLSKV
FT                   L"
FT   gene            515726..516661
FT                   /locus_tag="BMA10247_A0566"
FT   CDS_pept        515726..516661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0566"
FT                   /product="putative amino acid ABC transporter, periplasmic
FT                   amino acid-binding protein"
FT                   /note="identified by match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02630"
FT                   /protein_id="ABO02630.1"
FT                   /translation="MTDRRTFVGGAAAFAAAWAAAPFGARAGIAVDLDPRQAGRVRAER
FT                   DPAAVDAARRYRWVDDRAFTVAIAPHAPPVATFATDARTVVGADPDYAQLVADALGRRL
FT                   ALVPVAWADWPLGLSAGKYDAVISNVGVTEQRKRKFDFTTYRLGLHGFYVRAASPIARI
FT                   AAPRDVAGLRIITASGTSQERILLEWDRRNVAQRLKPVDVLYFDDDAASRVALLSGRAD
FT                   AELNPNATLAYQAARDGRIRCVGNVNAGWPLKADVAIATRKGSGLADALTLATNGLIRN
FT                   GKYRQALARWGLLSEALDRSETNPAGLPSF"
FT   gene            516914..517681
FT                   /locus_tag="BMA10247_A0567"
FT   CDS_pept        516914..517681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02698"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02845"
FT                   /protein_id="ABO02845.1"
FT                   /translation="MTLALLTVVALVAALLRFTKRRRASRALFVATVAAFFAIGCGLVP
FT                   AWLLRALQAPYAARPAIEWGERNAIVMLGLGTEKIAATGAVEPGTFSYSRVVEAASLYR
FT                   DCRRARADADCKILVSGGDARRNGVPEASVYRDALVGVGIDAADVLSEPRSMNTWQNAQ
FT                   FTRVALDGYRADRVLLVTSGIHLRRSMLYFAHFGVAAIAVRAEYLQAVTFPLPLAYNFA
FT                   IADLALHEYLGIARYRLYNALGWNPARTRPGDA"
FT   gene            complement(518016..518150)
FT                   /locus_tag="BMA10247_A0568"
FT   CDS_pept        complement(518016..518150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0568"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02920"
FT                   /protein_id="ABO02920.1"
FT                   /translation="MLLHACPARLRHPARNIEASPATIAADEERDAHGSSAHSDQERK"
FT   gene            518601..521672
FT                   /pseudo
FT                   /gene="fdoG"
FT                   /locus_tag="BMA10247_A0571"
FT                   /note="formate dehydrogenase-O, alpha subunit,
FT                   selenocysteine-containing, authentic point mutation; this
FT                   gene contains a premature stop which is not the result of
FT                   sequencing error; identified by similarity to SP:P32176;
FT                   match to protein family HMM PF00384; match to protein
FT                   family HMM PF01568; match to protein family HMM PF04879;
FT                   match to protein family HMM TIGR01409; match to protein
FT                   family HMM TIGR01553"
FT   gene            521683..522597
FT                   /gene="fdoH"
FT                   /locus_tag="BMA10247_A0572"
FT   CDS_pept        521683..522597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdoH"
FT                   /locus_tag="BMA10247_A0572"
FT                   /product="formate dehydrogenase-O, beta subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="identified by similarity to SP:P0AAJ6; match to
FT                   protein family HMM PF00037; match to protein family HMM
FT                   PF09163; match to protein family HMM TIGR01582"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03808"
FT                   /protein_id="ABO03808.1"
FT                   /translation="MALQSLDIKRVSATTTPPPTAREPVTGSVAKLIDVSKCIGCKACQ
FT                   TACMEWNDLRDEVGTNVGVYDNPADLTEHSWTVMRFAEYENPAGDLEWLIRKDGCMHCE
FT                   DPGCLKACPSPGAIVQYNNGIVDFHEEHCIGCGYCVTGCPFNIPRISKQDNRAYKCTLC
FT                   SDRVAVGQEPACVKTCPTGAIVFGTKEDMKQHAAERVADLKGRGFENAGLYDPQGVGGT
FT                   HVMYVLHHADKPSLYHGLPDNPSISPMVKLWKGLAKPLAVAGIALSALVGFFHYTRVGP
FT                   NDVTDDEEAAARDEARRIQEDAK"
FT   gene            522594..523220
FT                   /gene="fdoI"
FT                   /locus_tag="BMA10247_A0573"
FT   CDS_pept        522594..523220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdoI"
FT                   /locus_tag="BMA10247_A0573"
FT                   /product="formate dehydrogenase-O, gamma subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="identified by similarity to SP:P0AEL2; match to
FT                   protein family HMM TIGR01583"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03006"
FT                   /protein_id="ABO03006.1"
FT                   /translation="MKHDDPNLIVRYTANERSNHWITVISFVLLALSGLALFHPSMFWM
FT                   TALFGGGQWTRILHPFVGLVMFASFAVMVVRYWRHNLLDAGDRQWLRQMDDVLANREDK
FT                   LPEVGRYNAGQKLLFFVMVACLLLLLVSGIVIWRRYFSLYFPIGVIRAAAVVHAAAAFA
FT                   LIVGIVVHVYAALWVKGSIGAMVRGTVTVGWARKHHPKWFRESVK"
FT   gene            523395..524363
FT                   /gene="fdhE"
FT                   /locus_tag="BMA10247_A0574"
FT   CDS_pept        523395..524363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhE"
FT                   /locus_tag="BMA10247_A0574"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /note="identified by similarity to SP:P13024; match to
FT                   protein family HMM PF04216; match to protein family HMM
FT                   TIGR01562"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02482"
FT                   /protein_id="ABO02482.1"
FT                   /translation="MTDPTQRILDPSEIASLDHSAIPRVRMPERGAVFAARAARLRKLA
FT                   DLNPIAGYLRLMAAVADAQHELLQTFVPNAPEKAAAERAQRHSMPLMPALGGERDPRWR
FT                   DLLQSLLDRVERAGLVNPPLAKLIDGMRLREAAALDAQADALVAQRFAEIEPASAPFLM
FT                   AALQVVWTALASRIAPADVPYLEQPGLCPVCGAQPVASIVRVGGPYQGYRFLQCGLCST
FT                   EWHMVRTKCSHCDSTKGIAYHGIEGGSEAIKAESCDACHTYRKIGYQEKDYDVEPLADD
FT                   LASLTLDLLMGEAGYRRASPNPLLWPDLPAEAGAAAGDERT"
FT   gene            524360..525802
FT                   /gene="selA"
FT                   /locus_tag="BMA10247_A0575"
FT   CDS_pept        524360..525802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selA"
FT                   /locus_tag="BMA10247_A0575"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM PF03841; match to protein
FT                   family HMM TIGR00474"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01619"
FT                   /protein_id="ABO01619.1"
FT                   /translation="MSGPGASELNALLARAPSVERVLSSEEMQPLVDEYGRTRALAAVR
FT                   ASLAAWRDAARRDPAAAGTPDDARIAADVRARLAADAAAAMRAVFNLTGTVLHTNLGRA
FT                   LLPDDAVRAVVQALTQPMNLEFDLATGRRGDRDDLIGALACELTGAEAATVVNNNAAAV
FT                   LLVLSALAPRREVVVSRGELVEIGGAFRIPDIMSRAGAKLREVGTTNRTHLADYADAIG
FT                   PRTALLMKVHCSNYAISGFTKEVALRELAPLARERGVPVAVDLGSGTLVDLTRWGLPKE
FT                   TTVRETVEAGADLVTFSGDKLLGGPQAGLIVGRRDLIAKIKKHPLKRALRVGKLTLAAL
FT                   EPVLRLYQTPEFLRERLTTLRLLTRAQADIAATAERVRPALQRALGAAFAVDVEPMFSQ
FT                   IGSGALPVDQLPSYGLVVRASGGKRRGRALAQLDAHLRGWPRPVLGRIADDALRLDLRC
FT                   LEAGDEAAFIAQCAQAPTGPRA"
FT   gene            525769..527724
FT                   /gene="selB"
FT                   /locus_tag="BMA10247_A0576"
FT   CDS_pept        525769..527724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selB"
FT                   /locus_tag="BMA10247_A0576"
FT                   /product="translation elongation factor,
FT                   selenocysteine-specific"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03144; match to protein
FT                   family HMM PF09106; match to protein family HMM PF09107;
FT                   match to protein family HMM TIGR00475"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03511"
FT                   /protein_id="ABO03511.1"
FT                   /translation="MRAGADGPARMIVGTAGHIDHGKTTLVRALTGVDTDRLKEEKARG
FT                   ISIELGYAYTPLPNGDVLGFIDVPGHEKLVHTMAAGACGIDFALVVIAADDGVMPQTRE
FT                   HLSILQLLGVAHGALALTKCDRVDAARVARVRDEIRAWLAASPLADAPVFETRASEPDD
FT                   AGVAALNAHLRDTALAWRARRDDGLFRLAVDRVFTLAGQGTVVTGTAVAGRVRTGDSLA
FT                   VARTGETVRVRSIHAQNRATDVGHAGERCALNLAGIDKAALARGDAIVDARLATLSPRI
FT                   DVELTLTADADLTISHWTPLHVHLGTLHRVAHVALLEGETLGPGRRARAQLNFTEPVFA
FT                   APGDRFIVRDAQATRTVGGGRVLDPFGPARKRRTRARRAWLDALAAWLDEGRLDALLDE
FT                   APLGIARATLMHLTGLPAQAWALPADAVSVAAPGKHADEARVLARGHWDALRTRVLDAL
FT                   AAFHQRSPDEQGPDVARLRRIAAPLADDALWRALTDALIAEGAIVRSGPWLHLPSHAVS
FT                   FDAAEEALAGRLLPLVAAGRYDPPWVRDHAAATLMAEDAVRALLRKLARRGDVHQVVRD
FT                   LFYHRDVIAELARLIARLAGEHGGGLDAATFRDATGLGRKRAIQILEFFDRVGYTRFHR
FT                   DLHWLRADSRLLAGSR"
FT   gene            527832..527927
FT                   /locus_tag="BMA10247_A2413"
FT   tRNA            527832..527927
FT                   /locus_tag="BMA10247_A2413"
FT                   /product="tRNA-Sec"
FT   gene            528105..528227
FT                   /locus_tag="BMA10247_A0577"
FT   CDS_pept        528105..528227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0577"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03880"
FT                   /protein_id="ABO03880.1"
FT                   /translation="MALGAEAALSRRRLAEDFNSLWLRPATGTPCADCDRGALC"
FT   gene            complement(528305..528466)
FT                   /locus_tag="BMA10247_A0578"
FT   CDS_pept        complement(528305..528466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0578"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02262"
FT                   /protein_id="ABO02262.1"
FT                   /translation="MLRLTGHRELANPDDMEVLAMTAILIASIIVVGVLVALANTIIKR
FT                   SLARRTAH"
FT   gene            complement(529151..529318)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0579"
FT                   /note="glutamyl-tRNA; this gene contains a frame shift
FT                   which may be the result of a sequencing error"
FT   gene            complement(529579..530070)
FT                   /locus_tag="BMA10247_A0580"
FT   CDS_pept        complement(529579..530070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03629"
FT                   /protein_id="ABO03629.1"
FT                   /translation="MATTAEEDVLLHILHNVYSVTGGEVTPSSVSVPTVELKLQFDDNT
FT                   HRISGFGRIAWGKNKPPKVTSEFVDLLIHGDFGYFPPARKQRDANFPVKTLQINLVGYP
FT                   NLHWNPRWGIGPQLPIIFHQNAVIPVGSQTGYAAYSYGVPSDPESEISVTDATIRQLLL
FT                   "
FT   gene            complement(530345..530488)
FT                   /locus_tag="BMA10247_A0581"
FT   CDS_pept        complement(530345..530488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0581"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02559"
FT                   /protein_id="ABO02559.1"
FT                   /translation="MRRPVGHAGSTIRNTQDAARPTATAADALSPSLDVLPTLGASGYK
FT                   NL"
FT   gene            complement(530555..531682)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0582"
FT                   /note="putative beta-glucosidase; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF01915"
FT   gene            complement(531713..532750)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0583"
FT                   /note="beta-glucosidase; this gene contains a premature
FT                   stop which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00933"
FT   gene            532767..532931
FT                   /locus_tag="BMA10247_A0584"
FT   CDS_pept        532767..532931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0584"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03289"
FT                   /protein_id="ABO03289.1"
FT                   /translation="MFAWFCRSARRETPRERAATGAVKRVTDDTRSCVTDRPRAAGDES
FT                   GVSGGCVGM"
FT   gene            complement(533100..533492)
FT                   /locus_tag="BMA10247_A0585"
FT   CDS_pept        complement(533100..533492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0585"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02264"
FT                   /protein_id="ABO02264.1"
FT                   /translation="MNPSATLRRIDRQDNEANETLRRRCTPRRLQPVAARHALRSRPFP
FT                   GVGASPATRAPSDEDHATAGKRTLPNGACCATDGDKPDLIGIGIGIGIRSDCDYDYGCD
FT                   YGCGNLTMSAGVHLAARFTIDSVAQT"
FT   gene            complement(533489..534742)
FT                   /locus_tag="BMA10247_A0586"
FT   CDS_pept        complement(533489..534742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0586"
FT                   /product="putative transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01658"
FT                   /protein_id="ABO01658.1"
FT                   /translation="MTSVAPPSATSEAVSHRNTAVLVVFTALTNLADGVTKVALPLMAT
FT                   ALTHSPARISGVSLTLTLPWLLVALHVGVLVDRFDRRTLLWLANAARMAAMALLIALLP
FT                   SGRVTLPVLYASGLTLGLAEVVALTSAAALIPDAVAPSSRERANAWIAGAETVCNEFCG
FT                   PLTGGMLVAAGTAIALGAVAVGYFGGGVALFFLIGRFRVAHAPHGRPPPVRLQIAEGLG
FT                   CLWHQPLLRLMAVALTVLCMCWGAWLALMPLFATTVLGLDSRGYGVTVSALGVGGFVGA
FT                   LSVTLLNRRFGRRTVMLTDLLGTFAMMAVPVLSTNLWAVAASAFAGGLGGTLWTVNART
FT                   ISQHLVPGPLLGRYNAAARLFSWGAMPIGAGFAGAIAELLGMRAAFAALAVAALLLIVP
FT                   FLRVASAQALRIGPERRH"
FT   gene            complement(534817..534957)
FT                   /locus_tag="BMA10247_A0587"
FT   CDS_pept        complement(534817..534957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03655"
FT                   /protein_id="ABO03655.1"
FT                   /translation="MQAAAPGIAVLGATGSFDASLDEDVAAALRREADATGTALGYRLQ
FT                   A"
FT   gene            535236..537590
FT                   /gene="rhf"
FT                   /locus_tag="BMA10247_A0588"
FT   CDS_pept        535236..537590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhf"
FT                   /locus_tag="BMA10247_A0588"
FT                   /product="cytochrome P450"
FT                   /note="identified by match to protein family HMM PF00067;
FT                   match to protein family HMM PF00111; match to protein
FT                   family HMM PF00175; match to protein family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03672"
FT                   /protein_id="ABO03672.1"
FT                   /translation="MTTHSASTPPALPAAQCPFRPVSDDAAAHPAGCPASAGAAAFDPF
FT                   DDAYQQDPPEYVRWAREREPVFYSPKLGYWVVARYDDIKTIFRDNRTFSPSIALEKITP
FT                   TGPDANAALASYGYAMGRTLVNEDEPTHMARRRLLIEPFTPDALRAHEPMVRRLAREYV
FT                   DRFVDDGRADLVDQMLWEVPLTVALHFLGVPEADMDTLRAYSIAHTVNTWGRPRPDEQV
FT                   AVAHAVGQFWQYAGKVLEQMREDPSGPGWMQFGIRMQREHPDIVTDSYLHSMMMAGIVA
FT                   AHETTANATANALKLLLEHPRAWRELCDDPALIPNAVDECLRHSGSIVAWRRIATRDAT
FT                   VGGVAIPAGAKLLIVTSSANRDERRFADPDLFDIHRDNPADHLTFGYGSHQCMGKHLAR
FT                   MEMQIFIDELSRRLPHMRLAEQRFTYVPNTSFRGPEHLWVEWEPAENPQRRGHGARRCA
FT                   LAVRIGESNARRAGRALRVDSVMPVAERVLRVRLVAPDGAPLPRWSAGAHIDVECGDTG
FT                   LSRQYSLCGDPAERGVYEIAVLREPASRGGSAWMHERLRPGMRVKIRGPRNHFRLDGHA
FT                   ARAILIAGGIGITPIGAIAREARARGIDYALHYCGRSRRTMAFVDELAALHGERLRLHV
FT                   SDEGTRHDFSALDVAAGTQVYACGPARMLDALAACAAHWPAHALRVEHFAAAAPRVDPR
FT                   TDQPFEVELKDSGLTLTVPANRTLLATLRAANVDVQSDCEEGLCGSCEVRVLAGEVDHR
FT                   DSVLSADERALNTRMMACCSRARHGRLVLEL"
FT   gene            537658..538227
FT                   /locus_tag="BMA10247_A0589"
FT   CDS_pept        537658..538227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0589"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02373"
FT                   /protein_id="ABO02373.1"
FT                   /translation="MTARVDVRARLDDSRFDAYHWRIVAPCAAYRVMDGFDVQATGGVA
FT                   PAVIREWGIAKEALSPAFRAGWFGMLIGSLVFSALAAVFAAIFMAGFPIVGGQPALNVL
FT                   AAVYYPAPLRSTGIGWRSGVGWIGSVVGPARGGVLMYRQWLSSLLFLAAAVPACVSMAG
FT                   IGATARPGFAGAGEAIGARGAAAAGE"
FT   gene            538341..538466
FT                   /locus_tag="BMA10247_A0590"
FT   CDS_pept        538341..538466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0590"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02940"
FT                   /protein_id="ABO02940.1"
FT                   /translation="MRVRGRPRGSPAASTVHDVPNVARAGIESLCRGLAKASRAS"
FT   gene            complement(538468..538620)
FT                   /locus_tag="BMA10247_A0591"
FT   CDS_pept        complement(538468..538620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0591"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03447"
FT                   /protein_id="ABO03447.1"
FT                   /translation="MRSLRRKGGFADRRLQSRCRCRTRVLVSPFSRARLVHVDTNRVSR
FT                   GGAYS"
FT   gene            complement(538666..538803)
FT                   /locus_tag="BMA10247_A0592"
FT   CDS_pept        complement(538666..538803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0592"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01569"
FT                   /protein_id="ABO01569.1"
FT                   /translation="MLSNEHSGGAAVPRASTMPNAAPLRKRTSDTPRIRYAAHSIALAR
FT                   "
FT   gene            538848..539846
FT                   /locus_tag="BMA10247_A0593"
FT   CDS_pept        538848..539846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0593"
FT                   /product="patatin-like phospholipase"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02681"
FT                   /protein_id="ABO02681.1"
FT                   /translation="MAFKILSCDGGGIRGLITALLIQDLDRRSGILAKADGFAGTSTGG
FT                   LIALALARGVSISEVVDVYRNRGSEIFQESGAWLEQRATIATDASFAAFTGPGLFACQY
FT                   VNTGLKRIAQELLRGGDLTELHRLTVINSSRLWDPALRSWSACTFSNASGNAYRHVALV
FT                   DAALATSAAPSYFPPYEVPSLGYFADGGLFANNPSMTAVSEALASRLGGELGNLRVLSF
FT                   GTGISQAGIRPSAIGDPLRWGVTTWFWPFESHDVPASALLGLTLDTTAMLATQQATQLL
FT                   GGGYRRANFVLGETVGLDDWRKASLLESETAAYMKTPAWEGVCQWVDANWR"
FT   gene            complement(539947..540561)
FT                   /locus_tag="BMA10247_A0594"
FT   CDS_pept        complement(539947..540561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0594"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03215"
FT                   /protein_id="ABO03215.1"
FT                   /translation="MSADEIRTRRRKLLAAALGAALAPALPALAATQRAQPLAGQSGYH
FT                   GGLITPPVPVPDMPLRTAYGRATRLRALLAGRVTALQLFYTGCSSTCPIQGAVFHRVQT
FT                   LLGPHPKPDIQLLSLSISPLEDTPQRMHAWLARFGARPGWIAAAPELKDVDALQAFFGG
FT                   GRTGLDNHGTQVQMIDRRGALVWRTYELPSPETIAALLGHA"
FT   gene            complement(540548..541039)
FT                   /locus_tag="BMA10247_A0595"
FT   CDS_pept        complement(540548..541039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0595"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02745"
FT                   /protein_id="ABO02745.1"
FT                   /translation="MTMPGEPNARRASLTGLALKLAFGFGFAFALAWPGHAARADDSAA
FT                   RGRALFRGDAPLQGRLPMHPGDLPAPLVRCANCHAAGAGAAVPNSIAPRLTRAWLGDLQ
FT                   SRRGGPPSRYDRNAFCALLRTGLDPTYVLINVEMPRYRIGERDCTALWRFLNEAPHERR
FT                   "
FT   gene            complement(541036..543456)
FT                   /locus_tag="BMA10247_A0596"
FT   CDS_pept        complement(541036..543456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0596"
FT                   /product="ricin-type beta-trefoil lectin domain/galactose
FT                   oxidase domain protein"
FT                   /note="identified by match to protein family HMM PF00652;
FT                   match to protein family HMM PF09118"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03150"
FT                   /protein_id="ABO03150.1"
FT                   /translation="MHFFRFAWRHGRYWLCLLIASVLLPQGAAAAVTASYTDIVGADSG
FT                   LCVSTAGNSSASGAGVVQTSCAGLSNTTWSFVPVGNRYHIVLQGSGLCLNVPGGSLNSG
FT                   TQLIQYACQGNGQTNDQWTVVAVGSSYRIVSASSGMCVNVSGASHASGAALIQYPCQGA
FT                   SALNDQFNLYLPVVAATNVTAANSNLCVSVNGGSTAAGASIVQGTCSNQGATGWSLLPA
FT                   GSGYHVVSQGTGQCLNVYGGYTTSGAPIIQYPCQGDAQTNDQWTLVPVGSKYRLISVSS
FT                   GMCLNVSGGSLSPGAPLIQYPCQGANALNDQFSLSLPQTFPVTLPSAWSPVIPLPVNPI
FT                   GIANAPNGKLVMWSADQQLSFQNDVGSKATQTQTAVFDPATNTATQYLETSAGSDMFCT
FT                   GTAMLPDGRLLVNGGDSSPKTTLYDWTTNTWSAAATMNIARGYQGDTLLSNGSVLTLGG
FT                   SWSGGQGGKTAEVWTNGGAWTLLPGVPETNIVGPDPQGIYRGDNHLWLFAQGNGTVFHA
FT                   GPSSQMNWISTAGGGSIQSAGMRGVDPFSINGTASLYDVGKILKAGGAKSYQQNGSVTT
FT                   YASNSVYQIDITRGPNQPASVQRLNGMTYQRAFANSVILPNGSIVMIGGQSVPMPFTDT
FT                   TAIMVPEIWDPATQRFNLLKPMQTPRTYHSTAILMADGRVFAGGGGQCGTGCAMNHLNA
FT                   EILTPPYLLNADGTPAPRPVITNAPATAKLGATIAVSTQGPVASFVLMRLSSVTHTTNN
FT                   DQRRIPLAIASSGGTSYQLAIPADPGVVLPGYYMLFALNAQGVPSVSASIRIS"
FT   gene            complement(543489..543626)
FT                   /locus_tag="BMA10247_A0597"
FT   CDS_pept        complement(543489..543626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0597"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01686"
FT                   /protein_id="ABO01686.1"
FT                   /translation="MTGTVFRHSSFVHDFRDFPARPARRPSSGSSFGHAPNSRIGFGHF
FT                   "
FT   gene            complement(543668..543886)
FT                   /locus_tag="BMA10247_A0598"
FT   CDS_pept        complement(543668..543886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0598"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02000"
FT                   /protein_id="ABO02000.1"
FT                   /translation="MYRYRRTARFRSFAHGALIADFSFFGISAARALGRTRENVGNAKN
FT                   MRNAACVRASSVIPNIGPIRLPPRSIH"
FT   gene            543842..545269
FT                   /locus_tag="BMA10247_A0599"
FT   CDS_pept        543842..545269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0599"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03788"
FT                   /protein_id="ABO03788.1"
FT                   /translation="MSKRAKASSPSISIHSNGSAGEDDARPAHAAGDAPADAPVVLLVD
FT                   DEPSVLSALKRVFRPKHYRTLCADSGEAALDLLAAGEVDLIVSDMRMPRMSGAELLTRV
FT                   GERQPDTMRILLTGYSEIDSAVRAINEAGIYRYLTKPWDDHDLLLTVEQALEQQRLRRE
FT                   TARLDALTRKQNDALRAFNAGLEAQVQARVEEIRQTMLFLEDAQRDLTHNFAAMAQVCA
FT                   NMIELRCGAPGGESQRVGEAARDLALALGMSGWQVLELFFAGLLHGIGKLSLPDELLHR
FT                   PLDRLTPDESRLYYQHPLRAQMVLTPVQQLGRVAHVIHHQYERFDGRGTPDGLAANAIP
FT                   LGSRILAVARDFDVLCSGSMFTRPYTVQQAMAVLVSQSGLRYDARVVDRFVALSKEAAA
FT                   VDRRASVSRINASQLAEGMRLADDLRNGRGILLMTKGSVVSSHQAAQVRRFEASETAPF
FT                   VIFVDAAGGEPPRGMLD"
FT   gene            545342..546520
FT                   /locus_tag="BMA10247_A0600"
FT   CDS_pept        545342..546520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08495"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03124"
FT                   /protein_id="ABO03124.1"
FT                   /translation="MKGRSVVTMLSSTIPAVHSTCAHARDAVREVHAALANCDAELVLF
FT                   FCSSRFDLDALADEMRERFRGTRVIGCTTAGEIGPAGYRNDSLVAVALPRALFTVETAL
FT                   LEDLQTFTIASGHACALDALHDLERRAPRASGANSFALLLIDGLSVREEPVTRTLQGAL
FT                   GDIALVGGSAADDLRFERTAIFYDGRFRDDCAALIVASTALPFRTFKTQHFRCGAERLV
FT                   VTQADAERRTVSEINGLPAAEEYARLIGARVEDLSPGHFAAAPVVVLIDGTDYVRSIQK
FT                   LNPDGSLTFYCAIEEGLVLRVARALDLVDNLQATFGDLRDSFGEPQLVLAWDCILRHLE
FT                   MMQRGTRDTAAEVLKANHAVGFSTYGEQYGGVHVNQTLTGIVFSRAPEPDRG"
FT   gene            546513..547682
FT                   /locus_tag="BMA10247_A0601"
FT   CDS_pept        546513..547682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0601"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01802"
FT                   /protein_id="ABO01802.1"
FT                   /translation="MAESSLVDDASADIPSLKKEIVRLNKIVRSLMDRAERSTIVCGSD
FT                   FSLFQMAVTLEDQVRHRTRELEAALHENQKIMHALQRTQTLMAQEIEERKRTQAELETE
FT                   REAQRHLIEQLAQAHGQLLQSEKLASIGQLAAGVAHEINNPIGFVDSNLRTLKTWVRQL
FT                   LDVMAIEDALIADCGDAALARLRAAHAEVDLDYLRGDIGTLIDESIEGASRVRRIVQDL
FT                   RDFSRAGSEEWNFADVHEGLEATLNVLRNELKYKAEVVKDYGELPAVECMPSQLNQVVM
FT                   NLLMNAAQAIVEHGTITIRTRREGDGVTIAIEDTGVGIPADRLAKIFDPFYTTKPVGKG
FT                   TGLGLSVSYGIVEKHGGRITVDSEPGNGSRFTIWLPIVRQRSLQDVAAG"
FT   gene            complement(547845..548243)
FT                   /locus_tag="BMA10247_A0602"
FT   CDS_pept        complement(547845..548243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03514"
FT                   /protein_id="ABO03514.1"
FT                   /translation="MNEPNPYFQEVVDAHVDIERWLSGRAEHGRLPALLERFSPHFSMV
FT                   AARGAALDRAGLDALFRQGHGQRSGLRIEIDELQQIGAWRDGAVIGYRETQTDGEGRSN
FT                   TRRSTVVFERDAASRIVWRHLHETLLGA"
FT   gene            complement(548240..549646)
FT                   /locus_tag="BMA10247_A0603"
FT   CDS_pept        complement(548240..549646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0603"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02854"
FT                   /protein_id="ABO02854.1"
FT                   /translation="MAAMSARSRIAAVYLLGFSIDLANMFAINAAYPALQRALRASVAQ
FT                   LAWVGNIYMLGLTVVIPLGAWLAHRFGERRLLTASLLVFALGSAGAASAPSIGALLASR
FT                   LVQGLGGGLLIPVGQAMTYRAYPREARARLTSIVMMVALLVPAASPALGGVIVDHASWR
FT                   VVFWSMLALAASTCTLALAWLPADVARDAPRTLDAAGLGLSAAALVALLLGLAFASRRG
FT                   AGAPAIAMLALACTAGVAYVRHARRSSAPLLDLALLSQPLLRAGVVIYLCVPGIFTGVN
FT                   LIASLFLQNALGLGATQVGALMVPWAAASFAAIATTRRAFPAVGARPLLACGVVADCIG
FT                   IALLATPLAAHEAGRVLAYVAMGFGASLCTSTSQTAAFLDVPADRMGEASALWNINRQL
FT                   SFCLGVAVLGGMLNFLLAAGGGDAPLAYRRCFAFGALLTLLPLPLVARLGSRRAAVSPA
FT                   VSVDAQSNRT"
FT   gene            549728..550666
FT                   /locus_tag="BMA10247_A0604"
FT   CDS_pept        549728..550666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0604"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02631"
FT                   /protein_id="ABO02631.1"
FT                   /translation="MTIEGAMVSLDRFDVFRAVVEAGSFTGAANVLNQARAAVSFHVKQ
FT                   LEAELGVTLLTRTTRRVELTEAGERFYERCLRVLAEAEEAIDDARAEHGGMQGSLRVTS
FT                   TVEYALRIVAPALSEFMSAHPALRVRLETHTSQADLVRDRFDVAIRLGRLEQFRDLPYR
FT                   GVCIDTYDVRPVASPALLAAHGVARIDSPEALARLPQLGHSRLSQVASWLLHDRDGREH
FT                   VYRPAAKPHLIADNASVLRAFAQQGGGVALLPEWLVRDDLASGTLIDALPGYRFAQQGV
FT                   YALYPSARHVPQKIRAWIDFIKRYVRRRAEG"
FT   gene            complement(550762..550938)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0605"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            complement(550966..551229)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0606"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            551228..552139
FT                   /locus_tag="BMA10247_A0607"
FT   CDS_pept        551228..552139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0607"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01779"
FT                   /protein_id="ABO01779.1"
FT                   /translation="MRFDITDLRLFVSVIEAGSITHGASRVNLALGSASGRIKQMEETA
FT                   GVALLVRERLGVKPTEAGHTLLRHARATLASMQRLTDDLGEFANGLRGTVRLLTNTNAL
FT                   TEFLPGPIARFLAQHRNVSVELEEMLSHEIVAALVEGVADIGIVAAREDISGLQSFPFA
FT                   TDRLCAVVLASQPEFANARDVSFASLLDYDFVGYAAGAAIQTYLEAHARELHRRLRPRI
FT                   HLRSFDAICRLVENGVGVSVVPESAARRCRRTMSIKTLALRENWALREMRVCVADVDAL
FT                   PMYARQLLGHLVESGRAFARRR"
FT   gene            552244..553125
FT                   /locus_tag="BMA10247_A0608"
FT   CDS_pept        552244..553125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0608"
FT                   /product="putative citrate lyase, beta subunit"
FT                   /note="identified by match to protein family HMM PF03328"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02198"
FT                   /protein_id="ABO02198.1"
FT                   /translation="MSISIPHDAAAPAACDRLHSALRSWLFTPATRADRFSNASECGAD
FT                   VLIVDLEDSVAPADKAYARDHARAWLSSGQAHARPASAVRINAPDTVAGHADLGMLIDA
FT                   PRAPDFIVVPKVEAQQRIAHLDALLRDAGRLPRYGFVAMIESAAGADAADAIVRACGSI
FT                   GALMFGAADYASDVAAQPDALALQIARVRLAAACARGRIAAIDAPCFALRDAAALDTEL
FT                   AFAVRNGLRGKAAIHPAHVAPINAAFAPSPQRIAWARRVIGAASQGAAVVDGRMVDEAV
FT                   AREARDVLAAAR"
FT   gene            553162..553689
FT                   /locus_tag="BMA10247_A0609"
FT   CDS_pept        553162..553689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0609"
FT                   /product="MaoC domain protein"
FT                   /note="identified by match to protein family HMM PF01575"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03032"
FT                   /protein_id="ABO03032.1"
FT                   /translation="MSTTISAYRQIGDKRFREISGLYFEDFEPGNVYEHRPGRTITDVD
FT                   NIWMTLLTMNTQQVHFDAEYAAKTEWKKLLVDSTFTLALLTGMSVRTVSAKVVANLGWD
FT                   KVRASAPVFAGDTLYAESTVLSRRESKSRPTQGIVTVETKGVNQHGVIVMSFERTMLIY
FT                   KRGHSPEAGANY"
FT   gene            553708..555045
FT                   /locus_tag="BMA10247_A0610"
FT   CDS_pept        553708..555045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0610"
FT                   /product="acetyl-CoA hydrolase/transferase family protein"
FT                   /note="identified by match to protein family HMM PF02550"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03545"
FT                   /protein_id="ABO03545.1"
FT                   /translation="MGMRNDRDAREIYAGKLTSPQRAVSQVRSGSAIALGMAMSQPPAL
FT                   LAALAERAQAGDVDALRVYYFHAEAFLRETLLRYSLMGRILPHCMFMGPPERELVKLGE
FT                   ADGGRKVVFFVPNSFSQSPRLFAEHVDVDTMLVMVSPMDRNGYFTFGTNNDYTSSVARA
FT                   ARRLLVEVNPNMPRVFGNSLLHVSEVDAIVESDQPLPELIPKPGGELDRVIGEQIAELV
FT                   TEGACLQMGIGALPNAVCGALVGHRHLGIHTELLTPGLVELIRRGAVDNSRKTLDRGKS
FT                   VFTFAMGDRAMYDFIHDNPALESHPVDYVNDPCNIARNDNMISVNSTIEMDLTGACNSE
FT                   HVNGHQYSASGGQLDFVRGAYASRGGKSILAFHSTAAGATVSKIVPQLTGPVTTPRTDT
FT                   HLVVTEYGVANLKGLSSTERARALIRLAHPDFRDALSVHARRLHLI"
FT   gene            555046..556776
FT                   /gene="poxB"
FT                   /locus_tag="BMA10247_A0611"
FT   CDS_pept        555046..556776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poxB"
FT                   /locus_tag="BMA10247_A0611"
FT                   /product="pyruvate oxidase"
FT                   /note="identified by similarity to SP:P07003; match to
FT                   protein family HMM PF00205; match to protein family HMM
FT                   PF02775; match to protein family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03315"
FT                   /protein_id="ABO03315.1"
FT                   /translation="MEDRMASTIADYLARTLAAAGVTKIWGVTGDSLNGLSDSLRRDGG
FT                   IRWMHTRHEEVAAFAAGAEAAQTGRLAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAA
FT                   QISSTEIGLGYFQETHPQELFRECSHYVEFVTNASQFPRVLERAMRAAIGEHGVAVIVL
FT                   PGDVALSAAPARTPSWFDFASPVTTPADADLERLAALLDGSDAVTLLCGSGCAGAHDEV
FT                   VALADALAAPVVHALRGKQHIEYDNPNSVGMTGLIGFSSGYHAMQSCDTLLMLGTDFPY
FT                   RNFYPTRARIAQIDRRASALGRRAPLDVGLVGDVRATLSALLPRIRRKTRRGFVERALA
FT                   HYAAARKGLDELARPSPAGRPIHPQYLTRVVDELAAADAIFAADVGTPTLWAARYLTMN
FT                   GRRRLHGSFNHGSMANALPQALGAQAAHPGRQVVSLSGDGGLSMLLGDLLSARQLDLPI
FT                   KVIVYNNSSLGFVAMEMKAGGYLDTGTDLHETDFAAIAKGAGLYSLRVTESEALPDALG
FT                   KLLAHPGPALLDVVTDKHELAMPPKIEWAQAKGFSLYMLRAVLSGRGDEVLELAQTNLR
FT                   "
FT   gene            556798..557088
FT                   /locus_tag="BMA10247_A0612"
FT   CDS_pept        556798..557088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0612"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03820"
FT                   /protein_id="ABO03820.1"
FT                   /translation="MRRPIERGHREWLPACAAPRRPSPPASMGGPGIARGKQRPQEETM
FT                   QNEPGAAPSTSHWAGSASGPVRDRRRSFAAPRELIALRYETPISAYYAGDV"
FT   gene            557287..557448
FT                   /locus_tag="BMA10247_A0613"
FT   CDS_pept        557287..557448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0613"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01667"
FT                   /protein_id="ABO01667.1"
FT                   /translation="MVAKTIDAKWQIDHIARHAHPRPMPDPAGQGAILCRHDLEFDLES
FT                   KLFQCKTM"
FT   gene            complement(557839..557970)
FT                   /locus_tag="BMA10247_A0614"
FT   CDS_pept        complement(557839..557970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02208"
FT                   /protein_id="ABO02208.1"
FT                   /translation="MLAPLLARGSSKKPVGARRGEHVKSRSGSRRGAVPTDLGWLLD"
FT   gene            558053..558301
FT                   /locus_tag="BMA10247_A0615"
FT   CDS_pept        558053..558301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0615"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02376"
FT                   /protein_id="ABO02376.1"
FT                   /translation="MAGRKKATAGSTAFAAGANGESRCNGPLGLLMSLASGLGTDSSSM
FT                   RTGANGWVRASFAGRPSAAYGTNPVRARRFRHRRIPG"
FT   gene            558516..561299
FT                   /locus_tag="BMA10247_A0616"
FT   CDS_pept        558516..561299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0616"
FT                   /product="putative diaminobutyrate--pyruvate
FT                   aminotransferase/membrane protein"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00709"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02912"
FT                   /protein_id="ABO02912.1"
FT                   /translation="MHRFETIRQLESSARTYASSFEAVFESGAGALLRDQSGREIIDCL
FT                   SCAGALPLGHNHPEVNDAIRRFFQSGHVQQALDLSTPAKFEFVKTLFETLPDDWARRAK
FT                   IQFCSPSGSDAVEAAMKLTRFATGRQTIVAFSGAYHGMTRGALAAMGNLGVKSGLGLGA
FT                   GDVHFAPYPYRFRCPFGTDGTETDALSIQYLRNLLADPESGVSKPAAVVVEVVQGEGGC
FT                   IPVSDAWLRALRQLTRAHEIALIIDEVQTGFGRTGSMFAFERAGIRPDVLVLSKAIGGG
FT                   FPLAVVVYDEVLDVWPRGKHAGTFRGNQIAMVAGKATIEILRRDRLDAHAAQMGALLVD
FT                   GLREIARAHPEFGDVRGRGLMVGVEIVDPSSDGAPQDGELARAIKLEAFRNGLLVETGG
FT                   RHGAVLRLLPPLIVNRADISAILERLDASIAQAKRGRGPRGGANHRSDERDGEAARPVA
FT                   QGQSALPQAEPVKREAERRRGLLKPAFLLLWLGETALDFGSALMSFALAAWIFQKTGSA
FT                   ERFSFAVLSAAIPALLLTPVAGALADRFDRRWVIAGCDVAMAIMIGALAWLLFRGALAP
FT                   GHLYFFNATSAAIGCIRMPAYRAAVTAIVPRERLTQASGFTGTSQALLRIAAPLIAGYV
FT                   LADYGLKGIVGLDMLMIAAGSAAIFAALLRAAHAIRGVVGAVDASLIEGVSASFAAAVR
FT                   YFKSVPMFQGLAAYNMLQESLLLLSSVMLTPLVLSTHSSSTLGLILTYGALGGLAGSLL
FT                   LLVLRIEARLMSLALFADAVLAMLIALVGFSRSPAAWCAFVFLAYFASSASSACTSALW
FT                   ARKTPREMRGSIFALNTSMNLAAMSIVVLVGGVLCQRLFEPALADGGAWAPTVGAWLGT
FT                   GKGRGIGLLLVLCGAAGCVASLLALTCTRLRHLDALVPDQTHDDARDLLRNGVAVT"
FT   gene            561388..561573
FT                   /locus_tag="BMA10247_A0617"
FT   CDS_pept        561388..561573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0617"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01953"
FT                   /protein_id="ABO01953.1"
FT                   /translation="MSRRLGAADAARRRKRAGARCFAAIAAHESKRSAAHACAGVSFGD
FT                   IAVSHSPSVAAHSNHS"
FT   gene            561605..566056
FT                   /locus_tag="BMA10247_A0618"
FT   CDS_pept        561605..566056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0618"
FT                   /product="putative peptide synthetase"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01915"
FT                   /protein_id="ABO01915.1"
FT                   /translation="MTDMLDSSEISVRDDIDPVPGAAPERVLALTAGQYGIWLDQMLNP
FT                   DLPCYILGAILRIDGTFDEALLTSVVNEVVNANDSLRAVLVSEGGSVRQRVLSDVELEI
FT                   AHIDFSGSAHPHDSAWRYMRTAFDTAFALDGLLCDFRIVRESPSRTYWMYRCHHLVADG
FT                   QSVSMICRMIVDLYNRRASADMARIEPTPSYFDSLDDDRKYAESSRYERDAQFWQDKFS
FT                   SLPPPLLSSRSSEAAARPASFPDGQVNLTIERAKYDRLGRIAEASGCTIVHVMFGVLAL
FT                   YFSRAFQVDEVVIGMPVHNRSTAQQKRAIGMFASVVPIRIPVDGNERFVSLLNGVSAEL
FT                   RHCYRHQRFPIAELNRRLGLVRTGRRQLFDLTLSFEKFPLDFYIGDVKLGLTSMRHRFE
FT                   QTPITVNVQDYHEDQDLVMQFNYDVNAFSHAEVDNIGTRIGGLLDALIEHHDDMPVGML
FT                   PLLDEAERKQVVYEWNATERDYPIEQCIHQLFEAQVDRKPEAIALTFDGRRLSYAELNA
FT                   RANRLAHYLQGRGVGPDRLVALCAERGIEMVVGLLAILKAGGAYVPLDPSHPPERLRRM
FT                   LDDTNPVAVLVDDIGADALASFESHVAARSPRVHLSRDIAQWRACSPANPPTPRERAAR
FT                   RLAYVIYTSGSSGEPKGVMNEHRGVVNRLWWMQQTYALDERDAVLQKTPFSFDVSVWEF
FT                   FWPLMSGARLVIAKPEGHKDPAYLSELIDRERVTTLHFVPSMLQAFLEDEGAARGCGSV
FT                   KRVMCSGEALPPSLVKRFYRCLPDARLHNLYGPTEAAVDVTAWACDAEEGGASVPIGRP
FT                   IANTRIYVLDEYGQPVPRGVAGELYIGGVQVARGYLNRPELTRERFVDDPFVAGGRLYK
FT                   TGDLARWRTDGSLEYLGRNDFQVKIRGFRIELGEIEAQLAKVAGVRETVVLARDSGSPV
FT                   GEKRLVAYYTGNADVAALREQATRHLPAYMVPSAYVRLDAWPLTPNGKLDRRALPAPAD
FT                   DAYARAEYEAPQGAKEEALAAIWKDLLPVERISRHDNFFELGGHSLLVIGLSEKLRAAG
FT                   LHADVRVVYRASTLADLAAHLGTDNQDIRIPPNLIADGDEHITPAQLTLVALSQESIDA
FT                   LVAKVEGGAANVQDIYPLAPLQEGILFHHLMSGESDPYVLSGVLAFRSREVMERFVSAL
FT                   QQVIDRHDILRTGFFWEGLEQPVQVVQRRATLPVSVVELDAREGDIVRQLETRFDSRGY
FT                   RMDVSRAPLMHVHAACDGEHERWVARVLFHHLSIDHTTLERVIEEARAIGQGRAEDLPQ
FT                   PVPFRNFVAQARLGVSEADHEAYFRAKLGDIDEPTAPFGLLSVQGDGREIAEAARTLKP
FT                   ELSGALRGHARRLGVSAASMMHVAWGLVLSRTTGRQDVVFGTVLFGRMQGGAQSDRALG
FT                   LFINTLPVRMRVAQTGVEASVKGAHAQLAELMRHEHAPLVLAQRCSGVPAQTPLFTSLL
FT                   NYRYSKPKVAAAHIADGIELLD"
FT   gene            566122..566385
FT                   /locus_tag="BMA10247_A0619"
FT   CDS_pept        566122..566385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0619"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03012"
FT                   /protein_id="ABO03012.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            566409..567242
FT                   /locus_tag="BMA10247_A0620"
FT   CDS_pept        566409..567242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0620"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02418"
FT                   /protein_id="ABO02418.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            567250..577308
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0621"
FT                   /note="putative peptide synthetase; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00501; match to
FT                   protein family HMM PF00550; match to protein family HMM
FT                   PF00668; match to protein family HMM PF00975; match to
FT                   protein family HMM TIGR01733"
FT   gene            577376..578329
FT                   /locus_tag="BMA10247_A0622"
FT   CDS_pept        577376..578329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0622"
FT                   /product="putative syringomycin biosynthesis enzyme"
FT                   /note="identified by match to protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03233"
FT                   /protein_id="ABO03233.1"
FT                   /translation="MNVQPLFGQAQHHPVVVTPRGDASLHALRDYLADDAEGVARLLRE
FT                   HGGVLFRGFGLNGADDFRAITECLGAKPFGYVGGDSPRSRVAPGVYTSTDHPASERISL
FT                   HNEMSYLPAYPRRLFFYCLVPAASGGQTPLAHGGDVLRAVPADIVERLSRNRINYVRNF
FT                   PAVRLGKSWQDTYQTNDRAEVERIAAEQGSTCAWLPQGLRVTTPCDAIVTHPRTGDALW
FT                   FNQAELWHPSALAPRLRSTFEQLVGKGNLPHECEYGNGEPIGADVLAEIRRALQANKLM
FT                   FDWRRGDLLMIDNLTMMHGREAFRGERKTLAYLSGT"
FT   gene            complement(578574..580340)
FT                   /locus_tag="BMA10247_A0623"
FT   CDS_pept        complement(578574..580340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0623"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02593"
FT                   /protein_id="ABO02593.1"
FT                   /translation="MLKSVQHPTQPSTVSGPNRSASTQATGSPQQRPRRSLGAFSQGQL
FT                   RSARETANRTRHDETPRLPPLSFGEPLSLDQIVARPPITGTSASTNGAALAAPDVIEPA
FT                   DARSVPSPSSQSSPPSSPPPSRPPSRPSSAAPPPIAPPLPPAADDFRAPLPERQPGQAY
FT                   DRSKPGFTLAEANGIRPLAPLFNATAAHHHGEVAAGLAIGGLASGLAHETAGAGMNSHA
FT                   LFASWRKRRRYDRQLSAMRERDVAAFSVAAIGGDARRLDRLILTRDRNGKLDYDLDKVM
FT                   KLAANDDPLLAAQSAHAKDVLLTLYIRHEVAGKRMSRAAYELARNALGIASGAALIAGT
FT                   QGLAAAPASAAAVAAKQAGFALALLNALDVGKGVRGLKQRMRNDKARDIDRSALRSRMT
FT                   LDTRGIDDETPDEAIKGVHAVLKDNGRIEADRKRFGKLFPGRWIDEKKSTTNKNDMADL
FT                   TARHALTLVERSIARFAGEGDANLHAFHARVHPRNASTSQQKRALRDAIERDAHLVDAY
FT                   NLMRDLGMRGGEARIAIDGLIARRIEIGLANDPATSRARATDAGRKHAEQQRSGERAPD
FT                   DVTAMRTVLQRR"
FT   gene            580347..580724
FT                   /locus_tag="BMA10247_A0625"
FT   CDS_pept        580347..580724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0625"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03596"
FT                   /protein_id="ABO03596.1"
FT                   /translation="MPPERIGADKTTWAALRASCAPAGPATERLAAFRRRPGRIRAGAA
FT                   HVDARGFVDRTIGNPIDIAGIAYGARSRRPAGLAKTPNVMRSASRRLACPLGRGFREHD
FT                   ADRAPDKAMRTGMIRRISGRL"
FT   gene            complement(580708..581802)
FT                   /locus_tag="BMA10247_A0624"
FT   CDS_pept        complement(580708..581802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0624"
FT                   /product="putative type III secretion inner membrane
FT                   protein SctT"
FT                   /note="identified by match to protein family HMM PF01311;
FT                   match to protein family HMM PF01391; match to protein
FT                   family HMM TIGR01401"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01900"
FT                   /protein_id="ABO01900.1"
FT                   /translation="MTTYDIFALQHLGDEFIRFIVLLALSSERLLVLMAILPATADNVM
FT                   KGPMRSGAAAVWCLFVAGGQQALIPQLHGAFLMIACVKEAVIGLVLGIAASTVFWAAEA
FT                   IGTYLDDVAGFNNVQMQNPSSGAQTSLMATLFGQLTIASFWLLGGMTFLLGALYESFAW
FT                   WPFGSFDPVPAPLLEMFAQARIDMLMNMIARIATPMMAMLLLVDLGLAFVARSAQKLDL
FT                   MSVSQPLKGAIAVLIVAVLAGNFVSEMRGQISLSGLAQQIGRLARQPAGGVSGVSGVSG
FT                   VSGVSGVSGVSGVSGVSGVSGVSGVSGVSGVSGVSGVSGASGASGASGASGASGASGAS
FT                   GASGASGTSSTSSTWDATSVTTVR"
FT   gene            complement(581799..582326)
FT                   /locus_tag="BMA10247_A0626"
FT   CDS_pept        complement(581799..582326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0626"
FT                   /product="type III secretion protein HrpB7"
FT                   /note="identified by match to protein family HMM PF09486;
FT                   match to protein family HMM TIGR02559"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02767"
FT                   /protein_id="ABO02767.1"
FT                   /translation="MSGRQQRAFETLLARRAQRGERLRAEQRVLRAERDAAAAELAQGE
FT                   AHAHAKRDAANRYAERVDAMAAGRAPFTIGDYAACRRYRDALLDEHALASAQCARLRAA
FT                   LQAKVDRLAATARRIARNDAQIDVVRERIRRLARAAEAAAEDAQDEEIEEGVLARRLAA
FT                   ARASNASNETHA"
FT   gene            complement(582323..583651)
FT                   /gene="sctN"
FT                   /locus_tag="BMA10247_A0627"
FT   CDS_pept        complement(582323..583651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sctN"
FT                   /locus_tag="BMA10247_A0627"
FT                   /product="type III secretion cytoplasmic ATPase SctN"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF02874; match to protein
FT                   family HMM TIGR01026; match to protein family HMM
FT                   TIGR02546"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03148"
FT                   /protein_id="ABO03148.1"
FT                   /translation="MNALADLSRVADAMAARLAIEPAVGMTGKVLEVIGTLVRVVGLEA
FT                   TLGELCELRGASGALIQHAEVVGFTRNVALLSPFGTLGEINRGTRVIGLRRPLSVKVGN
FT                   GILGRVIDSFGEPIDGRGELDYDALRPVIAAPPNPMSRRMVDASLATGVRIVDGLITLG
FT                   EGQRMGIFAPAGVGKSTLLGMFARGASCDVNVIALIGERGREVREFVELIMGEDGMARS
FT                   VVVCATSDRSSIERAKAAYAATAIAEYFRDQGKRVLLMMDSLTRFARAGREIGLAAGEP
FT                   PARRGFPPSVFAELPRLLERTGMGEHGSITALYTVLAEDDSGSDPIAEEVRGILDGHII
FT                   LSREIAARNQYPAIDVLGSLSRIMPQVATREHVGAAGRLRQLLAKHREIETLLQLGEYQ
FT                   AGSDPAADEAVAKIDRIRAFLNQRTDEYSPPDATLAALHELVR"
FT   gene            complement(583648..584370)
FT                   /locus_tag="BMA10247_A0628"
FT   CDS_pept        complement(583648..584370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0628"
FT                   /product="type III secretion inner membrane protein SctL"
FT                   /note="identified by match to protein family HMM PF02108;
FT                   match to protein family HMM TIGR02499"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03779"
FT                   /protein_id="ABO03779.1"
FT                   /translation="MDMAFWLKNRQIPLVDDLRIDAPHGVLRRDAFETVQALGAALDAL
FT                   AAERDAVLRAARDDAERIAAGARAQADALVEAARREHDSAYARGYDAGRAQAIADWHAR
FT                   AADSFEQERRVRDRMRERLAELVAAAVQQMVHTEDARGLFARAAQTIERVVAGASYLTV
FT                   RVCDADYDAAREQFGLLADAWRRQGRNVPVDVVVEPRVARGTCVCESDFGTVDASLDTQ
FT                   LNAIRAALARALDDAGRA"
FT   gene            complement(584349..585026)
FT                   /locus_tag="BMA10247_A0629"
FT   CDS_pept        complement(584349..585026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0629"
FT                   /product="type III secretion protein HrpB4"
FT                   /note="identified by match to protein family HMM PF09502;
FT                   match to protein family HMM TIGR02560"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01663"
FT                   /protein_id="ABO01663.1"
FT                   /translation="MTGGAPVASVEARAAWLAGYDANARRAADWVHASWHGALAPLVAA
FT                   MHEHAPALRAACSLLLLRTLGGSAPTLGGFDSRADRLAALPIADTLRLLRMRALLFRRT
FT                   ELRHWIDRASRERLAGWVGADGGRALAALCAQPDARRERERREPLAPLTQLSADDVAWE
FT                   GWCLFERERVWSPAGPMRIVRLALPREPARAPWLERAAADADGAMLLARVPSLFPEWTW
FT                   LFG"
FT   gene            complement(585023..585286)
FT                   /locus_tag="BMA10247_A0630"
FT   CDS_pept        complement(585023..585286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0630"
FT                   /product="lipoprotein transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02428"
FT                   /protein_id="ABO02428.1"
FT                   /translation="MSVTSVAADPVDLVSAAQPAAQNSRGATLVGVLIALAVGGALAAA
FT                   GGALWWRARKRGGGAGAHGIAARPRGGARDAKAAAPRQADAQ"
FT   gene            complement(585312..585875)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0631"
FT                   /note="type III secretion protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01514"
FT   gene            complement(585872..586288)
FT                   /locus_tag="BMA10247_A0632"
FT   CDS_pept        complement(585872..586288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0632"
FT                   /product="type III secretion protein HrpB2"
FT                   /note="identified by match to protein family HMM PF09487;
FT                   match to protein family HMM TIGR02558"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03897"
FT                   /protein_id="ABO03897.1"
FT                   /translation="MNTPLSASDLSRALDVAFSDAAAAPAGAGAPAAAPVPAEVAGRFQ
FT                   ALMSNAVPTPPLAHAQETSAIAKLVETSDAEIRKVLDNVEYLNLHANEMTMNQMFAASL
FT                   QASAEATAMQIDMQAKMGVVTSTKDAIGSLMKNQ"
FT   gene            complement(586302..586877)
FT                   /locus_tag="BMA10247_A0633"
FT   CDS_pept        complement(586302..586877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0633"
FT                   /product="type III secretion protein, HrpB1/HrpK family"
FT                   /note="identified by match to protein family HMM PF09613;
FT                   match to protein family HMM TIGR02561"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01864"
FT                   /protein_id="ABO01864.1"
FT                   /translation="MDESRPTYLRCSHAALNGLIDATNLALGGALDGPAADPYDIGLLI
FT                   DALRVLAPQLPAADMFDGMLQIALGNWDDAARAFAEISNGTSNAVYGKALLALQVKRDP
FT                   EWRLAADEVLAAGGPAQAIALVRALERQHDVLLAKEHAQRTGVWELPASVAAASGDAAG
FT                   TAGEAPGANPSGGFDPQAAFAHQQYLRL"
FT   gene            586933..588195
FT                   /locus_tag="BMA10247_A0634"
FT   CDS_pept        586933..588195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0634"
FT                   /product="type III secretion inner membrane protein"
FT                   /note="identified by match to protein family HMM PF01312;
FT                   match to protein family HMM TIGR01404"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02526"
FT                   /protein_id="ABO02526.1"
FT                   /translation="MGRKVAARRARGRGDAKRARRMRSTARASHPAARLRLGARAARGA
FT                   PLTYAASPTPEGNAAMAEEKTEEPTEKKLKKVREKGQVAKSKDIADAMTLAAAIGVLTA
FT                   CESMLTGGLSRAVRTALDFVRGERTPQATLAALHDLAASAALTMLPFVAAAIVAGIVSQ
FT                   APQAGFLITLEPVMPKFDAINPMAGIKRIFSLKSLLELVKMIVKALVLACVAWKMMTSL
FT                   FPLVVASVYEATPQLARVLWTVLMKLLGTVSVVVAVLAAADYKIARVMFVRENRMTKEE
FT                   VKREHKESDGDPHTKGERRRLAREIATSAPPRQRGGQANVLVVNPTHYAVAIRYAPHEH
FT                   PLPRVIEKAVDDGALALRRHAHALGVPIVGNPSVARALYRVERDASIPEELFETVAAIL
FT                   RWVESLSGARAVAAVSSARSS"
FT   gene            588192..590264
FT                   /gene="sctV"
FT                   /locus_tag="BMA10247_A0635"
FT   CDS_pept        588192..590264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sctV"
FT                   /locus_tag="BMA10247_A0635"
FT                   /product="type III secretion inner membrane protein SctV"
FT                   /note="identified by match to protein family HMM PF00771;
FT                   match to protein family HMM TIGR01399"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02471"
FT                   /protein_id="ABO02471.1"
FT                   /translation="MTLKSLKLPAGGEVGITVLVVAIVSLMILPLPPEVIDVLLGVNIA
FT                   ISVTLLMVTMYVGSIVSLSVFPSILLFTTLYRLSLNIASTKSILLHANAGDIIESFGEL
FT                   VVGGNLVVGLVVFLIITIVQFIVIAKGSERVAEVGARFTLDAMPGKQMSIDADLRANIL
FT                   TPDEARRKRATLAKESQLHGGMDGAMKFVKGDAIAGLIITLVNIVAGIAIGVMYHGMTA
FT                   GDAANRFSILSVGDAMVSQIPSLLISVAAGVMITRVADDHDDGDGTSLGSEIARQLGGS
FT                   HRALYFAAVLLIGFAAVPGFPAALFVLLSGMLAFAGYRLQKGARRTTARGEPVIALQRA
FT                   GAKSSTPSILPRAPLFTCAIGVRVAPDLVARLAPAALDRAFDEERAKLQEEQGLPFPGI
FT                   TLWTSDALPASTCEILMRDVPQARLELPADQTMLPDAASDPALAGRCTKRGPAGGLAES
FT                   YWIDDKAVPAGARAWRAEQVVAHETIALLRRNAHLFLGIQEAQWILDQLGVDYPGLVAE
FT                   VQKTLPTQRIADVLRRLLEEHIPIRNARDIMESLVAWGPKEKDMLMLAEYVRGDLSRYL
FT                   AYRAARGARQLPAVLLDMAVEQHIRQSIKQTPAGNFLALPPEQVRYLVDSIASFVGEAP
FT                   RDDVALVTSMDVRRYTRRMIEARLDWLPVYSYQELGDQVQLQPVGRVTMPTAAHA"
FT   gene            590261..592198
FT                   /gene="sctQ"
FT                   /locus_tag="BMA10247_A0636"
FT   CDS_pept        590261..592198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sctQ"
FT                   /locus_tag="BMA10247_A0636"
FT                   /product="type III secretion inner membrane protein SctQ"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM PF09483; match to protein
FT                   family HMM TIGR02551"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03298"
FT                   /protein_id="ABO03298.1"
FT                   /translation="MSAADLRPVRIIAGAPAAEPAGAPAPRAARRGFDYAQLMRRSRVA
FT                   PAGAPAPRGDGERPRDAAMPWRDGAAPSFERDPAALPDALGREAMARACAGADAFVNQV
FT                   FAQRERVVRVAEALAAEIAALGGGDASGQWEQPAARRGVAAGYGAASRSFAFRLAASVR
FT                   DAGRGDAALTLHTWRDAARATRHAARASRRAAHDRDRRRLKRAQSNPTATMNTEPIELE
FT                   PATAEPPGIDTALPLPACSAFDAALARIVCDARLAAWLARFPGLSDWRASAGERPCFER
FT                   PGVLELRRGGAAAHVAIDLAAFPALEVVAAPALDARGDASLSLRAALAATLLAPLVAAF
FT                   AAAGLDGVTVGALRAVPAAALDATRCMLSFALDGAPLRCALLDAQAPWLDALAARLRDE
FT                   RRRDASSGLARVRLPGRVRLGTRALPLAVLRSLRPGDVLLDMVPAALGAARAGPLHAWW
FT                   GARRAAQWHATVLIEGTTMTMTEMPDTADDLDEPIVAGDLPADSLADFPADSPAAVPAE
FT                   FPAEFPADRAGDLPAPSAAHSSPGSLAGLPAGLQADAPPRDARYAAPEPADLGEVALPV
FT                   HVEIDTLSLSIAELAALRPGYVLELPLAARDVPVRLVAYGQAIGGGRLVAVGAHLGVRI
FT                   DRMAGDDGSV"
FT   gene            592185..592835
FT                   /gene="sctR"
FT                   /locus_tag="BMA10247_A0637"
FT   CDS_pept        592185..592835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sctR"
FT                   /locus_tag="BMA10247_A0637"
FT                   /product="type III secretion inner membrane protein SctR"
FT                   /note="identified by match to protein family HMM PF00813;
FT                   match to protein family HMM TIGR01102"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03800"
FT                   /protein_id="ABO03800.1"
FT                   /translation="MVQFNDITGLLIAVLVMSMVPFIAMVVTSYAKIVVVLGLLRNALG
FT                   VQQVPPNMVLNGIAILVSLYIMAPIGFAAQQQLQGQALSPQPTQAMLQAFGAAKEPFRR
FT                   FLAAHSREREKRFFLRSASVIWPQAAAAQLREDDLIVLAPAFTLAQMTDAFRIGFILYI
FT                   AFIIVDLVIANVLMSMGMNQVQPTNVAIPFKLMLFVVMDGWSTLVHGLVLTYS"
FT   gene            592876..593139
FT                   /gene="sctS"
FT                   /locus_tag="BMA10247_A0638"
FT   CDS_pept        592876..593139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sctS"
FT                   /locus_tag="BMA10247_A0638"
FT                   /product="type III secretion inner membrane protein SctS"
FT                   /note="identified by match to protein family HMM PF01313;
FT                   match to protein family HMM TIGR01403"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02802"
FT                   /protein_id="ABO02802.1"
FT                   /translation="MEIDDLIRLTSQGMMLCLYISLPVVLVAAASGLAISFLQAITSLQ
FT                   EQSISYGVKLVAVTVTVAIAGPWAAAEILHFAQQLMSAAVPS"
FT   gene            593136..594005
FT                   /locus_tag="BMA10247_A0639"
FT   CDS_pept        593136..594005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02253"
FT                   /protein_id="ABO02253.1"
FT                   /translation="MSRITRAIAQPLHAAKPDTRRRRPVRARTATTYGKYDTRFTYSSG
FT                   YQANTVAARNQMLAKLKPRAKTAAASARRRRRVDSQAEAFDAGEEPTMPHAHVTPHDER
FT                   DRHAGGQGGGRQQRDQDERDGEPANVSALPRVRAARARPAAEPAQRALRDVARTLADCA
FT                   QREHALRHLWADTLLQLGRRIDAEPGARITAALLNHNADLLAARLRTGPWTPIGWSGVK
FT                   QLLLDAMHGAGGAVRDAAAARGDRASTHYLLLPLLVFNAERPSTPRQLARAIASVETLR
FT                   GGARRPRS"
FT   gene            594201..594578
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0640"
FT                   /note="secretion-associated protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            594556..595179
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0641"
FT                   /note="secretion-associated protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            595219..595458
FT                   /locus_tag="BMA10247_A0642"
FT   CDS_pept        595219..595458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0642"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03238"
FT                   /protein_id="ABO03238.1"
FT                   /translation="MERVAGEVGSLEQALAAPDAAARIGAIRRALGETAERVSAATAHA
FT                   ASDYDRDAMQKIYRGLLAAQRIVATLHEANAAAA"
FT   gene            595628..595810
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0643"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            595903..596358
FT                   /locus_tag="BMA10247_A0644"
FT   CDS_pept        595903..596358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0644"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01603"
FT                   /protein_id="ABO01603.1"
FT                   /translation="MSWERYAQVVAQVCAVVDLPDVDYVLETRTIDVEGFDVRIEYFDD
FT                   DPESMYVNFHYGIVSAGRTLTVYRLLLEANLLIYAQDQAQLGIDADTGSIVLLMRLPLT
FT                   PDVTGETVADLFAHYAEHGRYWRQNIIESGDEMFGAIASGEYFWLRV"
FT   gene            596570..598003
FT                   /locus_tag="BMA10247_A0645"
FT   CDS_pept        596570..598003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0645"
FT                   /product="regulatory protein HrpB"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03706"
FT                   /protein_id="ABO03706.1"
FT                   /translation="MFSTLYFAAAAALANPSSNDAYAARVLDGRFAEAVALVAARCDSQ
FT                   PGDAAADVRDVHAYADIQLVLGRFEEAEDTFRRAQKLLRESRDQTRVMTCRNASWQAFF
FT                   QNRFGVAQAGFRRIADDRAASAAQKLESLVGTCVVMHHLGRAEDAMATLDVLDAAARGD
FT                   ADGRWVRLAAALRADLLLQYQIGRADALGDHVYWRSALAELPPAAFAETGAPHAACAAD
FT                   APPLLRMRVAYMRETRALAAGDHAALGRIDTHVSWCAKAGLADYQRSVRLEVALAALAG
FT                   QAPNVADAMIAPYREAAGRCGSHARWTLDYLYCAAKVREQQGRIRESSSLYAHYALASV
FT                   RHVRSDGAALAIARCGTQAAAPSDDVSARLPGKYRRAYRYLMERLDQRELSVREIAAHI
FT                   DVTERALQAAFKAYLGLSPSELIRRQRMERIRGELLSDAPRAASVLEIASRWGIQHRST
FT                   LVNGYRRMFDEAPSQTFDR"
FT   gene            complement(598018..598551)
FT                   /locus_tag="BMA10247_A0646"
FT   CDS_pept        complement(598018..598551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0646"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03328"
FT                   /protein_id="ABO03328.1"
FT                   /translation="MTNRCPHARRPPSRGPVRSFRRLAFARAACAVSSARDRWLIGDRS
FT                   GIGQRLIDGSPAWVHDWSAMGERRTGGESTAGRRRPGRRSAASQRLASMTVHPRSARPA
FT                   RLRSNDRRIGNGRIAIASRRIAAMPSRRHARRRAPPHTGHRTPRAAARARRCRPIPSHH
FT                   AHPPFGSARFRETE"
FT   gene            complement(598548..598958)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0647"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            599303..600067
FT                   /locus_tag="BMA10247_A0648"
FT   CDS_pept        599303..600067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0648"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02864"
FT                   /protein_id="ABO02864.1"
FT                   /translation="MRSDAAAHERRRSGAVCVERGSGRRPPLRAHAAAMRGRARQSVRF
FT                   PMTEEPPMNAFRPPELIETERLRMRPLTEGDAPEAFDALFGDRATTLDLPWPVHRSVDE
FT                   SRASIRRLAEGWRSGAFFSWGLFEKRGGRLIGTLEMHGRLPRVEIGLLTSFAPGRVRTR
FT                   AWSEMLHRFLGWLIAQPGVYRIEAFCSVTGKAAPLMPHFGFVCEATVRNYEARPNRGMS
FT                   AGDSYLFAITKAPQALRRAVEDEARAPSRQAA"
FT   gene            600064..600363
FT                   /locus_tag="BMA10247_A0649"
FT   CDS_pept        600064..600363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0649"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02622"
FT                   /protein_id="ABO02622.1"
FT                   /translation="MNGASGRDGESGGESGMAVEGYPLCEPACIAAGSAGARERRARAR
FT                   RCARRRSRALGFVCRLRPAQAAYRVADAGCRGAPWRARRVFARRRAAKREPCGA"
FT   gene            complement(600591..601079)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0650"
FT                   /note="putative hrp protein; this region contains one or
FT                   more premature stops and/or frameshifts; identified by
FT                   match to protein family HMM PF09613"
FT   gene            complement(601128..601310)
FT                   /locus_tag="BMA10247_A0651"
FT   CDS_pept        complement(601128..601310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0651"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02628"
FT                   /protein_id="ABO02628.1"
FT                   /translation="MRPPFDAKLRQRARARRPSARSGVAAAETADRGPCAGVARRARAS
FT                   PRTPSLRTRRSLARA"
FT   gene            601309..601932
FT                   /locus_tag="BMA10247_A0652"
FT   CDS_pept        601309..601932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0652"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01898"
FT                   /protein_id="ABO01898.1"
FT                   /translation="MRAARVLFSFRQSIHIHSETVMSVNGISNQTLNPAQYQSTTSSSR
FT                   DQKIEELLHEIEDLLLQDDSGGGDDTNVGGDPTGNTNTPAGGHTHAGNSGPGGHVTAGG
FT                   KPGEDMRDVKLNTKVGGEALHLKMDSQGNLYNGSGNSVGVIDKDGNVKLNSGATKELER
FT                   LETGGNPFKYGVANVGKRGAGGNMEFTPDEVTVSAGDIDQKADF"
FT   gene            602066..603145
FT                   /locus_tag="BMA10247_A0653"
FT   CDS_pept        602066..603145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0653"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03749"
FT                   /protein_id="ABO03749.1"
FT                   /translation="MPQRADARIFEVMQARQPWGTLALDRDGAIVAATRRAHALLGRAL
FT                   PAGLPLAAVLGEAVGTDFAALVEALEPGFEFETDDAILWLTLQPVEHDPAIAATVTVAD
FT                   VTPLRRALDERVASLRFLAHDLRSPQNSILALTQLHDADPDAFAACGGLERIAQLARHA
FT                   LLLGQDYLVASAADDLRQRHFVRFDLRKMLRELVPKLEVSAVYRGVALQLWLDDAAPLW
FT                   LRGARVFVARALQNLIDNAVQASRQGARVEIRLHVRDVHAEVAIRDWAGGLPGLATDAR
FT                   MTDFAPLAKRGSMGFGLGLQLAAQVVAAHAGTLHAESNRGVGTTFVMRLPMLAPAPGAV
FT                   PPAVPDGIARWRASVAPDG"
FT   gene            603154..603945
FT                   /locus_tag="BMA10247_A0654"
FT   CDS_pept        603154..603945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0654"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03114"
FT                   /protein_id="ABO03114.1"
FT                   /translation="MRVFPFSLDDSFLTMSEPNMQRTVQQPKQIVVVEDDPVQRTLLVT
FT                   WLKAEGYRVEAFDDGLDARRFLGDSWADLLLLDWDLPGMTGERLLAWVRGRARSIVPVI
FT                   FQTVHSDEEDIVKILDAGADDFLIKPLERQTLLARVRALLRRFAALSADSARMQLGGYT
FT                   LSRATLTVADGGASHAFSAKEFDILWHLAEHPGAVVQRQDLLRLVWGAEASAQTRTVDM
FT                   YVSRLRSRLKAAGIGWTVHAAYATGYRLNLGADAETADRAS"
FT   gene            603942..605732
FT                   /locus_tag="BMA10247_A0655"
FT   CDS_pept        603942..605732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0655"
FT                   /product="type II/III secretion system family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02991"
FT                   /protein_id="ABO02991.1"
FT                   /translation="MTRRAAASAAAVALALASHAAALRAVPLAWPLARFDYRVGPVNAA
FT                   DALGELSRRSGIAIDVDARAPCRLDVREALPPRRFVERLARTCGLVSYYDGAVLQLVAS
FT                   DAFEHAAVRLNYATLAELRAALARQRIVDARWRPGYDDAARIARVAGPPRYVALVLAAA
FT                   RALDEAAQTRVRTETRAFRLRARAAADRVVRGDGDGDDAVLPGLATRLRRRLEQDGAEP
FT                   RAVPGVREFTASLPIVDADARSNTVLIRDVPARLAHDARLVAQLDTRPASIRIDAFGAT
FT                   LAPAQLDALGLRWRDGAPASGASRDAGVARDGSRASAGGRLVGASRPSGARNEAAAAGA
FT                   RRAPAVSAAPDASGASAASGPSAASGAPDAVDASAGSADSPRASAVRIAIVSTPAGCAP
FT                   VRARIAELAAHGDASIDADDSTLALPDSRADFGRLRLSFVASGDGDARALDARRNGFAM
FT                   RVTPHETAQPARYALDIRIVERRADGDAAGASSRETVAGVTLAAGECAALALPSAAHGE
FT                   QRLVLVMPRAVPADPARLPPQALPNAPAAAAVAANARGPDAAEPAARAQAAARAHPPAA
FT                   PLPSPSAGLGLRAQTRLLGN"
FT   gene            complement(605953..607059)
FT                   /locus_tag="BMA10247_A0656"
FT   CDS_pept        complement(605953..607059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0656"
FT                   /product="putative twitching motility protein PilT"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02295"
FT                   /protein_id="ABO02295.1"
FT                   /translation="MNQHAAAAPLRDLAGEVLGLIDLKQMFTDIHIEQDRPVTIKTPRG
FT                   WVETSDEPVLLDDMRPLLDAIDEHWESALRQGTLDRPFVLTRCRLRCHVYRAGGGRKIV
FT                   ISMRRLPLKPLPLEELGLPVYVRSMLDNTKGIILVTGPTGSGKTTTIASLLEHVNATRN
FT                   THIVTIEEPIEYYLERRQSIISQREVPTDTPNFPHGLREALRQKPDVVMVGEVRDAQTA
FT                   DTLLQAGESGHLVLATMHTGSAVSALNKLLSFFPVEQRDRHAVALAESLIGIVCQSLVP
FT                   SADGESLVLASELLFNNNNQVAKLIADPTKLHLVNEFLRRREDNMSRSLNDDLAALAAR
FT                   NRITTKDALRATYNRLELHEMMQSIVNR"
FT   gene            607376..607945
FT                   /locus_tag="BMA10247_A0657"
FT   CDS_pept        607376..607945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0657"
FT                   /product="pilL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02062"
FT                   /protein_id="ABO02062.1"
FT                   /translation="MMHGATVAAAAFIAFALFATDCAASGPPAGTDPAPGGAFAERFDH
FT                   APLTAPRVDVVRAPQTAAPAGASRAADTVPAAQPPAGAAATAGQPPVADMPVADVPLRT
FT                   LPAWDVRVSDGTIRGVLSRWANTAGWQLVWDAPVDFSIDAQATLRGSFEDALQALVASL
FT                   GRTSTPIQAILYRGNHVLRVVAQGAG"
FT   gene            607945..609717
FT                   /locus_tag="BMA10247_A0658"
FT   CDS_pept        607945..609717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0658"
FT                   /product="type IVB pilus formation outer membrane protein,
FT                   R64 PilN family"
FT                   /note="identified by match to protein family HMM PF00263;
FT                   match to protein family HMM PF07655; match to protein
FT                   family HMM TIGR02520"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03021"
FT                   /protein_id="ABO03021.1"
FT                   /translation="MRVLFAISLLAVAWLAGCTGLRGGIERDARRDSNETGALLKRASD
FT                   GDNSVRSLAPVVVDNGLWVSAGTVKLRNSEQLPPLFDEPASFDRSVASLSEFAEQITRL
FT                   TQVPTQVAASAQQAAARSQHGGAGDAARGAPAFLDASGARAVPPLPPGLPGGASAGGGK
FT                   TGGGAAGAGSEGGGGTSFAPVRVLYAGGTLRGLLDAACARFGVSWKYEQGAIRFFFTDT
FT                   RTFQVNAIPGDSSLNASVVSGATSDGAAGGSQSGGSGGSGGGINGAGSGTTGLTANNTA
FT                   NTAVNSQLSVFNGLQSAIQSMLSRYGSSVASPATGSISVTDTPDVLERVAAFMAQQNRS
FT                   LSRQVLLNVTVLSVSLQAGDAYGIDWNLVYKTMSAGFGITNPFHPTALTAPADMSAAVL
FT                   SPTSRFNGTKLLIRALSQQGTVRRKTSASVTTLNNQPVPVQVATQTGYLASVSTTNTAN
FT                   VGSSTALTPGVVTTGFNMTLLPHVLDDGTVMLQFSTNISSLLELKEVTSSTGGSGLARI
FT                   QTPDVDMRNFLQRVAMKSGETLVISGYEGANDSLDERGVGTPKMIALGGGYEAQRAREV
FT                   IVILITPVTQRGGA"
FT   gene            609729..611027
FT                   /locus_tag="BMA10247_A0659"
FT   CDS_pept        609729..611027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0659"
FT                   /product="putative PilO"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02136"
FT                   /protein_id="ABO02136.1"
FT                   /translation="MSAQVIQIGRQRFVGGLFWQSLSRRNELRAEAVELAKKLKFDLMV
FT                   LRIDRGVAAAGYANTRDGFAPGHLSLGAMVSRAIALEGAFYNGRRQPAPNWLGAFALPD
FT                   GRWAYFAVRDHAFMPNGDWVGSREEALERLHTDYAWGGWNVVIGEPELERQGFQNFQPK
FT                   RLDDLLPRRGGRPRTERWWALRPVERRLSPRAALIAATAACVVLGGAFAYWHHRAKVEA
FT                   EEREAALERVRAELAARQARSGPVAPPWAALPDALAFARACAMRFGRLAPGGWRLERYE
FT                   CTPGTAHYAWARNGSNVRYLLVVEPGATLDTDGERATLDVPLTAPTANDTPLADDSVVR
FT                   TQLLARLQWLDAAAKLERLLPEQGPRAPLANLAQQAAALPASPTWRAYRLNANLGGIAP
FT                   PEFVRAIDVPGLRVERIAYQNNQWTLEGVLYAK"
FT   gene            611041..611541
FT                   /locus_tag="BMA10247_A0660"
FT   CDS_pept        611041..611541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0660"
FT                   /product="putative type IV pilus biogenesis protein PilP"
FT                   /note="identified by match to protein family HMM TIGR03021"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02646"
FT                   /protein_id="ABO02646.1"
FT                   /translation="MCALGVALFAGAARAAGPAPSDDGGATAARLTQLQSETVLLQAQL
FT                   KKLETQQQVIERAAQLARALGGGAPAGQFAVTAIEGVGKRAFATLRMNGGAEFEVQRGD
FT                   ALPDGARVVAIEPRAVVVSNRGRTYRLSTGAPPSPAYAGNPPLPADAAAPLPTLPARPA
FT                   SGS"
FT   gene            611538..613148
FT                   /locus_tag="BMA10247_A0661"
FT   CDS_pept        611538..613148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0661"
FT                   /product="type II/IV secretion system protein"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03348"
FT                   /protein_id="ABO03348.1"
FT                   /translation="MSHDAQRPDTAAARATPSAADAAAPPRGPRAVSEAGDFAASVEER
FT                   KFVCLFDDGRLLIAEGHEMNPFVLSYRARLDRMGRPYRPTPATLMQVREAYRQHVAGGG
FT                   ERLDHTVMQVLAKELIGRACRERASDVHIRVRRFSTEVYFRIHNELMRVNEHTREHGER
FT                   LLATLYGAMTTVSDNSYRPSERQDASIGDRDKLPDDLYGVRIATTPTSEGSLMVLRLLY
FT                   NDAGDATDLAALGFAPEHVAAFRMLRAQPHGMNIISGPTGSGKSTTLQRMLAAQIDESH
FT                   GSLHVITVEDPIEYPIDGAVQTPVANAPTEDARALAFAAAITNAMRLDPDTIMIGEIRD
FT                   RVSGQTALRASMTGHQVWTTVHANSALAIADRLIDLGLHARMITDHTVISGLISQRLVK
FT                   LLCPHCKVRLLDHAERIEPGLLARLRLALDTRMSEVCITGDGCEQCGMAGTIGRTVVAE
FT                   VILPDARLFEFLRDGDKVGALEYCTRTLGAMTLAEHALRKVAAGLVDPRGVERVVGALA
FT                   PVTGDARQQLSLVGFSYGT"
FT   gene            613138..614214
FT                   /locus_tag="BMA10247_A0662"
FT   CDS_pept        613138..614214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0662"
FT                   /product="type IV pilus biogenesis protein"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02620"
FT                   /protein_id="ABO02620.1"
FT                   /translation="MALELNRRWAKLCLNADERLRVYRKIAKMLGNGLPLLKVLEELEW
FT                   RASREGRKPREPLAIVLSDWRLAVQNGGMLSEAMDAWVPATEQMIVAAGEQAGRIEDAL
FT                   ASVADIVQSSRKIRRAVTGGVAYPVGLVVMVIGYLYLFGTHVIPKFALIADPAHWRGAA
FT                   RSLYLMSLFVQGWMLVVVAALAAALVALAWSLPRWRGPLRIYADRVPPYSIYRLIAGSG
FT                   FLIAFSALQASGVTVEKALLKIGSVAGPWLRERIDDTLVGVKSGLNAGEALLNAGYQFP
FT                   SREIVEDLCIYAEYGGFDAALKMLADEWLEEGVARITAQMRVLNGVAIVVLALLIGWLV
FT                   TGFFGIQQEIAAMTRAMH"
FT   gene            614211..614801
FT                   /locus_tag="BMA10247_A0663"
FT   CDS_pept        614211..614801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0663"
FT                   /product="putative type IV pilus biogenesis protein"
FT                   /note="identified by match to protein family HMM PF08805"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03485"
FT                   /protein_id="ABO03485.1"
FT                   /translation="MTSRIFNSGETSMKPLAAHPAYRHEPAFCRRHRRERGASLLESIA
FT                   YLGVAAIVIVGAIALLGSAFSSANTNRLAEELNAIQTGTKKLYMGQVNNYGNADLNANL
FT                   IAARVFPSTLPTGNNNTVSNAWGGNVTVTGAGRTFTVQYTNVPRDVCINTLTAGGNWQT
FT                   VAIGGNAPINYPVSPTNATANCADAATIVWTSN"
FT   gene            614841..615320
FT                   /locus_tag="BMA10247_A0664"
FT   CDS_pept        614841..615320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0664"
FT                   /product="putative PilM"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02823"
FT                   /protein_id="ABO02823.1"
FT                   /translation="MYALAAALAFASLAAVYAALQGPAAVPALQPARAAQALADNLAVY
FT                   RQAALDYARAHPGTRGAVPNARLAFPAWYPGADPLWRNYVENGTVVAYAASAPPVNIAG
FT                   EVATLAEGSLLAGVAYRGAVVRPGRADPNAPASGVPLPAGLAIADGLPVWMGQAY"
FT   gene            615320..617047
FT                   /locus_tag="BMA10247_A0665"
FT   CDS_pept        615320..617047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0665"
FT                   /product="type IV prepilin"
FT                   /note="identified by match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03007"
FT                   /protein_id="ABO03007.1"
FT                   /translation="MRFVLSRRRARGFALIEMLGALAIAALLLAGIAAMMDSSLDDVRA
FT                   QQAAQYQAQVTAAATRALKRDYDAWLQRANAQTPVVMTLADLQATNDLPAALQTRNAYG
FT                   QHTCVLVKRTANGVGLDALVVTTGGEAIGDKELGLVAASAGPGGGSIATSAPALARGAF
FT                   DAWRMPLGAYLGGSSPTCDPADAAPPNAGHLANEIFFNGPSQQINSDYLYRVGVGGHPE
FT                   ANAMQVPIWLTHTFVEGAADAANCGAAGSYANGKLGADAAGQLLSCRNGVWRGAGGHWK
FT                   DPVRTADDLPTDASNETGDVRLTLDTFRAFAWTGNAWQALAVDQNGNMIVPGVVSANQY
FT                   EITGRVVVNTPCAPEPSRPNAGLVSMGQDGQVLSCQGGKWLPQSGIKIGGTETACEILM
FT                   ETPGATDFSCGYTYRGPYPNPPLITYEPDGTYTYTINRPVKLDNNGLIAVSAYMHMSYA
FT                   TCALKGREGQMRLVVDVIDVQSNQVIAHSEAQSTKLIEDAATINVTLNQAAEPRSGYTV
FT                   RLSSKWATYDSYAGTPWTSSYCSGGKTFLQTPLVTGWTIFVLLNGASPRVAAAARRCG"
FT   gene            617117..618916
FT                   /locus_tag="BMA10247_A0666"
FT   CDS_pept        617117..618916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0666"
FT                   /product="type II/III secretion system protein"
FT                   /note="identified by match to protein family HMM PF00263;
FT                   match to protein family HMM PF03958; match to protein
FT                   family HMM TIGR02516"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02280"
FT                   /protein_id="ABO02280.1"
FT                   /translation="MKAKIPVLLSLLCSLASLSVDAAPIRWRSADIQYAAEGKDVKDVL
FT                   RDLAASQNIAANVAPGVSGAVSGKMKMSPQRFLDTLAASFGFVWYYDGTVLYVTPASDM
FT                   KSTLVKLDHANTGDLRDLLEQMKVADSRYPITYNAQQRTALVAGPARYVELVTSVAARL
FT                   DENSARTGGTQIRVFSLKHAWAADRDVNVDGTAVSMPGVASLLNRMYHPGEGKRASQTT
FT                   LGKPISRAAPMTDLGGGRSGVPPLPPYMQAAQSGDGAAMPAGVPGVPGGDPRPSGMVAA
FT                   AIANPGAARAPGGGMPDANGVPAGAGDAADLPVIQADPRTNSILVRDVPEHMAQYPDLI
FT                   ALLDVKPRLIEIEARIIEIDEGALKQLGVDWRAHNSHFDLQTGTGLTSQNGYANGTLNP
FT                   TFGSITLSGNDSVGVPASPLGLSLTAVLGDAGRYLLARINALESSNQARTDASPKVTTL
FT                   DNVEAVMDNKKQFFVRVAGYTSADLYSISTGVSLRVLPMVVDEGGCTQIKLDVRIVDGE
FT                   LSQQTVDNIPVIVSNEINTQAFIEQGQALLIAGYKVDARSSTQSGVPVLSKLPLVGALF
FT                   RSTDKQNSHSERLFLVTPRVIEP"
FT   gene            complement(618984..619868)
FT                   /locus_tag="BMA10247_A0667"
FT   CDS_pept        complement(618984..619868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0667"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01942"
FT                   /protein_id="ABO01942.1"
FT                   /translation="MRKPAHARFNHDSSARSASRPNPPARVFGDDPVRARARRPARIAA
FT                   HRRRPRTVHRQRAVNRRRAARFAHAPGAHGPRPNMIAAPVLHTLLLRTGHWLRRHTRGF
FT                   SRSDFWPGRAFLEAFTVLAAWVLPAIAGVVATGWLGGHRSVTYLQAAIQEGIGPHIWNV
FT                   FGTLGAVLFGLLVAAPTQRWLALAAHQVMLNAYSLGALMLGLLLGQWICIGAPPASGLL
FT                   HASLRAAGIGALFSIAFGLNLAVWYVAFLASPKRLHTGFMLKIAQCAPQFRVPLAATIV
FT                   TAALASLYLYLGR"
FT   gene            complement(620019..620501)
FT                   /locus_tag="BMA10247_A0668"
FT   CDS_pept        complement(620019..620501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0668"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02764"
FT                   /protein_id="ABO02764.1"
FT                   /translation="MVTRRAPKRGPTHGARLACASPSRAGHLLPPGRGGSIGTKRKSAC
FT                   GAARGGRCGGLPRFTPMRIARRERLRSACHVRRMSGHRGETSMPSIPHSREAEAAQRFF
FT                   EATRNVELAFRGDAEAPAPSIEYAAAVSRLDRALDELARAQAWFDSAVRMRARKRN"
FT   gene            complement(620495..621295)
FT                   /locus_tag="BMA10247_A0669"
FT   CDS_pept        complement(620495..621295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0669"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02439"
FT                   /protein_id="ABO02439.1"
FT                   /translation="MTLKHLPPTFCWTKIGHESGEELPTVVLRKEWERRLGGGRFLWGI
FT                   GQPLGNSAQIAAHRTGSLIALFSPASSRARQPERKTEDVLLWNAWIDASGQVRQLPLHT
FT                   FITSRATLPSGRRREHYYALVCASPTELSIGTRLRVYPDHLRSVSTGKVLGAAQSAAVV
FT                   DCVGRDAEQSGRSYPLALSVELEAPYFVRLTQPSLLKARDLADITKATRDGDFDTFVEQ
FT                   VTRLRSRPAAEQTRGFTRDLFDLSPAESAAPFGNAAPAHANHAW"
FT   gene            621426..621716
FT                   /locus_tag="BMA10247_A0670"
FT   CDS_pept        621426..621716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02233"
FT                   /protein_id="ABO02233.1"
FT                   /translation="MADTRSSSEIARLSGVSQPTVSRLRSSSGRRLRRSASFNKLCSFY
FT                   GVEARQAARLSAPYNDLLREAIVEAWDGSEEHGRALLGVIQGLKALSSKPG"
FT   gene            complement(622308..622607)
FT                   /locus_tag="BMA10247_A0671"
FT   CDS_pept        complement(622308..622607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0671"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01592"
FT                   /protein_id="ABO01592.1"
FT                   /translation="MRPAFGGPHRIAGETGRRGARRSRGMRSGFERGSSRIHAALGARR
FT                   RHRIGERARHAAGCGHVTRLRRTHAVPTQPKPKPPSARRRFTRDEPGRCHRPRR"
FT   gene            complement(622623..624023)
FT                   /locus_tag="BMA10247_A0672"
FT   CDS_pept        complement(622623..624023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0672"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03291"
FT                   /protein_id="ABO03291.1"
FT                   /translation="MKKLKYAAALLTAVAMSPSWSQASTLVAQSHVDGVSRAEPAKIGE
FT                   QLAARRASLPTLPRPLPTLSAGAIRQAGLRAPLAKRQATLAAPAAATVAPPVANCTDVT
FT                   IGAAYNAATAPAGQADCFQFVAPSATKIVAYVVNLPANEQHDAHLVQVNEDGSWTVLDS
FT                   QADLSPNKIVEAVPNGPVRLLLLVSAQQGAGNAPFQFQVLGTTGYDSYEPNDSILHPTK
FT                   LTGNQLISANLDTVADFDYYAVQVPSTQTANYVTFKGAGTQTAELETAPNTWATLASGT
FT                   SYNITSPAGATLMFRVYDKGTTAPAAQAYTLRISDGAGTAGFYRFLDEENITHLVRGNE
FT                   NVARVVSAGTIAWDSTGNVRLPPGERIWLRAYDSAGPNGPNTLLSETSGYTDANGNLLV
FT                   NLNVGVCQGGGTMTGDFNTMSVPSDRWRITYNPYAFVVAYLDNAQIRAQTSIKHFTHIC
FT                   TEQYLGRK"
FT   gene            complement(624020..624358)
FT                   /locus_tag="BMA10247_A0673"
FT   CDS_pept        complement(624020..624358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0673"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02619"
FT                   /protein_id="ABO02619.1"
FT                   /translation="MRAHPATRPRPNSAPGVGASLSKNSIAAAGRCAAAAAASERMPAC
FT                   ADSSRDKPARTRRAPRRRDLGALRPVGAAMRAVPFARPSTRNFPALFFLGKRMMIAAHP
FT                   AHPHTETL"
FT   gene            complement(624634..625587)
FT                   /gene="speB"
FT                   /locus_tag="BMA10247_A0674"
FT   CDS_pept        complement(624634..625587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB"
FT                   /locus_tag="BMA10247_A0674"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="identified by match to protein family HMM PF00491;
FT                   match to protein family HMM TIGR01230"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02597"
FT                   /protein_id="ABO02597.1"
FT                   /translation="MSDDYFQPQSGNAMPRFAGIATMMRLPQAASAAGLDACFVGVPFD
FT                   LGTSNRTGARFGPRQIRSESVLLRPYNMATRAAPFDSLRVADLGDVATNPYNLADSIAR
FT                   IEAAYHAILAHGCRPVTLGGDHTITLPILRAMHRRHGRVGLIHVDAHADVNDTMFGEKI
FT                   AHGTPFRRALEEGLLDGDRVVQIGLRGTGYAAEDFDWCRDQGFRVVQAEACWNRSLAPL
FT                   MDEVRARVQGGPVYLSFDIDGIDPAYAPGTGTPEIAGLTVPQGLEIVRGAWGLDIVGAD
FT                   LVEVAPPYDPFGTTALLGANLAYEMLCVLPGVARRA"
FT   gene            625754..626668
FT                   /locus_tag="BMA10247_A0675"
FT   CDS_pept        625754..626668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0675"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02038"
FT                   /protein_id="ABO02038.1"
FT                   /translation="MLGTLTDLDLRLIRVFVAVADAGGVSAAQATLNVSQPTISTQLAT
FT                   LETRVGFRLCERGRSGFRLTTKGERFYALAKKLYAAVDAFTGEARHMDKTLVGTLAIGL
FT                   IGHTPISANARVSEAIARFRRRDEAVRFVISVRPPGDLEERLLSGDVQIAIGYFWHRVP
FT                   ALEYAPLFVERQLAYCGRGHPLFARAGRLAAARVAAFEWAWRTYPSPEVALSTTPANVT
FT                   AHADNMEAIALLILSGHHLGYLPRHFAAPYVEQGLLKALNPATLCYDVTFDVVTRRGAR
FT                   RDPIVQAFLDDLTHAHRGGAAQA"
FT   gene            626665..626862
FT                   /locus_tag="BMA10247_A0676"
FT   CDS_pept        626665..626862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0676"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03649"
FT                   /protein_id="ABO03649.1"
FT                   /translation="MTRDARCAMRDARCAMRARPPAPGIGRDARGDARGIRTVFFRANP
FT                   AGCRGRIPASNRHEFRMNAG"
FT   gene            626870..626998
FT                   /locus_tag="BMA10247_A0677"
FT   CDS_pept        626870..626998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0677"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03144"
FT                   /protein_id="ABO03144.1"
FT                   /translation="MSLRMDFAGTARDSATRAHRCGPMVRDPFFPRGGARDGTRSI"
FT   gene            626995..627138
FT                   /locus_tag="BMA10247_A0678"
FT   CDS_pept        626995..627138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0678"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03847"
FT                   /protein_id="ABO03847.1"
FT                   /translation="MSQVKPGGSGCTQYATGRMDARRRARRRDRNGAMRWNTGTSIVDG
FT                   GG"
FT   gene            627099..627551
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0679"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(627719..629071)
FT                   /locus_tag="BMA10247_A0680"
FT   CDS_pept        complement(627719..629071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0680"
FT                   /product="putative regulatory protein HipA"
FT                   /note="identified by match to protein family HMM PF07804;
FT                   match to protein family HMM PF07805; match to protein
FT                   family HMM TIGR03071"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02818"
FT                   /protein_id="ABO02818.1"
FT                   /translation="MSARRARATRLHLWMNGLPVGYWEHARDGERLVYFDEWIGDPQGR
FT                   PLSLSLPFTPGNQPYRGRLVSDYFDNLLPDSEPIRRRIAMRYRTGGTSAFALLATLGRD
FT                   CVGALQMLPPDEAPDDIERIRGHALADADIARLLREVTSAPQAGRHAPLDDLRLSIAGA
FT                   QEKTALLRHRGRWLLPEGSTPTTHILKLPLGLVGNRRADMRTSVENEWLCARIVAAYGL
FT                   PVARCDIAQFDDQKALVVERFDRRPSRDARWLLRLPQEDMCQATGTSALDKYQADGGPG
FT                   IETIMEVLAGSEHARDDRRAFFAAQIVFWLLAATDGHAKNFSIAHLPGNRYRSTPLYDV
FT                   LSAHPVIGRGANQLPAQRARLAMGVRGKHIHYPLHQIRRRHWIAQGQRVGFAPADVDAL
FT                   IDTLTARTADVVDAVSARLPRDFPRDVADAIFSGMLGLSARLAGDAAARAP"
FT   gene            complement(629068..629472)
FT                   /locus_tag="BMA10247_A0681"
FT   CDS_pept        complement(629068..629472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0681"
FT                   /product="putative transcriptional regulator HipB"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03344"
FT                   /protein_id="ABO03344.1"
FT                   /translation="MAILIEHEIKTLGQLRPILRGFRKSAGLTQAMLASRLGVTQQTYA
FT                   QFEANPASASVERLFKVLRALDIELTLTLTQVYAAPAGKDKGEVAKTVANARAGARRAV
FT                   PPASAPAPSAAGRPPRPARKRAAPKKREDW"
FT   gene            complement(629628..629744)
FT                   /locus_tag="BMA10247_A0682"
FT   CDS_pept        complement(629628..629744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0682"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01733"
FT                   /protein_id="ABO01733.1"
FT                   /translation="MRKRIIPHTQTLPRRSAHRRARFQRRQAPRAATKRLAA"
FT   gene            complement(629810..630031)
FT                   /locus_tag="BMA10247_A0683"
FT   CDS_pept        complement(629810..630031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0683"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02241"
FT                   /protein_id="ABO02241.1"
FT                   /translation="MRWHTPAFDSLADAADTPLRRRPTWFDVGRSARGAGRAPAPRRSP
FT                   NGADRQTVKKLRIIRDMTAEKRMEPRNF"
FT   gene            630020..630268
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0684"
FT                   /note="cyclic di-GMP binding protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            630487..632934
FT                   /locus_tag="BMA10247_A0685"
FT   CDS_pept        630487..632934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0685"
FT                   /product="cellulose synthase, cyclic di-GMP binding
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF03170"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03703"
FT                   /protein_id="ABO03703.1"
FT                   /translation="MPAARKRSRLRIGFAAPMKPIATFARAFAMACALLCPIASWAALQ
FT                   SAPRPASQPALQPASRPTPAPALQPPRARPRAPRSASLAAGASAPLPASAPLVMPLAAP
FT                   KPSGLAGAAIHVPFATLGAYEPLRLRGSDTARTVNVGVRLDRMVTAARLRLTYTYSPSL
FT                   VFPVSHLKVSINGEAVATLPFDSEHAGRAVTQEIPLDARYFTDFNQIELRLIAHYTLDH
FT                   CEDPEHSALWADVSPTSELIFDEASVRLPNDLALLPAPFFDRRDNSRLRLPFVLPATPD
FT                   DATLRSAGVLASWFGVLADYRQARFPVSSALPANDHAVVVGTAARLPASLALPPIDGPM
FT                   LVVTDNPAAPDKKLLVVTGRSAADVDAATNALVLGSAALSGPWARVSRIDIGAPRKPYD
FT                   APRWVPVDRPVALRELVDSPADLQVRGSAPDPIRLNLRVPADLHSWGGSGVPLALHYRY
FT                   TAPTVRSDSMLAVEINDQLVQSYRLSPRSQDARGRMQVPRLSGADSRATNDVDIPAFRV
FT                   GSANQLQLRFTLDLEKTGLCTGGASEPQRAAIDPDSTIDFSRFIHYAMLPNLAYFANSG
FT                   FPFTRYADLSQTAVVLPPRPSPAEQEAYLTMLGHMGQWTGFPALRVRLARAADAPAIAD
FT                   KDLLVIDGAPPYAQLANWRDALPVAIGEATAGGGFSRAAFSVKERWHDDARSPAGGARF
FT                   EQSGTLAALFGFERPGGDGRSVVALTATDARHLGDLLDVFEKPGLVAQLQGDVALVRAG
FT                   AVESLRVGEPYLVGYVPWYARVWTAVARHPMLLGLLGAAAGLLLALGAFGALQRIAARR
FT                   RGL"
FT   gene            633152..634465
FT                   /gene="bcsC"
FT                   /locus_tag="BMA10247_A0686"
FT   CDS_pept        633152..634465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcsC"
FT                   /locus_tag="BMA10247_A0686"
FT                   /product="endo-1,4-D-glucanase"
FT                   /note="identified by match to protein family HMM PF01270"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02081"
FT                   /protein_id="ABO02081.1"
FT                   /translation="MASFSVMAFAAATLPVSWRVAAAAERTRSGGERAGGLRDTAGLIE
FT                   ISAAAPASTPIPAAPRRFAQPFAQPARAFAVASACAPSWPRWDRFKRDFVSADGRVIDV
FT                   GSADERTVSEGQAYGLFFALVANDRAAFDALLRWTEDNLAQGDLSARLPAWLWGRAADG
FT                   AWRVLDANAASDADLWLAYALLEAGRLWRERSYTARGALLAKRVLDEETATLPGLGLVL
FT                   LPGPMGFRPARDAWRLNPSYSPPQAIRGIGAHVPDDARWARLAAGFGRVLTDSAPRGFA
FT                   PDWALYRAGRGFEPDAETHAVSAYNAIRVYLWAGMLDAGDPLARPLVAHFAPFAEHVAA
FT                   HGAPPEAVDATTGAAAPRDGNAGFSAAAVPFLEARGERASADAQLARVARLERETASGY
FT                   YANVLTLFGLGWRDGRYRFAADGTLRVRWSEPCSTPAR"
FT   gene            634444..639186
FT                   /locus_tag="BMA10247_A0687"
FT   CDS_pept        634444..639186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0687"
FT                   /product="cellulose synthase operon protein C"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF05420; match to protein
FT                   family HMM PF07719; match to protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02607"
FT                   /protein_id="ABO02607.1"
FT                   /translation="MLDARALTAGPQARRRARRGAGCAGIAAVAAIAFAVPCFASAAAD
FT                   DVAARWAASERSLADAHACAGVRPAAPGWAVSMEAAAPPPRFVPPGPNTSPGAMQANVE
FT                   AMSPAAPARAAAMTRASSARLEPAPSASVDAASANVEAMPPAAPAQAAAMTRASSARLE
FT                   SAPGASVDAASANVEAMPPAAPARAGAMARASSARLEPAPSASVDAASANVEAMPPAVP
FT                   AQAAAMAQASPVRPASVPRASFDAPSAQAGSMPPDTAHRHASAASSLARTTAPALPFAP
FT                   AGFASAALRAFAPTYPMSLMSPMSPKQTPPVRFVPTSPRGAPATPQPVATPHAPDADAV
FT                   RALYATARMWANKHRDDLARDALRKALLIAPRDPALLAEHTRILLRVGDAKGARASLER
FT                   LKQAAPGALATRQVDDEYRVATSGREEMAQIRLLARSGRGDEAARRIVALFPHGAPAGS
FT                   LGAEYYQIVASAPDGRARAIDALRRAVAADPADADAATVLAKLLNQRDDTRAQANRLAW
FT                   ALVARPDTDRRASLALWRSVLQSAGRDLAYLDALRAYLTFAPEDDEFRGNAAALEQQRD
FT                   ARLRLARDPDYIPQQRGLQALARGDPAAAEPLLARAAAARAGDPDALGGLGLLRLWQGR
FT                   HDEARALFVRAAALAPDNRAKWVGLAGTARFWGTLAQGRAAAAQGRPDDAQRAARAALA
FT                   LDPQSADAKLLLADSLLARRDWRAAQPLLRALLDARAPSVSAVRSMRTLYEQTGRADAF
FT                   GPLVDALQSRFAAPDDRAALSRLRAEWLAQQADALAAAGQRGPAAQRYEASLRIAPDAP
FT                   WARFALARLYRDMGLPQLGRAVMDEGLAGSDAADMRYAAALYRYALDDVAGARAAFAAI
FT                   ADASRTQGMRAFARKLDAEAALADARAALAREDRAAAHAALERARRAAPDDPDMLAAVG
FT                   AQWIDIGEIERGLAPLRDWIVAHPREADADVRLRYGDLLGGARRDDALAAWLDTLRRGG
FT                   APLDAAQSARLEDQALRLVLRETDDALDRDDYEAAARALDRASPAGRADRRYALEAAEL
FT                   ARAQGRYDTARAALAPLLARAPDDADAQLALARILDDDGAPADALALVRDVLARTPPDD
FT                   VDTQLSALRRLTALRRARDAAALADTLRAAYPARADVTVAAGRVAQALGRYDDAASLYW
FT                   LSLAQERATGIAPRRDGATPAQAAWADLQQRRDPQIEAGWLPAYKSGDEGVSAYRAHQM
FT                   PVYLQMPYRYDGHAFVHLDAVRLDAGTLDTSDPRAYAFDTFATHPALADAAAPGGALRQ
FT                   RAAGIGGGIGYRDDAWRVDVGTTPLGFPVHYVVGGVRYRFGAGPASVTVSAARRPETGS
FT                   MLSYAGLRDPWTGATWGGVRRDSVGVRASVDIGRVNLFADLAAARLTGRNVAENAAVTL
FT                   RTGFMAPVYRRADMRVSAGLVGNAWHYAQNLRYYTYGQGGYYSPQRYLSIGMPLEWAGR
FT                   RGAFTWDVTATVGVSNSYERDSPYFPNGLPGSTLVKSAPALGNPVFSRGSTRGVSFWYG
FT                   FAGVAEYRVNGRLAVGARFDIDHAHDYAPSAGLLYVRYAFDARKDSGGFSPSPVRLYSS
FT                   Y"
FT   gene            639197..641461
FT                   /gene="bcsE"
FT                   /locus_tag="BMA10247_A0688"
FT   CDS_pept        639197..641461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcsE"
FT                   /locus_tag="BMA10247_A0688"
FT                   /product="cellulose biosynthesis protein BcsE"
FT                   /note="identified by match to protein family HMM TIGR03369"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01935"
FT                   /protein_id="ABO01935.1"
FT                   /translation="MNDSRVKSPDPVPGRPASGGAGARALARLRALWRVCSRAARPREP
FT                   AHAANRLAIDALPDEWAELAPGGLYAVYAAACTSACDALIWDSVRDARTRDVTVVLARE
FT                   RAAVATRLRELGFVDGMHARGWPRRLNVLAMPPGDIAARGAAREGAPAPAPVPAPAFSR
FT                   LVGGLRALRRYRFRSNALYFVEGAERWFSWHDPVALTHEGWALAGWCRSRRIALVLLID
FT                   PRASQAAASRADARHTAPLPDAPDAPDAFDAGDGVLGGARAEHGADDRTTLFAADRARA
FT                   ARGGFHGACAGVAQLQRTHGELRWRVDFWRSRGAVATGEVRALRFVGDGRLAAVPAAGA
FT                   HAAGDGARLAFDEARVVVSRRVVERESWVPGDWEVVDDNDAVLAACAGAHAASAVLAFT
FT                   GRAQLEALCATIHALRLRCGGALKIVVVERGEAMRHQFELLALNLGANQVVARNLPFSR
FT                   VLAVLRSLQGQLHARPVAADYRAALAASLGDTALGYLPVGAFCSQARAVLERSAVLALS
FT                   HTLVKLTLLPGVAHAHALRACTPRRAGDVLTADAQHLYLFLFACELADANDVLGHLFDV
FT                   PVERISDRVVHLAQDSIEHELNALDAANRRAPIADYSDLFSPAAVATRAAGARASAGAP
FT                   AAARDGEPSAEPMSPHVPPHAPHVSGAPTPPGTRAAAHGPPWCSAFALSSASQTSRTSP
FT                   ASAQIVVPPPQAPSNVSHAPLSATPRAPRPRRPHDAGAVAGVRTRTATRDAMPLRPREA
FT                   E"
FT   gene            641458..641670
FT                   /locus_tag="BMA10247_A0689"
FT   CDS_pept        641458..641670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0689"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02450"
FT                   /protein_id="ABO02450.1"
FT                   /translation="MISLMIAGFFAGIVIAVAIRFAASRGGAGRGLPLPSGFDRSDPVR
FT                   CAIEPVALHARLLPSAARRERRDGR"
FT   gene            641667..642530
FT                   /gene="yhjQ"
FT                   /locus_tag="BMA10247_A0690"
FT   CDS_pept        641667..642530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhjQ"
FT                   /locus_tag="BMA10247_A0690"
FT                   /product="cellulose synthase operon protein YhjQ"
FT                   /note="identified by similarity to GP:18535631; match to
FT                   protein family HMM TIGR03371"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01736"
FT                   /protein_id="ABO01736.1"
FT                   /translation="MRTIAIVSTTGGAGRTMLTAALAALLARDGRPVVALDFDPQNLLG
FT                   VQLGLDAFAPAGIAHALAGAHAAWHAHTWRSADGVLFVPYGHVDPAQALACDARLAADP
FT                   EWLARALADIDLPADGVTLIDTARFPSQQAAHALRCADLALCVVPPEPAACATAAARLP
FT                   ELRAAGVCAGACSGSGAGTRASIHASTGTSTGAGALHIVVNRLNPARDMQRDVLAMLRA
FT                   ATGPGVVLEQRVHLDAALPEALARGTWFFDDAPHSQASHDLHGVAGWVGAWLDTQAARN
FT                   AAGARA"
FT   gene            642527..645073
FT                   /locus_tag="BMA10247_A0691"
FT   CDS_pept        642527..645073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0691"
FT                   /product="glycosyltransferase, group 2 family"
FT                   /note="identified by match to protein family HMM PF00535;
FT                   match to protein family HMM PF07238; match to protein
FT                   family HMM TIGR03030"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02170"
FT                   /protein_id="ABO02170.1"
FT                   /translation="MTARAAWSRRIGGAAARVRGWIARSLGVPAKGSSFDWLVRVFFHA
FT                   PAPGRRDVVRDGLRAAILWAAAQWGVTQPRRARDWLWRAFVRAPHERRSRARDPFAWID
FT                   ATLVPAFMFARRARRRVDAWLARLPWHRWGARLEQGAQRAVARRWLLPASAAAGVALWL
FT                   AAGTSPLAPAGQCAFFATLAALALALALRRVPGRLPTLALATFALLAMARYIWWRSTET
FT                   LDLRTPVEACVGYLLYAAEAYTWLILVLGFVQTAWPLERPVARLPDDPAGWPSVDVYIP
FT                   TYNEPLAVVKPTIFAAQSLDWPADKLNVYLLDDGRRPEFEAFARDAGIGYLTRDDNRHA
FT                   KAGNINSALARTHGEYIAIFDCDHVPTRSFLQTTMGAFLRDPNCALVQTPHHFFSPDPF
FT                   ERNLGTFRRVPNEGSLFYGLVQAGNDLWNAAFFCGSCAVLKRGPLEAIGGVAIETVTED
FT                   AHTALKLHRRGYTSAYLPTVQAAGLATESLAGHIRQRARWARGMAQIFRIDNPFVGRGL
FT                   GFFQRVCYGNAMLHFFYGIPRLVFLTMPIAYLFFHLYFINASALALASYVLPYMALAHV
FT                   ANARMQGRFRHSFWAEVYESVLAWYIALPTTLAFLSPRHGRFNVTAKGGRIDEGYVDWA
FT                   TSRPYLALFVLNVAAIAAGGVRLAASGGDEASTILMNVAWALYNLAMLGAALAVAREAK
FT                   QVRVTHRVAMRVPATLLLADGTTAACHTKDYSAGGLGLDAVPLARIALGDTLDVCVSRG
FT                   DRPFHFPVRVTRVDAAHLGVQFEPLTLEQERQLVQCTFGRADAWLDWRDARAEHDDAPL
FT                   RGLKEVLSMGFEGYARMLRAATSAVRARRAADRTRH"
FT   gene            645107..646663
FT                   /locus_tag="BMA10247_A0692"
FT   CDS_pept        645107..646663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0692"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03368"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03354"
FT                   /protein_id="ABO03354.1"
FT                   /translation="MTFWNLYFILKLYLFAAGHLKPLWIANLGFALALALSAPARRRSV
FT                   RLLRHALALALAVPLMYREADVPPLARLVETLGGLRAFSAGYWMELVPRFVPPMLALAA
FT                   LGVVIGYLIVNRWLRVATFVLLALIALPVWQAGSAALARLDAAAAAVPGPAGTGRAVQP
FT                   QDHNAALAAFRSQESQRQVTFGRPSADPATQFDVIVLHVCSLSWDDLDVARLRNHPLLG
FT                   HFDYLFTNFSTAASYSGPAAIRVLRASCGQEAHADLYKPAPAQCHLFGQLAAAGFAPQT
FT                   LLNHDGHFDNFLQLIRENIGVPNAPMIPNADAPVAMHAFDGSAIKDDYATLANWYAKRG
FT                   ASPGPVALYYNTISLHDGNQLTGGRMSSLDSYPLRARKLLDDFDRFADLIAASGRRAVI
FT                   VFVPEHGAALRGDAKQVAGLREIPTPRIVHGPVGVRLVGFKGDHGATTVIDAPASFFAL
FT                   AQLLANLVSNSPFKPGVTLSQYAADLPQTRMIGENEGTVTMTTPTGYAVKTPDGVWIDE
FT                   K"
FT   gene            646660..646854
FT                   /locus_tag="BMA10247_A0693"
FT   CDS_pept        646660..646854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0693"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03867"
FT                   /protein_id="ABO03867.1"
FT                   /translation="MTNGNRNTPAARGDALPPAHDIAGLARHVREIDPARYLDEQARLA
FT                   YRTALKRWPVLAKLMGLAD"
FT   gene            complement(647096..647407)
FT                   /locus_tag="BMA10247_A0694"
FT   CDS_pept        complement(647096..647407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0694"
FT                   /product="taurine dioxygenase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02644"
FT                   /protein_id="ABO02644.1"
FT                   /translation="MIAFNPSVAHPVVRTHPETGRKTLFVNEGFTTEIDELPEEEGAAL
FT                   LRFLFAHQSRPEFTLRWRWQPGDVAFWDNRSTIHYAVNDYGKAHRVMHRATIVGDRPY"
FT   gene            647394..648098
FT                   /gene="tauA"
FT                   /locus_tag="BMA10247_A0695"
FT   CDS_pept        647394..648098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="BMA10247_A0695"
FT                   /product="taurine ABC transporter, periplasmic
FT                   taurine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03173"
FT                   /protein_id="ABO03173.1"
FT                   /translation="MNAITGVSEALVVRRGAHIDKPADLVGKTIATPYASNCHYALLAA
FT                   LKHWGIDAQRVKIVNLGPTEIVAAWARGVIDAAYTWDPALGRAKASGGKVLVDSAEVGK
FT                   WGAPTFDLWAVRSDFAQAHPDFVSKFVKVTTQAIADYRANGKAWTSASRQVAEISRLSG
FT                   AAAGDIAQLLAGNLYPSAAEQASPELLGGGTADAIASTARFLKEQRKIDRVLPDYRPTV
FT                   TDRFVRAAIAAR"
FT   gene            648119..648901
FT                   /gene="tauB"
FT                   /locus_tag="BMA10247_A0696"
FT   CDS_pept        648119..648901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="BMA10247_A0696"
FT                   /product="taurine ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.36"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03003"
FT                   /protein_id="ABO03003.1"
FT                   /translation="MAKLCAQQVSVVYASRRGALTALENVSMSVGSGEIVVALGASGCG
FT                   KSTLLSLLAGFQPPTSGRVSVDGAPVAGPGADRGVVFQDDALMPWLNVIENVAFGLRMQ
FT                   GVGRDARHARARDVLRLVKLAGFEQHRIDEISGGMRQRVGLARALAADPSFLLMDEPLG
FT                   ALDALTREHMQTLLLDVWRATGKGVFLITHSVEEAVLLATELLILSPRPGRIVARHSLD
FT                   FARRYAHGEPMRSIKSDPRFTEIHLALVEQLMRETEEV"
FT   gene            648904..649755
FT                   /gene="tauC"
FT                   /locus_tag="BMA10247_A0697"
FT   CDS_pept        648904..649755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="BMA10247_A0697"
FT                   /product="taurine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03521"
FT                   /protein_id="ABO03521.1"
FT                   /translation="MAATEPNADLALPLPATNAAASAAARRAPRVHAGHAAALATWVAL
FT                   AAGWWLAARFEWVSAALLPGPEAVLRKLVVLSTEGFDDATLGEHLLASVSRIATAFALA
FT                   IVTAIPVGILVATNRIVRGVVDPIVEFYRPIPPLAYLPLMVVWFGIGDASKILLIYLTM
FT                   FAPLAIATAAGASGVSESRLRAAASLGATRVQLLRHVVLPSALPDILTGVRIALGAGWS
FT                   TLVAAELIAATRGLGFMVYSASRFLVTDVVIAGILVIGAIALALEIGLRALQRRLTPWR
FT                   VD"
FT   gene            649836..649949
FT                   /locus_tag="BMA10247_A0698"
FT   CDS_pept        649836..649949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0698"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03465"
FT                   /protein_id="ABO03465.1"
FT                   /translation="MRRFVAVRDDVRRFICYHARAASFHRRFALSLIVDER"
FT   gene            complement(650101..651465)
FT                   /locus_tag="BMA10247_A0699"
FT   CDS_pept        complement(650101..651465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0699"
FT                   /product="oxidoreductase, FAD/FMN-binding protein"
FT                   /note="identified by match to protein family HMM PF00724"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01758"
FT                   /protein_id="ABO01758.1"
FT                   /translation="MDFRSSTQPERHAMPDSNPTAAALLAQPLTLPNGTVLKNRLAKSA
FT                   LSEALCGHGGRVTPQLIALYRRWSGSGAGLLVTGNVMIDGKALGEPGNVVIEDDRDLPR
FT                   LREWAAAAKAHGSEIWMQINHPGKQAMRGLNEETVAPSAIGFGPKLSPYFAVPRALTVD
FT                   EIDALIRRYGTTAAVAQQAGFTGVQLHGAHGYLINQFLSPQHNQRTDEWGGSAENRRRF
FT                   VLAVYAEVRRRVGPDFPIGIKLNSADFQRGGFTEEESLDVIRALAEAGIDLIEISGGTY
FT                   ETPVMQLGDRKASTIAREAYFLAFAEKVRADVKVPLMVTGGFRSLAGMEAPLRDGALDL
FT                   IGLGRILAIEPDAPARLLRGEETRHRVKPLSTGVKYFDSLGSLEVTWYTRQLHRIGKGR
FT                   NPIPDENALKSFLLDLSSKGCAIFKTRRLRASSSEASAARGSATSVAGGPRHDAH"
FT   gene            complement(651759..652367)
FT                   /gene="bpmI"
FT                   /locus_tag="BMA10247_A0700"
FT   CDS_pept        complement(651759..652367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bpmI"
FT                   /locus_tag="BMA10247_A0700"
FT                   /product="acyl-homoserine-lactone synthase BpmI"
FT                   /EC_number="2.3.1.184"
FT                   /note="identified by similarity to GB:CAH39043.1; match to
FT                   protein family HMM PF00765"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02711"
FT                   /protein_id="ABO02711.1"
FT                   /translation="MSYIIAGRLNELPPHVQTDLGAYRYDVFVRRLGWTIAGHSLDEHA
FT                   EWDEFDGPSTIHVVALDDAREICGYARLLPTTGPYLLRDVFAHLLGSSPAPQSPAVWEM
FT                   SRFAASRRRRSATEREPLGMAFFPSVLTVAASLGATRVVGVMTPSIERLYRRSGIALHR
FT                   LGNAMPGAGGSLSACSIDLPRLAFAPLGLKQCAACLAMH"
FT   gene            652476..652655
FT                   /locus_tag="BMA10247_A0701"
FT   CDS_pept        652476..652655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0701"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02016"
FT                   /protein_id="ABO02016.1"
FT                   /translation="MRDTKARRYGNARAARPRREARRGRAAAFGAQAGAQACAASIGSP
FT                   MQAAGCIASARGGG"
FT   gene            complement(652693..653385)
FT                   /gene="bmpR"
FT                   /locus_tag="BMA10247_A0702"
FT   CDS_pept        complement(652693..653385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bmpR"
FT                   /locus_tag="BMA10247_A0702"
FT                   /product="autoinducer-binding transcriptional regulator
FT                   BmpR"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF03472; match to protein
FT                   family HMM PF04967"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02870"
FT                   /protein_id="ABO02870.1"
FT                   /translation="MLSAALPESRDVRTLVETFRQAALQIGYQHHAIVELSGASHPASI
FT                   DVVSLHYPSEWVEHYTRNDYFAIDPVHRAAFRYSTPFSWNDVATANLRERHLLMEAEDA
FT                   GLDNGISIPLHQPLGRVLLVSLSGTAPTHDADAKWRNAYLLGMQFNLQFQSMRTCRPIP
FT                   PSVHLTDREQMCLTWVARGKSSWVIANMLDISKYTVDFHIENAMEKLNTRSRTFAAVKA
FT                   TRQGLIFP"
FT   gene            653559..653828
FT                   /locus_tag="BMA10247_A0703"
FT   CDS_pept        653559..653828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0703"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02167"
FT                   /protein_id="ABO02167.1"
FT                   /translation="MTLKLSANNIKCNNDCKSGVRIIEIHLAMAFDIFIPALRVFFAVC
FT                   NDPIGKATGRGQIDTAIGILNRCCDAIGKFISFSSEPIFCADRE"
FT   gene            complement(653880..654080)
FT                   /locus_tag="BMA10247_A0704"
FT   CDS_pept        complement(653880..654080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0704"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01971"
FT                   /protein_id="ABO01971.1"
FT                   /translation="MPGAPGGAALRTRALGHRGSGRRRARRFGPSRGRRRLAFRHEYIR
FT                   APFLDEKQEFTAHLIRRNPAE"
FT   gene            complement(654153..655760)
FT                   /locus_tag="BMA10247_A0705"
FT   CDS_pept        complement(654153..655760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0705"
FT                   /product="AMP-binding enzyme domain protein"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR03098"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02495"
FT                   /protein_id="ABO02495.1"
FT                   /translation="MRNFFDLVEQAACRTPDAEALVAGDARLTYRALAALGLAFAERLQ
FT                   ALEIAQGERLAIFLDKRIETVVAMLGAAAAGVVFVPINPVLKPEQVHHILVDSGARCLV
FT                   TSSLRARILGDGVLAGMPYVILTDAKTLAPAPASRTTFLRWMQPDAPPESVANRHASAA
FT                   PEPRADTIDADLAALLYTSGSTGRPKGVMLSHRNLLEGAWSVAQYLRHTAQDRILAALP
FT                   LSFDAGLSQLTTAWAAGASAVLVNYLMPADVVEICVRERITGFAGVPPLWIQLARAAWP
FT                   GEARARLRYFANTGGHLPRPVLHALRELFPSASPYLMYGLTEAFRSTYLDPAEVDRRPD
FT                   SIGKAVPNARILVVREDGAPCAPNEVGELVHVGACVTLGYWNDPARTALRYRPSPEAKP
FT                   GGAPRETAVWSGDLVRRDDDGFLYFVARNDAQIKSSGYRISPEEIEEVAHASGLVAEAV
FT                   ALGVPHDELGESITLVVVPLDADTFRPDALRARCAQQLPPYMVPHTIATRTSLPRNPNG
FT                   KFDRVALRADAANLVETL"
FT   gene            655821..655967
FT                   /locus_tag="BMA10247_A0706"
FT   CDS_pept        655821..655967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0706"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03035"
FT                   /protein_id="ABO03035.1"
FT                   /translation="MANDRRANAADPGCRKSSEWTRRAVAAHRCKWPNGVVPNIDGCGR
FT                   APR"
FT   gene            complement(656022..656276)
FT                   /locus_tag="BMA10247_A0707"
FT   CDS_pept        complement(656022..656276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0707"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03562"
FT                   /protein_id="ABO03562.1"
FT                   /translation="MRTRTHACGARPPERIAIVAHTSIRREACISRRHGKTRRDTGSLQ
FT                   AMRARLGACRSTCDAFARATHATELKDRVRAHGEIHQDN"
FT   gene            complement(656340..657122)
FT                   /locus_tag="BMA10247_A0708"
FT   CDS_pept        complement(656340..657122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0708"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02682"
FT                   /protein_id="ABO02682.1"
FT                   /translation="MNTLSEPRAPAARAHDETASGAAREAALARRIDALPWASIERDLE
FT                   RDGHAIVHGLLAPRTCEALAALYARDALFRSRVTMARHGFGRGEYQYFGYPLPRAVHAL
FT                   RTALYPHLAPIANRWHAQMRIDARFPAEHAHFIERCRAAGQLRPTPLLLRYREGDYNCL
FT                   HQDLYGEHVFPLQAAVLLSKPGADFAGGEFVITEQRPRMQSRADVVPLEQGDAVVFAVH
FT                   HRPVQGARGVYRVNLRHGVSRVRSGQRHTLGIIFHDAP"
FT   gene            complement(657272..658858)
FT                   /locus_tag="BMA10247_A0709"
FT   CDS_pept        complement(657272..658858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0709"
FT                   /product="phosphate transporter family protein"
FT                   /note="identified by match to protein family HMM PF01384"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02122"
FT                   /protein_id="ABO02122.1"
FT                   /translation="MNPLLSAAASEELGRTRHLGVALLVALLAAGVAYVFVHLFADLAP
FT                   VGPRSAFPYLLLGVALAIALGFEFVNGFHDTANAVATVIYTHSLTPNVAVIWSGLWNFL
FT                   GVMASTGAVAFGILQLLPVELILQVGHGAGFAMVFALLIAAIAWNLATWYFGLPSSSSH
FT                   TLIGSIIGVGLANQLMHGPSGTSGVDWAQAAGVGQSLLLSPLVGFLCAALLLAALKALV
FT                   RVPALYREPQTNEPPPFWVRCLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYA
FT                   LNKAVTPGETQTFIAVAHRASETLARYAGAAQPSPNPRADVEAYVQSRRLSDATLPAVR
FT                   RLSDALAAEVGATGSIAKVPEGQADNVRNTMYLVSEALRLMEKTGRPAFSPADRLALDD
FT                   YRRQLDHATKFIPTWVKVAVAIALGLGTMVGWRRIVVTVGEKIGKQHLTYGQGASAEVV
FT                   AMLTIGAADAYGLPVSTTHVLSSGVAGTMAANGSGLQWSTVRSLVLAWVLTLPASIVLA
FT                   GALYWAFHALT"
FT   gene            complement(659252..659968)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0710"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF08327"
FT   gene            complement(660020..660484)
FT                   /locus_tag="BMA10247_A0711"
FT   CDS_pept        complement(660020..660484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0711"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03838"
FT                   /protein_id="ABO03838.1"
FT                   /translation="MIELDKTDRAILAAVQLDGRIPVARLADSVGLSETPCARRLKRLE
FT                   SDGYIERYRAQLSRNALGFGVVAFVLLRCSVHDRSVANRFEREVLGIPRILSCHNVSGS
FT                   ADYLLQVVAHDLDDYGTFLRETLRVLPGVTSIESALSLREVKREAELPIP"
FT   gene            660618..661232
FT                   /locus_tag="BMA10247_A0712"
FT   CDS_pept        660618..661232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0712"
FT                   /product="translocator protein, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02929"
FT                   /protein_id="ABO02929.1"
FT                   /translation="MFSAHLLLVYVAAVVAVYAVPGPDMAFVLQTGIGRGARHGAAAAA
FT                   GLGLARAVHVTLSACGVAALLKSAPWLYEAVRYGGALYLAYVAVQIFRSPALALSAADA
FT                   AAPAARLRHTFVKGLLTNLLNPKALLFCSVLLPQFVQRGGAPVIAQMAVLVLAGLCFDL
FT                   ACVAGATRIAEWLRAHPLAQLAQRWTFSAVLLGFALRLSID"
FT   gene            661663..663252
FT                   /locus_tag="BMA10247_A0713"
FT   CDS_pept        661663..663252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0713"
FT                   /product="serine protease, kumamolysin"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF09286"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02505"
FT                   /protein_id="ABO02505.1"
FT                   /translation="MARHLHAGNESHLVAESTCIGPCDPAETIHVVVMLRRQQEQHLDS
FT                   LLQGLASGDPGVKPVSREAFAQRFGAHPDDVMKVEAFAQQRGLAVARVDPVESLVVLSG
FT                   TIAQFEAAFGVKLERFEHRSIGQYRGRTGDITLPDELHGIVTAVLGLDDRPQARPHFRL
FT                   RPTFLPARAPAVTYTPPQLAALYDFPPGDGAGQCIAIVELGGGYRPAEIQQYFGGLGLA
FT                   RQPKLVDVSVGAGRNAPTGDPSGPDGEVALDIEIAGAIAPGATIAVYFAQNSDAGFIQA
FT                   VNQAVHDTTNRPSVVSISWGAAEANWTSQSIQAFDSVLQSAAALGVTVCAASGDDGSND
FT                   GLQDGTNHVDFPASSPYVLACGGTRLDALPGQGIRSEVVWNDEAAGGGATGGGVSAVFD
FT                   VPQWQSGLSATLAQGGGASPLAKRGVPDVAGDVSPATGYEVFVAGTSTVMGGTSAVAPL
FT                   WAALVARINAAAGSPAGWINPKLYRNAGALHDISVGDNGAYAATPGWDACTGLGSPDGA
FT                   KVAAALKGGAAG"
FT   gene            663275..663859
FT                   /locus_tag="BMA10247_A0714"
FT   CDS_pept        663275..663859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0714"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0714"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02749"
FT                   /protein_id="ABO02749.1"
FT                   /translation="MRGGLHAAPGRRRGRGRAHRMRRRAGCGVAALDVGGGCRDSDGAN
FT                   GANGANGANGANGANGANGANGANGANGANGANGANGANGTNGTNGTNGTNGTNGAAGA
FT                   DTGRGGSVALAHRERRAAAGGGAIFATAATGPSNGRHATDEGNRRRQPTKARDACRAPS
FT                   PRERRGDDGFESPARRMRRGRRRNGASRPLR"
FT   gene            663887..664030
FT                   /locus_tag="BMA10247_A0715"
FT   CDS_pept        663887..664030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0715"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02375"
FT                   /protein_id="ABO02375.1"
FT                   /translation="MREAGPKPARRDSPQRQRRARPVSAANGLARLTIRSCTLNRTEGA
FT                   AR"
FT   gene            664027..665691
FT                   /locus_tag="BMA10247_A0716"
FT   CDS_pept        664027..665691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0716"
FT                   /product="serine carboxypeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00450"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02143"
FT                   /protein_id="ABO02143.1"
FT                   /translation="MSIDSTSSGGAQPLHHGANGSVHAPPPVIVAPKDDGDQPFFDPVA
FT                   YGNGPDDSVTDTTEAAAITHHTVRIDGRTIAYTAAAGHLVTVDPSSSQPDAKIFYVAFT
FT                   QDGQQEQTRPVTFFYNGGPGSSAVFVLLGSFAPRRIRTSMPSFTPPAPYRMEDNPDSLL
FT                   DKSDLVFINPVGTGYSAAIAPRKNRDFWGVDQDANSIKQFIKRYLTKHNRWNSPKYLFG
FT                   ESYGTARSCVLAYKLHEDGVDLNGITLQSSILDYRQAGNPVGALPTAAADAWYHKRLGV
FT                   APTPTDLGAFVEEVAQFARTDYLGALRKFPQADAAVVKKLSDYTGIDTTTLLSWSLDIA
FT                   GYDARGNALFLTTLLKAQGLALGAYDGRVTGIESGIAGRIDPNSGGNDPTMTAVSGVYT
FT                   AMWNTYLNEQLKYTSNSSFTDLNDQAFKYWDFGHIDPTGEQQGVDAKGNVILYTAGDLA
FT                   ATMALNVDLKVLSANGLYDFVTPFYQTVLDLQQMPLEDPKVRQNLSARFYPSGHMVYLD
FT                   GGSRTTLKHDLAQMYESTVRDTAAVMRIRALQEKKRA"
FT   gene            complement(665815..667158)
FT                   /locus_tag="BMA10247_A0717"
FT   CDS_pept        complement(665815..667158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0717"
FT                   /product="dehydrogenase, FMN-dependent family"
FT                   /note="identified by match to protein family HMM PF01070"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03446"
FT                   /protein_id="ABO03446.1"
FT                   /translation="MSVGVAMIIRFYRTISFEDYRFLSMWQLHRMAASRQESPTMSTVT
FT                   SSPIVEASRPAASAAATPRALRGVLSLHDFEARARRALPRPIFGYVGGAAEDNRTRDDN
FT                   RAAFDEYGFVTRVLRDVSQRQQGVELFGRRYASPFGIAPMGINALSTYRGDIVLARAAQ
FT                   HAGIASIMSGSSLIPLEDVAAAAPDTWFQAYLPGDAGRIRALVERVARAGYRTLVVTVD
FT                   IPVSANRENNVRSGFSTPLRPSPRLFWDGLTRPRWLLGTFARTLLAHGMPHFENSFATR
FT                   GAPILSANVLRDFSARDHLSWAHVRQIREQWAGELVIKGVLSVEDARIAREAGADGIIL
FT                   SNHGGRQLDGAVSPMRILRDVVQAVGNGYPVMIDSGFRRGSDVLKAVALGARMVFVGRP
FT                   FNYAAAVAGEAGVAHAIRLLREEVDRNLAMLGANGCDALTPDMLIRKR"
FT   gene            667139..668026
FT                   /locus_tag="BMA10247_A0718"
FT   CDS_pept        667139..668026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0718"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0718"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03204"
FT                   /protein_id="ABO03204.1"
FT                   /translation="MATPTLKQLDAFYWAATCANFSTAAQRLHLSISSLSKRINELEQA
FT                   VGRTLFDRSGHRAVLTEDGVALLPAAVRVLESVAALQDAFAGEKGLSGRLRFGVGELSA
FT                   LTWLARFVAAVQTLHPQLSLEPYVDVGAALEEKVDAGELDFAVIAGRSSRGSILSQPVA
FT                   EARFAWMAAEKLVGGERALTPGLLARHALVILPSGSGVTRILDEWLLACGINHPRRIAC
FT                   NHWSAVAGMLREGVGIGFLPADWADARAGGGLVQLTSEPPLSPLHYAFQWRRGDMRGLI
FT                   PSMLALVRQHADFR"
FT   gene            complement(668387..669706)
FT                   /locus_tag="BMA10247_A0719"
FT   CDS_pept        complement(668387..669706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0719"
FT                   /product="MFS transporter, metabolite:H+ symporter (MHS)
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03926"
FT                   /protein_id="ABO03926.1"
FT                   /translation="MSQVRSLATAPHCPPAGTLARLRSIFSGSVGNLIEYYDWYVYSAF
FT                   SLYFAKVFFPSGSQTVQLLNTAAIFAVGFVMRPIGGWLVGLYADRKGRKAALLVSVLAM
FT                   CAGSLIIGLTPGYGSIGIAAPVLLVLARLLQGLSLGGEYASSATYLSEMADKTNRGFYS
FT                   SFLFATLSLGQLLAMAVLVALQQFFLSAAQLESWGWRIPFLIGSLAAGVAIFLRRNMEE
FT                   TESFEQHRQSRRSRTSVAELFRHKRACLIVAGLTLGGTVAFYAYTTYMQKFLVNSAGMS
FT                   KADASMVSVASLIAFVLMQPVFGSLSDRVGRRPLLIAFGVLGTLCTVPIFSALTTVRTM
FT                   GGALALISAALLIVSLYSSVSAVAKAELFPVEIRALGVGLPYAITVSLFGGTAEYIALW
FT                   TKSIGHETWFFWYVSGCVLVSLLCYLWMPDPKTVSCIDRD"
FT   gene            669734..669946
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0720"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            complement(670270..670728)
FT                   /locus_tag="BMA10247_A0721"
FT   CDS_pept        complement(670270..670728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0721"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03390"
FT                   /protein_id="ABO03390.1"
FT                   /translation="MAIEVVELHHVGFRVAPEQADAMLDFYRDVLSLPLDRTRWKIPGI
FT                   YGSWIDLPNGTQLHILGSDAPSRYAKGPGQDPVSNHIALAVEDVRAAEQALVARGIGYF
FT                   TLENIASPNLKQLFLHDPAGNLVELHQADARRPGITQADRQAPPAGNE"
FT   gene            670905..671543
FT                   /locus_tag="BMA10247_A0722"
FT   CDS_pept        670905..671543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0722"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0722"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01807"
FT                   /protein_id="ABO01807.1"
FT                   /translation="MTQRKAAARPPRQPDKRDAPRRAERESPRDAHRATSQARADDDAG
FT                   GPALAMQPHLALMKKTARRHTNQANAGAGLLLLWLADDIERRVNVPLTELGLSESKLGV
FT                   LMFFGLVERGLVDGKVVTPSYMAEYFGVTRSTVTGLLDWLEKRDLLARALSADDRRSFS
FT                   LALTDAGRALLERALPVFWDSCEALVACLDETERAALQRILAKVWRHLK"
FT   gene            671687..672160
FT                   /locus_tag="BMA10247_A0723"
FT   CDS_pept        671687..672160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0723"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0723"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02324"
FT                   /protein_id="ABO02324.1"
FT                   /translation="MRRDRARASARVGANVAGRVPRWSTRGVRDCVGRASREGGRARSV
FT                   AAFARTSAQARRGAALGAAVSEFGSPPRSTLVSRTKARPGARRRVAAGSIAAARNSRTI
FT                   RRRRLEPLRDAVISISSLSCPFAIVISVVACHALHTDGRRARKRIDAVRAGAR"
FT   gene            complement(672649..674346)
FT                   /locus_tag="BMA10247_A0724"
FT   CDS_pept        complement(672649..674346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0724"
FT                   /product="thermolysin metallopeptidase"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01447;
FT                   match to protein family HMM PF02868; match to protein
FT                   family HMM PF07504"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0724"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02250"
FT                   /protein_id="ABO02250.1"
FT                   /translation="MKKLSCLLSVTAISLACLSAFAQADDPPAAADRALQLIRQNPSAF
FT                   HLAAGSAARTLKFAGAQAKAPADGDQFQVRDVIVDADGTEHVRFDRFYAGLPVIGGDVV
FT                   VHSNQGQLKQASLTQPAPIDLAGKIGKVGERFVVRNAPDVGADAARRVASKRFGADVRR
FT                   VDGADLVVFARDAAPTLAYAVRVYGKATDAHGEAVIYYVDARTGNVLDAQDLIKTASVT
FT                   GTGRSLYYGNLSLTTDQTGTNAYRMLDPTRGSGSVYDGRGLSSDEVEQASDLPIFTSST
FT                   NVWGNNTTSDRQTVAADIDYGLALTWDYYKTTHNRNGIFNDGRGVRSYAHVVFDTGSGT
FT                   TGANAAWLSSRVMVYGDGEPGTRLPKPVVSVDVAGHEMSHGVTEATSNLYYSGDAGGLN
FT                   ESTSDIFGTLVKYYANNPNDPGNYVIGARITSGGLRKMYKQDLDGRSYSCYPSGGFSWA
FT                   NPRHDPHYTSGVGNRFFYLLAEGPVAPSTDTGLSRSQLVCNGDTGFSGLGRDKAGKIWY
FT                   RTLTVYLTTNSSYPGARRASIQAANDLYGVNSLESATVARAWSAAGVN"
FT   gene            complement(674904..675374)
FT                   /locus_tag="BMA10247_A0725"
FT   CDS_pept        complement(674904..675374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0725"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03282"
FT                   /protein_id="ABO03282.1"
FT                   /translation="MHLGALSSRLASHRAAALGLRPSRGARRPLRGHIGERRAPSCNAL
FT                   AFAAAMRRINRCSRCSRPRRAIPTASSTSPPSSGTSHSGARGRRVRGGFVSKQPRRGAR
FT                   VIASIFALAGRGTADHRTGPPRRRDAHRDSARGSSSDRAAIAPPSAPPAAIA"
FT   gene            complement(675356..675793)
FT                   /locus_tag="BMA10247_A0726"
FT   CDS_pept        complement(675356..675793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0726"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0726"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03654"
FT                   /protein_id="ABO03654.1"
FT                   /translation="MALSGWTAWYVTVGAYRDLPGGKCVIRQPRFVLNKDGVTRQAMLS
FT                   TSFWLDVHRVHVSGCFEHEKVNLSIDRSGSLQTLFRGDGSLLCRVNHVAYTARDSAAAH
FT                   PLPSALPDVGDEIDLRFRKLASNAWIVETGDDRVGMCISEP"
FT   gene            complement(675808..676779)
FT                   /locus_tag="BMA10247_A0727"
FT   CDS_pept        complement(675808..676779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0727"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02106"
FT                   /protein_id="ABO02106.1"
FT                   /translation="MGRFASPSNDFSNSEKRHILSKYQIDGSVVFDSQAMTLSRGDIVT
FT                   TLTANETELLCILMQGTASKQAVIEQIWESKGLFVTEGSYHQLVRALRVKLDEQGIPPT
FT                   QVKTLPRLGLRFLGFAELLDASPPSPDAHAASASPASSEPEPAAAPAGAQAALAEAIAP
FT                   SVPIAPRASSAPDTANTVTAPIAAAAPPPSAAPSAPPPGAASAPLPATRAAHARSPRRR
FT                   AAYLAIYVTLAAWASVLTWQTFRHRDNTFRFRFTRTVDGIHYFSDGRMNQPNLLKAIDV
FT                   KPLKGSFVYEIELGSNDWLAVCPESIYETPELCQAYFFEKNN"
FT   gene            complement(677058..677249)
FT                   /locus_tag="BMA10247_A0728"
FT   CDS_pept        complement(677058..677249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0728"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0728"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01613"
FT                   /protein_id="ABO01613.1"
FT                   /translation="MPRLLPIGGGASTPKRMLAMPARPPADFGGGARRARSALFQRISQ
FT                   LKSCNSHTEFRRRASRIV"
FT   gene            677200..677364
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0729"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            complement(677605..677805)
FT                   /locus_tag="BMA10247_A0730"
FT   CDS_pept        complement(677605..677805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01772"
FT                   /protein_id="ABO01772.1"
FT                   /translation="MTPLPTATHTQTDAADRSTGREPPKPPASLDEIMRQWLINDFKQK
FT                   VMFPDPDDPSACPTFDGNGSW"
FT   gene            complement(677768..678562)
FT                   /locus_tag="BMA10247_A0731"
FT   CDS_pept        complement(677768..678562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0731"
FT                   /product="type III secretion apparatus protein, HrpE/YscL
FT                   family"
FT                   /note="identified by match to protein family HMM TIGR02499"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0731"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02426"
FT                   /protein_id="ABO02426.1"
FT                   /translation="MRSSNLRQFPDTLAPLGGVLLKRAPLSQAARAERLLDEARRRAQR
FT                   LVRDAEREADACRAHAATAGYEAGFARAIAELAAGVERIDAQRATLLERVVDDVRRSLE
FT                   HLLDDPDLLLRIVNALASRRACATDRPLRVSVPPHAKRIAPAIRERLNDAYPSAQVVVA
FT                   DTRTFVVESGEDILEFDPRAVARALGDAALAACRAAAATAATAADGALARRAALDAPHP
FT                   LERGTAHGAAAIDDDRPRASLDTSTAQEPCDDPAANRDAHAD"
FT   gene            complement(678531..679133)
FT                   /gene="orgA"
FT                   /locus_tag="BMA10247_A0732"
FT   CDS_pept        complement(678531..679133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orgA"
FT                   /locus_tag="BMA10247_A0732"
FT                   /product="type III secretion apparatus protein OrgA/MxiK"
FT                   /note="identified by match to protein family HMM PF09482;
FT                   match to protein family HMM TIGR02555"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03199"
FT                   /protein_id="ABO03199.1"
FT                   /translation="MGAAPMNPLALMRVMYGPLGYAHPDHRTIAGVDLARMPADVANQW
FT                   LIDHHRLDTAIDFDWRDAPRAAPCVDHWARLPRIAYLIGVQRLRAALVERGRYVRLDAS
FT                   SQRFLCMPLAAVPKAACAGMPDDDAIVAAGTACLTAALHDAPRALRQRLPLLFPRAHAA
FT                   RLASGLDGAHDDARAAWSSSLFSFAVNHALLEPAPVS"
FT   gene            complement(679115..680065)
FT                   /gene="basJ"
FT                   /locus_tag="BMA10247_A0733"
FT   CDS_pept        complement(679115..680065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="basJ"
FT                   /locus_tag="BMA10247_A0733"
FT                   /product="type III secretion system BasJ"
FT                   /note="identified by match to protein family HMM PF01514;
FT                   match to protein family HMM TIGR02544"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0733"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03737"
FT                   /protein_id="ABO03737.1"
FT                   /translation="MKRFVSFSLLPALLLLAACNQQELLKNLTEQQANDVVAVLQAHDL
FT                   AVRKEDLGKTGYAVSVEQADFPTAVDLLRQYNLPSQARVQIAQAFPADSLVASPQAEQA
FT                   RLLSAVEQRLEQNLAALQNVVSARVQVSYPLKPSDSGKPDARMHVAALLTYRNDVNADI
FT                   LVSEVKRFVKNSFTNIDYDDISVILYRAPSLFRGAPTMPASHAGGAWLAWLAAIPVALA
FT                   AAAAGGLAYLRRRRAGGPDTPARAAPRAEPAAPAGPDARETTEVPPPGDAFDISDASDA
FT                   FDASGTSASPGASAADAAAADAPGASRGAPWEPRR"
FT   gene            complement(680070..680372)
FT                   /pseudo
FT                   /gene="bsaK"
FT                   /locus_tag="BMA10247_A0734"
FT                   /note="type III secretion system protein BsaK; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            complement(680427..680696)
FT                   /gene="bsaL"
FT                   /locus_tag="BMA10247_A0735"
FT   CDS_pept        complement(680427..680696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaL"
FT                   /locus_tag="BMA10247_A0735"
FT                   /product="type III secretion system protein BsaL"
FT                   /note="identified by match to protein family HMM PF09392;
FT                   match to protein family HMM TIGR02105"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0735"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01609"
FT                   /protein_id="ABO01609.1"
FT                   /translation="MSNPPTPLLTDYEWSGYLTGIGRAFDDGVKDLNKQLQDAQANLTK
FT                   NPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSIVSNFR"
FT   gene            complement(680693..681979)
FT                   /gene="eprH"
FT                   /locus_tag="BMA10247_A0736"
FT   CDS_pept        complement(680693..681979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eprH"
FT                   /locus_tag="BMA10247_A0736"
FT                   /product="type III secretion apparatus protein PrgH/EprH"
FT                   /note="identified by similarity to SP:P41783; match to
FT                   protein family HMM PF09480; match to protein family HMM
FT                   TIGR02554"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0736"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02452"
FT                   /protein_id="ABO02452.1"
FT                   /translation="MNKPDSGLEALQLRILFGPLFGSDIAIPSGEVFFCVGEQVIDDRP
FT                   AEHPENRAGHLLERAVDTLYIPHRAGAPNFRLRFPGAPTQAARTAETGEAASGDFEVDF
FT                   LSADGCVTQRAAFNTVCRFGDLAFALRRQREPWSEAVMHYAPHAPSRAADAAEPGAPGE
FT                   PGDGGERASRFALKLGALLVAGVALAALAYWQVQRYVGAQKLASVNGVLAGAPVPNAIL
FT                   PGDDGRIYVLSASQDGAEWDREALLKAALPEKIEVAVIGAERQRVERRLDEAGVDFVTV
FT                   RLDAPEHPELILTGAAPAAARARAIGELRRAAPYVRDVRVIDASLGAIEQEARNALDKV
FT                   GARYRLLARRGGATFEVASSFGDEELAALQNLMRSFGHKWGTRRVDFKIALRTDWLKGK
FT                   SYREGGDGYVLLDHASWYFPQPLEGAHYR"
FT   gene            682024..682191
FT                   /locus_tag="BMA10247_A0737"
FT   CDS_pept        682024..682191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0737"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0737"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03014"
FT                   /protein_id="ABO03014.1"
FT                   /translation="MYISFSRSPSLPSIVNRIIGFRPKGRIGQDLRRRAGIRLDGRNVP
FT                   PGGVPRHEQA"
FT   gene            complement(682258..682389)
FT                   /locus_tag="BMA10247_A0738"
FT   CDS_pept        complement(682258..682389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0738"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0738"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03107"
FT                   /protein_id="ABO03107.1"
FT                   /translation="MNRFAIAHSSITSAKYSSDISAAFRERRLIRHHIPIKEKFGNL"
FT   gene            682466..683131
FT                   /gene="bsaN"
FT                   /locus_tag="BMA10247_A0739"
FT   CDS_pept        682466..683131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaN"
FT                   /locus_tag="BMA10247_A0739"
FT                   /product="type III secretion system transcriptional
FT                   regulator BsaN"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0739"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03777"
FT                   /protein_id="ABO03777.1"
FT                   /translation="MTEIAKLDVSFGAMSHAVSIDKNKSALVIGIGQFKIASREGAWRF
FT                   HDVPLFEAAKLLAFLESCGAPDGAGREYRAGAPDGAVIDAPGDLSIWKFDRWLIARVMG
FT                   APHGADPLFAFLRAQESYGLVRFLLRERANPQPIAVLAARYGVSEPHFRRLCRQALGRG
FT                   LKRELRQWRAAQAVLEVVESRDSMTEVAMSNGFASSSHFSREIKDLFGISPCRFRRRT"
FT   gene            683145..685022
FT                   /gene="bsaO"
FT                   /locus_tag="BMA10247_A0740"
FT   CDS_pept        683145..685022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaO"
FT                   /locus_tag="BMA10247_A0740"
FT                   /product="type III secretion system protein BsaO"
FT                   /note="identified by match to protein family HMM PF00263;
FT                   match to protein family HMM PF03958; match to protein
FT                   family HMM TIGR02516"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0740"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01639"
FT                   /protein_id="ABO01639.1"
FT                   /translation="MMYADTARRYAAALAASLLMTGAAFAAPTDAAPLADAPAAASATP
FT                   DARDGDASRVAAPPARAPQDDERHFVANDASISVLLNALSGRLHKPIVASEKVRRKHVT
FT                   GEFDLAQPRALLARLGESMSLLWYDDGASIYIYDNSEIKNAVVSMRHATVRNLRNFIRQ
FT                   TRLYDPRFPVRGDDLSNTFYVTGAPVYVNLVAAAARYLDEVRSNEASDRQVVRVVQLHN
FT                   SFVVDRQYTLRDKAVDIPGMATVLGRIFGPARPGAPADSPVAAADATARGGAGGAAGKP
FT                   AFSLADALPAPLDAGNAPGGAGSTHSTNPANAASPMGGAAGGVALPASDGVRAVAYPDT
FT                   NSVILVGRLDKVQDMEALIRSLDVEKRQIELSLWIIDIRKSRLDQLGIDWQGALNAPGI
FT                   GVGFNNRGGNVTTLDGTRFLASVAALSQTGDATVISRPIVLTQENVPATFDSNQTFYAK
FT                   LIGERTVQLDHVTYGTLVNVLPRLTRDGSQVEMIVDIEDGNTDGATSDGQIVIDNNTMP
FT                   LVNRTEINTVARVPHEMSLLIGGNTRDDVTRRTFRIPGLASIPLIGGLFRGHSDRHEQV
FT                   VRVFLIQPKLLRAGAAWPDGQPWESGDPADNATLRATVQMLKPYMDDKS"
FT   gene            685019..686140
FT                   /gene="bsaP"
FT                   /locus_tag="BMA10247_A0741"
FT   CDS_pept        685019..686140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaP"
FT                   /locus_tag="BMA10247_A0741"
FT                   /product="type III secretion system protein BsaP"
FT                   /note="identified by match to protein family HMM PF02523;
FT                   match to protein family HMM TIGR02511; match to protein
FT                   family HMM TIGR02568"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0741"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02232"
FT                   /protein_id="ABO02232.1"
FT                   /translation="MSSIIGGASAARRGFSIDGTGSAANRLDAEPSLDDAPQTGAAGAA
FT                   DVQAQLAGVDEEAANAAAQFGRFRASERKGRRSDELERILDTDADEKLDELAALLGGRA
FT                   ARGRADLATLLRDARERFRDESDLLLALRELRRRRRLDGESVDALERAIDELLAGDGAK
FT                   RIKAGINAALKAKVFGARMQLDARRLRELYRQFLEFDGSHLVIYEDWIEQFGASRRKRI
FT                   LDYVSAALSYDMQSHDPSCGCAAEFGPLLGTLHRARMLASADEQFVGRLLDDALARDCG
FT                   LTEARALATMLGGLQRPFSVADVLLGTLGDLLEPLAPARRSQLLQLALRAFAGVPIALY
FT                   GDADARRAALGALEELIGATYARERRQARPRAD"
FT   gene            686176..688248
FT                   /gene="bsaQ"
FT                   /locus_tag="BMA10247_A0742"
FT   CDS_pept        686176..688248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaQ"
FT                   /locus_tag="BMA10247_A0742"
FT                   /product="type III secretion system protein BsaQ"
FT                   /note="identified by match to protein family HMM PF00771;
FT                   match to protein family HMM TIGR01399"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0742"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02798"
FT                   /protein_id="ABO02798.1"
FT                   /translation="MLKNLLIKAQARPELIVLCLMVLVIAMLIVPLPPYVLDFLIGLNI
FT                   VTALLVFMGSFYIVNILEFSTFPPILLITTLFRLALSISTSRMILLTAEGGKIITTFGQ
FT                   FVIGDNLVVGFVVFVIVTIVQFIVITKGSERVAEVAARFSLDAMPGKQMSIDADLRAGI
FT                   IDNEGVKARRSALERESQLYGSFDGAMKFIKGDAIAGIVVIFVNLIGGISVGVMQHGMS
FT                   VSDALTTYTILSIGDGLVAQIPALLIAIGAGFVVTRVGGSGNNLGANIVGELFSNPFVL
FT                   VVTAVLALAIGLLPGFPLIVFLLIALALGALYVRREWRKPGEPAREGGLVGKVAGALSG
FT                   GGAAKAADGGAGDVDIDKLIPETVPLMLMVPEAAQPMFEQEGVIGAFRRRAFVDMGLRL
FT                   PDIRVVYSPQVHPREAIVLINEIRAATFAICFDRHRVVGSTLALEGLPVDVVTLPDGAG
FT                   GDAWWVPGAQTDALAKIDVLTRSAIDDLYGQFLAVMLANVSEFFGVQEAKRLLDDMDQK
FT                   YPELIKESYRHISVQRIAEVFQRLLAEKISIRNMKLILESLAQWGPKEKDSILLVEHVR
FT                   AALARYISNRFAAGGKLRALVLSAQFEDAVGKGVRQTSGGAYLNLEPATSEQLLDRLAL
FT                   ELARAGFSQRDMVLLASMEVRRFVKRLIESRFPELEVLSFGEVADSVAIDVLKTI"
FT   gene            688260..688667
FT                   /gene="bsaR"
FT                   /locus_tag="BMA10247_A0743"
FT   CDS_pept        688260..688667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaR"
FT                   /locus_tag="BMA10247_A0743"
FT                   /product="type III secretion system protein BsaR"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0743"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03332"
FT                   /protein_id="ABO03332.1"
FT                   /translation="MNVDVVMLVKESMEKMDCGNAIAGELDAHAPICIAFHSMPEMFVE
FT                   RDGEHVTIWSRLGCAGESQLARCAFDLLAYQLPRGSDAFASRRPLLSFVDDALVLHGRV
FT                   EPRCLADAEGFTEALETFYADLCAVSEILAR"
FT   gene            688664..689974
FT                   /gene="bsaS"
FT                   /locus_tag="BMA10247_A0744"
FT   CDS_pept        688664..689974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaS"
FT                   /locus_tag="BMA10247_A0744"
FT                   /product="type III secretion system protein BsaS"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P39444; match to
FT                   protein family HMM PF00006; match to protein family HMM
FT                   PF02874; match to protein family HMM TIGR01026"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0744"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03024"
FT                   /protein_id="ABO03024.1"
FT                   /translation="MKAAGDPLRLLARRAHPRRIQGPIIEAPLPEVAIGELCAIRAAAG
FT                   SDTTIGRAQVVGFGRDTAILSTLGSTAGLSRQVALVPTGERMTIDVSPALLGAVVDATG
FT                   GIVETFGAPPPPAGAAPGRRAIDAAPPDYAARRPIERRLATGVRAIDGLLACGVGQRFG
FT                   IFAAAGCGKTSLMNMMIEHAAADVYVVALIGERGREVSEFVERMRRSGSRDRTVVVYAT
FT                   SDRSSVDRCNAALVATTIAEYFRDLGCDVMLFLDSMTRYARALRDLALATGEAPARRGY
FT                   PASVFEQLPRLLERPGRTRAGSITAFYTVLLENEEEPDPIGDEIRSIVDGHVYLSRQLG
FT                   AKGHFPAIDVLRSASRLFDEIADAPHRALAKRFRQHLARIDEMQVFLDLGEYRRGENPE
FT                   NDDALDRRPALDAFLQQAVDEASAFGDTLERLSEAAS"
FT   gene            689971..690435
FT                   /gene="bsaT"
FT                   /locus_tag="BMA10247_A0745"
FT   CDS_pept        689971..690435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaT"
FT                   /locus_tag="BMA10247_A0745"
FT                   /product="BsaT protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0745"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02537"
FT                   /protein_id="ABO02537.1"
FT                   /translation="MKRLDGARRLLAVLERRGDALRRQAARERGALAALDARIAERRAA
FT                   IEQLCERLAASVPPRPYARSELMRVRGKQAAIRHAIACQQIEVDDLLERRQAAEQALRD
FT                   SLAAALGLERRRNAHRDWLARRRIETERRRESAAEADITEGAGHGFNHQQ"
FT   gene            690413..691660
FT                   /gene="bsaU"
FT                   /locus_tag="BMA10247_A0746"
FT   CDS_pept        690413..691660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaU"
FT                   /locus_tag="BMA10247_A0746"
FT                   /product="BsaU protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0746"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02019"
FT                   /protein_id="ABO02019.1"
FT                   /translation="MGSTISNSAPIAPIVSGVEPAQQSDAERTSDLQRAYREQCRAALD
FT                   KRDDGRDCDDTEAQRAHARKKTKRNGEPPGAAGGMPAPHAARDRAFALRFGGARLGEAR
FT                   SGANARDARVGAGAEAGIEAGVEVGTDAHAARGGATMRGHAPASGAVRATSERAPAAAT
FT                   ADAHAPQAAAESAPPSVPMPAAHAAPRTSGGSARDIAAAAARICATAADPAAGVVASRS
FT                   PALPAARGPASATAAASAASAMSAMSSTRRPTAAASPGAARERVDGDGDDSNCAGDASL
FT                   AGLPRGVQPQASLRAAEPAARAHDPSRAARQRAQAGAAQADARDVRETQGTQVRYSFNS
FT                   WDGRPAVELRFDAGGAPRVVNAQPSHDRVQRAMEHGADRLSPGWTVEFDRSRADDDSGG
FT                   RSPWRRARQEPEADER"
FT   gene            691657..692664
FT                   /gene="bsaV"
FT                   /locus_tag="BMA10247_A0747"
FT   CDS_pept        691657..692664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaV"
FT                   /locus_tag="BMA10247_A0747"
FT                   /product="type III secretion system protein BsaV"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM TIGR02551"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0747"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03901"
FT                   /protein_id="ABO03901.1"
FT                   /translation="MSARYTLFRRVAPAELPLYRRARALRAAGEHAALRTIAPPRGYAA
FT                   LRATWRGVEHDGWVDLDDLMRRRYPALGALAWRALDRRYALDLLSGRDAAAELPAPPGG
FT                   WAHVRLVDLVERALPAEPLLCFDTPGRARALFRAFPDEAPAARTVADIGGVPLTMRFAI
FT                   GTARLPLALLPAVAPGDVLLVCAPRNVVRIGARALCEFCCEGENIMLNEPLADSAIDAL
FT                   HDASHDASHDTSHDTSHDTSHDEPTAAHAPPAFDIDALPVTLEFVLHDERVTVEQLAGC
FT                   HLGMVLPLRGAPGEVTIRANGRPFGRGELIQVGEQLAVEVKALWRAKPAACDGE"
FT   gene            692654..693334
FT                   /gene="bsaW"
FT                   /locus_tag="BMA10247_A0748"
FT   CDS_pept        692654..693334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaW"
FT                   /locus_tag="BMA10247_A0748"
FT                   /product="type III secretion system protein BsaW"
FT                   /note="identified by match to protein family HMM PF00813;
FT                   match to protein family HMM TIGR01102"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0748"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03398"
FT                   /protein_id="ABO03398.1"
FT                   /translation="MANNEIALIVLLTAATLVPFVVAAGSCFIKFSIVLVLVRNALGIQ
FT                   QVPSNLALNSIALIMSLFVMMPVAQSAYRYLQHHPLDVMSGASVNEFIDGGLGDYKRYL
FT                   TRYSDPELVRFFERAQTARLKGDDADAADADDAPDGLDNSLFSLLPAYALTEIKSAFKI
FT                   GFYLYLPFLVVDMVVSSVLLALGMMMMSPVTISVPIKLILFVAMDGWTLICKGLIEQYL
FT                   NLMQ"
FT   gene            693370..693624
FT                   /gene="bsaX"
FT                   /locus_tag="BMA10247_A0749"
FT   CDS_pept        693370..693624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaX"
FT                   /locus_tag="BMA10247_A0749"
FT                   /product="type III secretion system protein BsaX"
FT                   /note="identified by match to protein family HMM PF01313;
FT                   match to protein family HMM TIGR01403"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0749"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02873"
FT                   /protein_id="ABO02873.1"
FT                   /translation="MAELTYAGDKAILLVILLCAAPVAVATVVGLAIGLFQTVTQLQEQ
FT                   TLPFGLKMLAVFGCLMMLSGWFGGKLLAFATEMLSIGLR"
FT   gene            693670..694413
FT                   /gene="bsaY"
FT                   /locus_tag="BMA10247_A0750"
FT   CDS_pept        693670..694413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaY"
FT                   /locus_tag="BMA10247_A0750"
FT                   /product="type III secretion system protein BsaY"
FT                   /note="identified by match to protein family HMM PF01311;
FT                   match to protein family HMM TIGR01401"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0750"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02490"
FT                   /protein_id="ABO02490.1"
FT                   /translation="MQAFYRHAGAIAIAYARVAPVFYLLPFLNDRTIVNGIVKNTIVFA
FT                   IILGLWPSFAHPPLQGGALAGVALTEAAAGVVLGVALSLPFWVATAVGELIDNQRGATI
FT                   SDSIDPATGVEASALAPFVSLFYAAAFLQQGGMLTIVGALEASYATVPAGALFSVDLPR
FT                   IGALLTDLVAHGLALAAPVLIVMFVTDALLGLFSRFCPQVNAFSLSLTVKSIVAFAVFH
FT                   LYFVYAAPHELTALLRVHPFSSLVK"
FT   gene            694417..695652
FT                   /gene="bsaZ"
FT                   /locus_tag="BMA10247_A0751"
FT   CDS_pept        694417..695652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsaZ"
FT                   /locus_tag="BMA10247_A0751"
FT                   /product="type III secretion system protein BsaZ"
FT                   /note="identified by match to protein family HMM PF01312;
FT                   match to protein family HMM TIGR01404"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0751"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02442"
FT                   /db_xref="GOA:A3MCG6"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MCG6"
FT                   /protein_id="ABO02442.1"
FT                   /translation="MAEKTEKPTAKKLRDAAKKGQTFKARDIVALIVIATGALAAPALV
FT                   DLTRIAAEFVRIASTGAQSNPGAYAFAWAKLFLRIAAPFVLLCAAAGALPSLVQSRFTL
FT                   AVESIRFDLTALDPVKGMKRLFSWRSAKDAVKALLYVGVFALTVRVFADLYHADVFGLF
FT                   RARPALLGHMWIVLTVRLVLLFLLCALPVLILDAAVEYFLYHRELKMDKHEVKQEYKES
FT                   EGNHEIKSKRREIHQELLSEEIKANVEQSDFIVANPTHIAIGVYVNPDIVPIPFVSVRE
FT                   TNARALAVIRHAEACGVPVVRNVALARSIYRNSPRRYSFVSHDDIDGVMRVLIWLGEVE
FT                   AANRGGPPPETRAPTSAEPQARDGVAPLGDACADNAFPDDAPPGAAAPNAGSPDSPAPD
FT                   GGAPARTGDQNA"
FT   gene            695778..696293
FT                   /gene="bicA"
FT                   /locus_tag="BMA10247_A0752"
FT   CDS_pept        695778..696293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bicA"
FT                   /locus_tag="BMA10247_A0752"
FT                   /product="type III secretion chaperone BicA"
FT                   /note="identified by match to protein family HMM PF07720;
FT                   match to protein family HMM TIGR02552"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0752"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03898"
FT                   /protein_id="ABO03898.1"
FT                   /translation="MTQRDVNIDDIEAQEMAAALLDAVQNGATLKDLHQVPQDLMDGIY
FT                   AFAYRFYQQGRLDDAEVFFRFLCIYDFYNAEYAMGLAAVCQLKKEYARAIDLYALAYSL
FT                   SKDDHRPMFHTGQCHLLMGKAALARRCFGIVVERSRDERLAQKAQSYLDGLDEVGADAA
FT                   PASAGNDH"
FT   gene            696312..698174
FT                   /gene="bipB"
FT                   /locus_tag="BMA10247_A0753"
FT   CDS_pept        696312..698174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bipB"
FT                   /locus_tag="BMA10247_A0753"
FT                   /product="BipB protein"
FT                   /note="identified by match to protein family HMM PF03518"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0753"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03246"
FT                   /db_xref="GOA:A3MCG8"
FT                   /db_xref="InterPro:IPR003895"
FT                   /db_xref="InterPro:IPR006972"
FT                   /db_xref="InterPro:IPR032391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MCG8"
FT                   /protein_id="ABO03246.1"
FT                   /translation="MSSGVQGGPAANANAYQTHPLRDAASALGTLSPQAYVDVVSAAQR
FT                   NFLERMSQLASEQCDAQPAAHDARLDDRPALRAPQERDAPPLGASDTGSRASGAAKLTE
FT                   LLGVLMSVISASSLDELKQRSDIWNQMSKAAQDNLSRLSDAFQRATDEAKAAADAAEQA
FT                   AAAAKQAGADAKAADAAVDAAQKRYDDAVKQGLPDDRLQSLKAALEQARQQAGDAHGRA
FT                   DALQADATKKLDAASALATQARACEQQVDDAVNQATQQYGASASLRTPQSPRLSGAAEL
FT                   TAVLGKLQELISSGNVKELESKQKLFTEMQAKREAELQKKSDEYQAQVKKAEEMQKTMG
FT                   CIGKIVGWVITAVSFAAAAFTGGASLALAAVGLALAVGDEISRATTGVSFMDKLMQPVM
FT                   DAILKPLMEMISSLITKALVACGVDQQKAELAGAILGAVVTGVALVAAAFVGASAVKAV
FT                   ASKVIDAMAGQLTKLMDSAIGKMLVQLIEKFSEKSGLQALGSRTATAMTRMRRAIGVEA
FT                   KEDGMLLANRFEKAGTVMNVGNQVSQAAGGIVVGVERAKAMGLLADVKEAMYDIKLLGD
FT                   LLKQAVDAFAEHNRVLAQLMQQMSDAGEMQTSTGKLILRNARAV"
FT   gene            698210..699475
FT                   /gene="bipC"
FT                   /locus_tag="BMA10247_A0754"
FT   CDS_pept        698210..699475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bipC"
FT                   /locus_tag="BMA10247_A0754"
FT                   /product="type III secretion target BipC"
FT                   /note="identified by match to protein family HMM PF09599;
FT                   match to protein family HMM TIGR02101"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0754"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02192"
FT                   /db_xref="GOA:A3MCG9"
FT                   /db_xref="InterPro:IPR005427"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MCG9"
FT                   /protein_id="ABO02192.1"
FT                   /translation="MRMSIGVQSSGINISHAELSRLVDAGKSEQGDKAVRDDGRALARA
FT                   DAALAAVVGERVAARRDAVAGSGAQRVELARPKPDAQTRATDRRTVSGLEREHKRLAAS
FT                   QTPRVTGMHDALVQRHVSLDGAKAAHGEGVKRAAGDAPRAAADAPQRFAFADDKAFDAM
FT                   LALGAAMQKNVQSDLAMQGKLTMLAHDAMMSAAAQDRSIGAAQMTAAIAGGALQATTSL
FT                   GGAMQQMKSLSTKSMSIEKELKPQAELKQFHAEQALELRGINKPVLSNDEVSHVKIKRD
FT                   TGETVRHEIDHGGERMSDEHASVLAQEAPARQHRIDMHGMRHEENLVKAGRQQMKGDLL
FT                   QSGGQIGKNQIDGASAQQQGADRAEQKEDENAQQTAMAAASTRDEAAHRSREAAQKAID
FT                   AAKSQVANDNAVAAQVAGNLRT"
FT   gene            699597..699899
FT                   /locus_tag="BMA10247_A0755"
FT   CDS_pept        699597..699899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0755"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0755"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01778"
FT                   /protein_id="ABO01778.1"
FT                   /translation="MVERMATYKELKARAEALSAQAEAARQAELQAAIEDVRAKVREYG
FT                   LTAYDVFGHRKKPGERHRGAVRPKYRDPATGATWTGRGIEPKWIRGRNRDEFLIE"
FT   gene            699961..700893
FT                   /gene="bipD"
FT                   /locus_tag="BMA10247_A0757"
FT   CDS_pept        699961..700893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bipD"
FT                   /locus_tag="BMA10247_A0757"
FT                   /product="BipD protein"
FT                   /note="identified by match to protein family HMM TIGR02553"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0757"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02884"
FT                   /db_xref="GOA:A3MCH1"
FT                   /db_xref="InterPro:IPR009483"
FT                   /db_xref="InterPro:IPR036708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MCH1"
FT                   /protein_id="ABO02884.1"
FT                   /translation="MNMHVDMGRALTVRDWPALEALAKTMPADAGARAMTDDDLRAAGV
FT                   DRRVPEQKLGAAIDEFASLRLPDRIDGRFVDGRRANLTVFDDARVAVRGHARAQRNLLE
FT                   RLETELLGGTLDTAGDEGGIQPDPILQGLVDVIGQGKSDIDAYATIVEGLTKYFQSVAD
FT                   VMSKLQDYISAKDDKNMKIDGGKIKALIQQVIDHLPTMQLPKGADIARWRKELGDAVSI
FT                   SDSGVVTINPDKLIKMRDSLPPDGTVWDTARYQAWNTAFSGQKDNIQNDVQTLVEKYSH
FT                   QNSNFDNLVKVLSGAISTLTDTAKSYLQI"
FT   gene            complement(700878..701012)
FT                   /locus_tag="BMA10247_A0756"
FT   CDS_pept        complement(700878..701012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0756"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0756"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03253"
FT                   /protein_id="ABO03253.1"
FT                   /translation="MNGRRHGESFPLVGCFGSGQGPRPRASPRRCAAAWARPLVQICR"
FT   gene            700995..703673
FT                   /locus_tag="BMA10247_A0758"
FT   CDS_pept        700995..703673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0758"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0758"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03717"
FT                   /protein_id="ABO03717.1"
FT                   /translation="MPPSIHRTSSINSTPAVTAAGARRASGPGGVLSADVARVASARRH
FT                   TMPEIGARRGVDGDRAAPAPRESFRRRLETVSSRAPTPPEADSRAANARTTGAADGAGA
FT                   TGAAAGPSHGATSLDAARAYLAELAGDRGGALTTLVAQLNGHDRRALDHLALTVHALHL
FT                   SVDDASHAKTFAGIGDALASFLAAAARANAKPGSTPRDLCVEGNKGYRKLCECVGALLR
FT                   SDGIANALFGRARERGDAAADTLVSERLGGRMDGHVRTNGMVNRHGGDAQRRMADAAQR
FT                   FALGARHATNLVDMVGTALELLGRTDQLLNDVSLKRPAAEPGGPRAPGGGPAAPAGPAS
FT                   GAAQQPAAPVVVNNHNENNVNVNLDGLERLVGDLGKMMGALLERMGAYDPSHTRPAAPD
FT                   ANGPAPVRTGGHTTVVKSPVSVARTSNNGAPGSPAADGTRGDAPMPPTTPALPATPATP
FT                   TTPPAGGPSMDERTPATNTLERGAGNGGASPTGAWRRGDDGGWRMARGNPVVRTTEGAT
FT                   RIDPFSRVGARAASGVGAARAWRDAAADATQRSLASGTSGGAADAIAPRAGAGAGAAAG
FT                   GDAARVARRMPDVRAGGPERDAPGERAAGPNGSNGSAVGQPIAGHAPAGGPDAADFSDA
FT                   SGTGGTGARAPGMPPATGSWSRDPASGRWLRAGGGVPLRSTEGFGRIDPFAGVQRNASA
FT                   TGASAVSSPSFASASMSVGSTGALPAGSSIASPDTSGIAPAVASGGALDVASNVASNVA
FT                   SNVTSNVASGVTSGVTSGVTSGVASGVAPDGTAWTRPSALAPRNIDPRRMNRAQLERAG
FT                   LYPLVDDALPPSSQSAPADAGDAGDAGDAAARRASRPDTGAPQPGAAKTFPSVAPAHRI
FT                   VTTEGAARVGWNDSIANGTKR"
FT   gene            703670..703951
FT                   /gene="acpP-1"
FT                   /locus_tag="BMA10247_A0759"
FT   CDS_pept        703670..703951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP-1"
FT                   /locus_tag="BMA10247_A0759"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0759"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03191"
FT                   /protein_id="ABO03191.1"
FT                   /translation="MTAGPHLSDAAALAAAKTLLAGMLGVPEAQIAPPQRLLDDLAMDS
FT                   LELIELAMELDERWNIRLDRARFAEVATVADVAALLGAAARADDSGGA"
FT   gene            703948..704511
FT                   /gene="bapC"
FT                   /locus_tag="BMA10247_A0760"
FT   CDS_pept        703948..704511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bapC"
FT                   /locus_tag="BMA10247_A0760"
FT                   /product="BapC protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0760"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03702"
FT                   /protein_id="ABO03702.1"
FT                   /translation="MSARRAEAARPRGYAARIARVAAAFAIGIVSAGGVAHADCIDDAA
FT                   RRYGVNADLLRSIAYYESGLNPRALHRNGDGSTDIGLMQINSVHLPALRDQGIDRLRLY
FT                   DASINARVGAALLRRQIDQYGDTWRAVGAYHSRTPGLSERYARAVHDVYVARPWAAKAA
FT                   ARRDAAHTMPARAPGLVIEEASVQ"
FT   gene            complement(705052..705837)
FT                   /gene="bopE"
FT                   /locus_tag="BMA10247_A0761"
FT   CDS_pept        complement(705052..705837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bopE"
FT                   /locus_tag="BMA10247_A0761"
FT                   /product="type III secretion target BopE"
FT                   /note="identified by match to protein family HMM PF07487"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0761"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03206"
FT                   /db_xref="GOA:A3MCH6"
FT                   /db_xref="InterPro:IPR005414"
FT                   /db_xref="InterPro:IPR016019"
FT                   /db_xref="InterPro:IPR035949"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MCH6"
FT                   /protein_id="ABO03206.1"
FT                   /translation="MTYNPRIGGFTHVKQASFDVHVKRGEAQPRTSFAQQIKRIFSKIG
FT                   ETLGQLFRHRAPDSAPGRVRLQGVRYVGSYRPTGDAKQAIRHFVDEAVKQVAHTRTPEI
FT                   RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATRAGNVRPAFIEALGDAARATGLPGADK
FT                   QGVFTPSGAGTNPLYTEIRLRADTLMGAELAARPEYRELQPYARQQAIDLVANALPAER
FT                   SNTLVEFRQTVQTLEATYRRAAQDASRDEKGATNAADGA"
FT   gene            complement(705931..706398)
FT                   /locus_tag="BMA10247_A0762"
FT   CDS_pept        complement(705931..706398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0762"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0762"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02331"
FT                   /protein_id="ABO02331.1"
FT                   /translation="MAAEQAVARRARPANRASVPLGIDVDAEDIHPASLADSAQTATHI
FT                   PAEATSGVASRGGSRAHRLSAYRAPHALAGTCAPRGIGPAPGIATQAAPPIVKRHAADR
FT                   EAPRRPRRFAPTPRGRLSAHAITGGRTRRVPEPPTAHEQFMESEPTARFIE"
FT   gene            706463..708001
FT                   /gene="icsB"
FT                   /locus_tag="BMA10247_A0764"
FT   CDS_pept        706463..708001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icsB"
FT                   /locus_tag="BMA10247_A0764"
FT                   /product="virulence protein IcsB"
FT                   /note="identified by match to protein family HMM PF09119"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0764"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02033"
FT                   /db_xref="GOA:A3MCH8"
FT                   /db_xref="InterPro:IPR011070"
FT                   /db_xref="InterPro:IPR015203"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MCH8"
FT                   /protein_id="ABO02033.1"
FT                   /translation="MINVGAFVASARSGARVVVGGDARGPVVSAARLGMKERLFAFLAH
FT                   VPLLKHCDAVRRYAEQVRMENRRSLEVFVLALSKRYGPEGAKAAFDYGARRDGAPLDQR
FT                   RVRNMVSIAEHFHGTGDAKPLARQMVFRSWECRGLDHPGHASLTIKNQADADAGRHVYE
FT                   HVSWWPNQRLGSKEHFDRIEPKTLDGYRIDKRSEISSATEQRLREGDAARRKILADGFK
FT                   YANQDERHDALFFPRAGQKLDKDAEWGLSARKVYFPAIGFNHDRRDTDRPRAFVLFGLN
FT                   EAAMLRDARTVKEGAKSGELKYRMISKKENCASMALRVLRAGGAEHFVPYTAAWISEDP
FT                   NHAHAYALAVQARIDALNQRRADVERRCERLRDSASVRQAWRAFSEAGGASASPLAEDA
FT                   GRGRASAHMRQARLDEHAREVERIGAYFAELSAGRSGKHRDRADADLADAMKRCAPSAR
FT                   DDVAALTRKASVLVETLGRHLDAPPPSDSSALRRLAAHAMIGRIEAFMAAAIAA"
FT   gene            complement(707976..708119)
FT                   /locus_tag="BMA10247_A0763"
FT   CDS_pept        complement(707976..708119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0763"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0763"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01770"
FT                   /protein_id="ABO01770.1"
FT                   /translation="MGIEAVSNQPRAAARRTAARARRALRSFSMRSSCCLQAVFRRRSQ
FT                   PP"
FT   gene            708153..708608
FT                   /gene="bicP"
FT                   /locus_tag="BMA10247_A0765"
FT   CDS_pept        708153..708608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bicP"
FT                   /locus_tag="BMA10247_A0765"
FT                   /product="type III secretion chaperone BicP"
FT                   /note="identified by match to protein family HMM PF05932"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0765"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02771"
FT                   /protein_id="ABO02771.1"
FT                   /translation="MNTHTEWLNALSEAAGVPLEFDEHGQCFVLLDTQLMISIRDRPDA
FT                   LVLYGMVGEFAEHAPAQCWKRMLAVNLDLSEAGRGGLGLDDETGAVMLIERVATANLGG
FT                   REFVDVFEAFASRVESLIDTFEQAGAYDADARGLPADSHAAARALRG"
FT   gene            708879..709523
FT                   /locus_tag="BMA10247_A0766"
FT   CDS_pept        708879..709523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0766"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196; match to protein
FT                   family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0766"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03108"
FT                   /protein_id="ABO03108.1"
FT                   /translation="MLVVDSHPIVRDGIEVVLGKAYAGIDVDGAADMAEASDRCGRDRP
FT                   DLVLLDVMLPGEDPLPAMGEILRAHPGLRFVVFTALGSEARAADAIRFGASGYLLKWCS
FT                   PDGIVQAIRRVMAGRVHIDPSLDEARVASAAGGRTLASPVDELTRREKQVLKLIADGMR
FT                   NREIASLLNISPKTVDCHRQRLMQKLGARNVATVIHWAYRYGYANACAPAM"
FT   gene            709779..710222
FT                   /locus_tag="BMA10247_A0768"
FT   CDS_pept        709779..710222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0768"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0768"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03331"
FT                   /protein_id="ABO03331.1"
FT                   /translation="MKLNGMTAAQAQHRHGAIERHAPGKDDGRRTAGVADEREGRTMKG
FT                   EIKAIRMDVLKEIRFNSAVSTPVLLAKRNRIAANIREVSEKIDRKGLFGKMFEAVKCVA
FT                   QRGLYYDRRALRKLDAFVVRHIGDRPEDRKFKVLPTRAQRPAP"
FT   gene            complement(710194..710355)
FT                   /locus_tag="BMA10247_A0767"
FT   CDS_pept        complement(710194..710355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0767"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0767"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02645"
FT                   /protein_id="ABO02645.1"
FT                   /translation="MQRIGGRPVRRASRTRPRNEWRAEVPRPPDASRHAGRETRARRAL
FT                   TAPGAAPA"
FT   gene            710354..710545
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0769"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            710682..711674
FT                   /locus_tag="BMA10247_A0770"
FT   CDS_pept        710682..711674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0770"
FT                   /product="transcriptional regulator, araC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0770"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01704"
FT                   /protein_id="ABO01704.1"
FT                   /translation="MAKMHAPRGGTLLQFFSTDDMPLARAAAFWSAHVFQCEDVRASSA
FT                   RAFHGHGFLCRCERGRFVRFRGASLDTRIGAAWLSAAPADAYVTICALHAGECTVEAPG
FT                   LPDVRFRANELFMLDGGQPMRVRWSEPCFSALRLPRASVGRTLGQAAMDASPSAASLQE
FT                   ARLAPFLAAELALIGGRGPTLSSDELDYMLARAAELGRTLLQAALSSRARRGAPARADR
FT                   LQAAYRYIEQHLHLPTLTPERIADAIHCSRTQLYRLFRHESQTVKAALREARLNRSLGY
FT                   LEQPEVTLSIGEIAHACGFPDQSTFGKLFRRRFGRTPGEVRRAARGCSI"
FT   gene            711709..711840
FT                   /locus_tag="BMA10247_A0771"
FT   CDS_pept        711709..711840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0771"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0771"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02387"
FT                   /protein_id="ABO02387.1"
FT                   /translation="MRRVHRRFDDECRFRHFTEASPRFRHDFGATFDKMRRASETVP"
FT   gene            712216..712404
FT                   /locus_tag="BMA10247_A0772"
FT   CDS_pept        712216..712404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0772"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0772"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02814"
FT                   /protein_id="ABO02814.1"
FT                   /translation="MPRSAYRWLRWLRKRGWTCDEIADHTDLSRMGRSTSASGTRSMVR
FT                   RLCATNPVGARGIEVVR"
FT   gene            712356..712508
FT                   /locus_tag="BMA10247_A0773"
FT   CDS_pept        712356..712508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0773"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0773"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03497"
FT                   /protein_id="ABO03497.1"
FT                   /translation="MRDKPGGGEGNRGRALTEQREVDIRALLRGQMPDQLKMSFALWTR
FT                   HAVRE"
FT   gene            complement(712581..712712)
FT                   /locus_tag="BMA10247_A0774"
FT   CDS_pept        complement(712581..712712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0774"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0774"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03809"
FT                   /protein_id="ABO03809.1"
FT                   /translation="MNVESIVDVNRDRLRTGILRFLESEVLKPFIDQGTVDILRRHS"
FT   gene            713047..714540
FT                   /locus_tag="BMA10247_A0775"
FT   CDS_pept        713047..714540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0775"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0775"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02102"
FT                   /protein_id="ABO02102.1"
FT                   /translation="MESFKMPSMTVTRTTSQEQYVPAAGPTTPSTSNVDGRTLTVRPST
FT                   LSTDDLVKAPPEHRAKMAGVRLGIGSAGDRLNFLERNGVMPAEDKVLTAARYAHNVKID
FT                   HKNASNLEFQLNRMRIGEVSLPKQAKPDSMEIRNALDVIPLALPDRNEKYTIPTDKYLM
FT                   NRLSSGAVEQARHHGCEFFCGSGRDEMLNHYAHRGFDRAISISSNTSTKFDLLSNSSNG
FT                   KSLLVLSGMSSTTRIKHQLLQLHFADVDLNRVKLVGDINLLKEKSGDDLRKELSQLPPI
FT                   PSKTLFIGARWQIMESLGKQLFHVGDSAKEGTGYGKLGVKEHKVADFVFDTATLNLDGR
FT                   QHLVAALRMPNGDLAYDAMKGFLDHGFNQVIMCGAGGRLAGDAQVGDYMLLERSQYGDQ
FT                   SISLARECIHVPGAKLFENAKPTSNVTVDSPLQETQRWLDENQETGNVDVETAHILRAL
FT                   TEAGPDVKVLPGLFVSDVVGEHPLEGKIDLPPSIGPMGF"
FT   gene            complement(714551..715384)
FT                   /locus_tag="BMA10247_A0776"
FT   CDS_pept        complement(714551..715384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0776"
FT                   /product="A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0776"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02516"
FT                   /protein_id="ABO02516.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(715408..715671)
FT                   /locus_tag="BMA10247_A0777"
FT   CDS_pept        complement(715408..715671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0777"
FT                   /product="transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0777"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02911"
FT                   /protein_id="ABO02911.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            complement(715880..716026)
FT                   /locus_tag="BMA10247_A0778"
FT   CDS_pept        complement(715880..716026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0778"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0778"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03264"
FT                   /protein_id="ABO03264.1"
FT                   /translation="MKPAPASAGQRVVSSDALLQGQSHVSIAHNGETYQLRATRLGKLI
FT                   LTK"
FT   gene            complement(716287..716772)
FT                   /locus_tag="BMA10247_A0779"
FT   CDS_pept        complement(716287..716772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0779"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08982"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0779"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03495"
FT                   /protein_id="ABO03495.1"
FT                   /translation="MNFEHLIQINAADNPAVPTLTRAQLWEGLVLRAEQPQLFVLGLDS
FT                   CIVHERTETTLERELHYGNATVRDHVTFTPNEQVRYDIHAADGEIGGSLTMTIEERDDQ
FT                   QLFLRFEYRTTLPVSNDSEDARQTQEIVKEAYRTSDIDTVRLIREYAQGRKDPDPLH"
FT   gene            complement(716891..717763)
FT                   /locus_tag="BMA10247_A0780"
FT   CDS_pept        complement(716891..717763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0780"
FT                   /product="pirin domain protein"
FT                   /note="identified by match to protein family HMM PF02678;
FT                   match to protein family HMM PF05726"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0780"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01774"
FT                   /protein_id="ABO01774.1"
FT                   /translation="MTIARSIQRTYPAHRTTEGGGFVVHRPFPTRLLTDFDPFLLLDEM
FT                   GPVDYAPNDAKGAPDHPHRGFETVTYVLEGWFRHRDSAGHAGALGPGDVQWMTAGAGVV
FT                   HSEMPDPEFARRGGRAHAFQLWVNLPRRDKMIAPRYQDIPAARIPSAKSPDGRAKVRVI
FT                   AGEAFGACATIETRTPMLYLHFTLSPGAVVEQPVPAGFRVFAYPFEGGGFYGGDREAVD
FT                   ARHVVVYAEDGDTAVIAAGEAPLDLLLIGGAPLNEPIVRYGPFVMNTEDEIREAVADYQ
FT                   TGRMGRISA"
FT   gene            717865..718857
FT                   /locus_tag="BMA10247_A0781"
FT   CDS_pept        717865..718857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0781"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0781"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02401"
FT                   /protein_id="ABO02401.1"
FT                   /translation="MWNWNDEMTIDAHNLNDLMYFSQVVEHGGFSAAERVLGISKSRLS
FT                   RRLTELEATLGVRLLQRSTRKLALTEAGQLFYQHCQAMLSEAQAAMNAVQQLRSAPRGT
FT                   VRVSVPVTVSQTMLSRLLLEFLRRYPEVRVQIRVTNRVIDLFEDSIDVALRVRSEPPQS
FT                   ANIVVRPLWRTEQMLVGAPSLLQQNAPPLAPDDLAGFDTLDTPSGDGRHVFNLIAPDGT
FT                   RHTHEHEPRLVTADLMTIREAVLDGGGIAALPESMYGNALRAGQLSPVMPGWTLPVPQL
FT                   YAVFVSRQGMPPAVRAFVDYLVEKLDNERYEEPGCPERGAKDTQTKISI"
FT   gene            719210..720691
FT                   /locus_tag="BMA10247_A0782"
FT   CDS_pept        719210..720691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0782"
FT                   /product="ISBma2, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0782"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03772"
FT                   /protein_id="ABO03772.1"
FT                   /translation="MFFNGVMLKTPMPTQHELEMVTLEELVPKDHLLRQIDAAVDFEFI
FT                   RAKVAHLYCADNGRPALDPVVMFKLLFIGYLFGVRSERQLMREVQVNVAYRWFARFRLT
FT                   DKVPDASTFSQNRRRRFTDTTVYQEIFDEIVRQAIKRGLVDGRVLYTDSTHLKANANKG
FT                   KFDVVKLEQTPAAYTEALNAAVDADRAAHGRKPLDRDDDEPPSSKDTKLSRTDPDSGYM
FT                   VRDDKPKGFFYLDHRTVDAKHAIITDTHVTPASVHDSQPYLDRLDRQRERFEFKVEAVG
FT                   LDAGYFTPAVCQGLEERGIAGVMGYRTPNHKPGMFYKRQFKYDAYRNEYVCPQGQALPY
FT                   STTNRLGYREYKSNAQICGRCPVRSQCTNSAIAVKVVTRHVWERAKERVDARRLTEWGQ
FT                   RIYARRKQTVERSFADAKQLHGHRYARMRGLRKVAEQCLLAAAAQNIKKIAMLLARKRK
FT                   KGPAGPDWRFVRMLLRLVSGLRCGFDYPLAANPQS"
FT   gene            complement(720806..721237)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0783"
FT                   /note="porin, interruption-C; this gene model represents a
FT                   disrupted reading frame with multiple genetic anomalies"
FT   gene            721319..721582
FT                   /locus_tag="BMA10247_A0784"
FT   CDS_pept        721319..721582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0784"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0784"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02740"
FT                   /protein_id="ABO02740.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            721606..722439
FT                   /locus_tag="BMA10247_A0785"
FT   CDS_pept        721606..722439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0785"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0785"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02797"
FT                   /protein_id="ABO02797.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(722484..723272)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0786"
FT                   /note="porin, interruption-N; this gene model represents a
FT                   disrupted reading frame with multiple genetic anomalies"
FT   gene            723507..724307
FT                   /locus_tag="BMA10247_A0787"
FT   CDS_pept        723507..724307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0787"
FT                   /product="D-methionine-binding lipoprotein metQ"
FT                   /note="identified by match to protein family HMM PF03180;
FT                   match to protein family HMM TIGR00363"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0787"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01754"
FT                   /protein_id="ABO01754.1"
FT                   /translation="MTSIIRRVAGGAVWALAATLAHAGGPALKIGTMSGPDAQIWAEVT
FT                   KVAARDGLAIKVIEFNDYVQPNAALDAGDLDANGFQHQPFLDSQIRQRGYRIVNVGLTY
FT                   TSPMGFYSKRLKSLKDLPVGAKVGIQNDPSNGNRALLLLQKYGIVKLKPGAGVNGVNAT
FT                   PLDVAENPRKIRLVELDAAQLPRALPDLDAASINTDYAVKAGLSPVKDAIAIEDLKGPY
FT                   ANLIAVRAQDKDKPWVKKLVAAYESNDVRKFIETKFNGAIIPAF"
FT   gene            724343..724540
FT                   /locus_tag="BMA10247_A0788"
FT   CDS_pept        724343..724540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0788"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0788"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02337"
FT                   /protein_id="ABO02337.1"
FT                   /translation="MSEGGASRAARFAAARAHQRIHSNGHSPASRGRFVSRGGVCLSMK
FT                   AACAREPAGDAAKARPRREA"
FT   gene            724537..724659
FT                   /locus_tag="BMA10247_A0789"
FT   CDS_pept        724537..724659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0789"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0789"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01821"
FT                   /protein_id="ABO01821.1"
FT                   /translation="MSLGGVQARAAREWWASGRGLAAACGNDPSPAFMSGRQPS"
FT   gene            complement(724780..725895)
FT                   /locus_tag="BMA10247_A0790"
FT   CDS_pept        complement(724780..725895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0790"
FT                   /product="succinylglutamate desuccinylase/aspartoacylase
FT                   family protein"
FT                   /note="identified by similarity to OMNI:NTL03PA00892; match
FT                   to protein family HMM PF04952"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0790"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03413"
FT                   /protein_id="ABO03413.2"
FT                   /translation="MQTQTHPLISPAVGTARHITSFHYGPRGGKKVYIQASLHADELPG
FT                   MLVATLLRRKLAALEAAGRLRDEIVVVPVANPIGLAQHVFGDHLGRFELGSMQNFNRNF
FT                   HDLAALVIPRIEGRLTHDAAANLAAVRGAMREALAEQKPRTELESQRLALQRLSYDADI
FT                   VLDLHCDCDAVMHIYTNPDLWDDVEPLSRYLGAKASLLALNSVGNPFDEIHSFCWSELR
FT                   GRFGERHPIPNGTISVTVELRSERDVSYELAEHDAQALVEYLTLRGAIDGTPAPQPPLE
FT                   FAATPLAGTDPLVAPVSGVIVFHTPVGVWIEAGQDVADIVDPLTDRVVTLKSSVSGVLY
FT                   ARQIARFATAGMEVARIAGATPIRTGSLLSA"
FT   gene            726098..728281
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0791"
FT                   /note="putative O-antigen acetylase; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by similarity to GP:1545849; match to protein
FT                   family HMM PF01757"
FT   gene            complement(728597..729379)
FT                   /locus_tag="BMA10247_A0792"
FT   CDS_pept        complement(728597..729379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0792"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /note="identified by match to protein family HMM PF00497;
FT                   match to protein family HMM TIGR01096"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0792"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03376"
FT                   /protein_id="ABO03376.1"
FT                   /translation="MKKILAALTVALLAVSAGGVQAKDWSTIRFGVDASYPPFESKGPD
FT                   GKVVGFDVDLGNEICKRVKAKCVWIENDFDGMIPALKARKFDGVLSSMSMTPQREEQIA
FT                   FSSKLFNTPTRLVTKKGANLMPTAESLKGKTVGVEQGTIQETYAKVHWAPMGVKVQPYQ
FT                   NQDQVYADLIAGRLDAALQDAVQADIGFLKTPRGKDYAFAGTDLNDPKTLGEGAGIGLR
FT                   KEDTDLKAKIDKAIADMHKDGTYDKIAKKYFDFDVYGK"
FT   gene            complement(729613..730512)
FT                   /locus_tag="BMA10247_A0793"
FT   CDS_pept        complement(729613..730512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0793"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0793"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02849"
FT                   /protein_id="ABO02849.1"
FT                   /translation="MKLQQLQAFVCAAHHKSLRAAARALGVTQPAITHTIRELEAALNA
FT                   ELLVRSVRGVELTACGHALLPRAEQLLGDMRRTVEAVEQVRGELSGRVAIGTMPSIALT
FT                   ALPRAVMKFRATMPHVSLSLEEVTVPNALARLRNGELDIAAIHHIPALERDFAQLPLCS
FT                   TEFVVAMREGHPLAGARRLAELLDAEWIVTVGADHFPHSVMMSMFNAHGLPLPQRLLRA
FT                   PSSFAVTLGLVARSDVIGCFTKPLAAMVAPLGIRPARLDDRLPSYDLSILSRRDLLPTP
FT                   AVTQFIACLRQAADETLT"
FT   gene            730648..731835
FT                   /gene="hipO-1"
FT                   /locus_tag="BMA10247_A0794"
FT   CDS_pept        730648..731835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hipO-1"
FT                   /locus_tag="BMA10247_A0794"
FT                   /product="hippurate hydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0794"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02669"
FT                   /protein_id="ABO02669.1"
FT                   /translation="MNDARFTEVDDLAPLAEALREIRHRIHRHPELAYEEVETAALVAD
FT                   KLEAWGWRVTRGVGGTGVVGTLRVGDGARSVGVRADMDALPIAEATGLPYASAVPGKMH
FT                   ACGHDGHTAMLLGAAWRLAQARHFSGTVHLYFQPAEEHGVDSGAKRMIDDGLFERFPCD
FT                   AVFGMHNHPGVEPGVFLTRRGAFMSAGDKAVIDIHGVGGHAARPHLAVDPVVVAASVVM
FT                   ALQTIVARNVDPAQPAVVTVGSLHAGTANNVIPSRARLELSVRSFDPEVRALLRRRITE
FT                   LAQAQAASYGASANVEYIEGYPVVVNSDAETDFAAQVAKELVGERNVVEQADILMGSED
FT                   FAFMLQRRPGSFVRLGNGAGEEGCMVHNPKYDFNDRNLVTGAAFWARLVERYLAR"
FT   gene            732088..733425
FT                   /locus_tag="BMA10247_A0795"
FT   CDS_pept        732088..733425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0795"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0795"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02128"
FT                   /protein_id="ABO02128.1"
FT                   /translation="MHEDNLTMPADGAGVAPADAVSAAGLRTARGGAIAAAVIGNWLEF
FT                   FDFTVYGFFAVIIGKLYFPSHDATTSLLLSVATFAAGFFTRPLGSIVLGVYADRRGRKA
FT                   ALNLTILLMALGTGMIALAPTYAQIGVLAPVIVVCARLMQGFSQGGEFGAATSTLVEHG
FT                   GAARRGFCASWQLATQGGAALMGSGFAALLSNTLAKGALESWGWRVPFALGVLIAPVGM
FT                   YLRRRLADDAPGAGHHGIDGGVLRELFARHGRTVLLLTLTVMGGTVSTYILTFYMPTYA
FT                   IHTLGLPMKLSMFVGVASGCVMLVTCPLFGWLSDRIGSRRLPIFVGRGVLVVLLFPAFV
FT                   LMNRYPSLAVVMPLTGLMLLFYSMGSASEFALMCESFPRRVRATGISIAYALAVTLFGG
FT                   TAQLVATWLVRVTGSTLAPAAYVAVCVIVSLVAVGMLRETATETAD"
FT   gene            complement(733974..734693)
FT                   /locus_tag="BMA10247_A0796"
FT   CDS_pept        complement(733974..734693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0796"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM PF08362"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0796"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01804"
FT                   /protein_id="ABO01804.1"
FT                   /translation="MPHDDPTTTPPDAPAPRARTKAAHAPSRARKAHIRELNEAHLLAC
FT                   AEAVFAERGFEGASTALIAERAGLPKANLHYYFPTKLALYRRVLDDLLEDWHAAADSFD
FT                   VGDDPVAALGGYVRAKMALSRERPLGSKVWVNEIISGATHMQDLLLERVKPWMDTRIAL
FT                   IERWIARGLVEPVEPKTLLYMIWATTQHYADFDAQIVALSGKHGLSAKAFDATTDEVVR
FT                   LILRACGARSPHAREPA"
FT   gene            complement(735054..735839)
FT                   /locus_tag="BMA10247_A0797"
FT   CDS_pept        complement(735054..735839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0797"
FT                   /product="beta-ketoadipate pathway transcriptional
FT                   regulator, PcaR/PcaU/PobR family"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF09339; match to protein
FT                   family HMM TIGR02431"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0797"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03196"
FT                   /protein_id="ABO03196.1"
FT                   /translation="MSTEFQAKPGDSYVQSFARGLAVIRAFDAEHPEQTLTEVASATGL
FT                   TRAGARRILLTLQTLGYVEADGRLFRLTPKILDLGFAYLTSMPFWNLAEPVMEQLSARI
FT                   HESCSAAVLDRTEIVYVLRVPTHKIMTINLSIGSRLPAYCTSMGRVLLSSLDAAALDDT
FT                   LARSTLRAYTPRTLTDPAALKDEIATVRSQGWAIVDQELEAGLISLSAPIRNRRGQVIA
FT                   AMNISGNAQRHTAKQMVKAFLDPLLEASQTVSQLVARRG"
FT   gene            736076..737278
FT                   /gene="pcaF-1"
FT                   /locus_tag="BMA10247_A0798"
FT   CDS_pept        736076..737278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaF-1"
FT                   /locus_tag="BMA10247_A0798"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930; match to protein family HMM
FT                   TIGR02430"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0798"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01747"
FT                   /protein_id="ABO01747.1"
FT                   /translation="MTEAFLCDAIRTPIGRYGGALAPVRADDLGAVPLKALVERNRDVD
FT                   WAAVDDVIYGCANQAGEDNRNVARMSLLLAGLPHAVPGATINRLCGSGMDAIGLAARAI
FT                   KAGEASLMIAGGVESMSRAPFVTGKAMSAFSRQAEIFDTTIGWRFVNPLMKQRYGVDSM
FT                   PETAENVATDYRVSRTDQDAFALRSQQKAARAQADGTLAQEIAPVTIAQKQGEPLVVAR
FT                   DEHPRETTLEALAKLKGVVRPDGTVTAGNASGVNDGACALLVASEAAARRHGLVPRARV
FT                   LGIATAGVEPRVMGIGPAPATQKLLARLGMTLDQFDVIELNEAFASQGLAVLRLLGVAD
FT                   DDARVNPNGGAIALGHPLGASGARLVTTATYQLHRTGGRFALCTMCIGVGQGIAIAIER
FT                   V"
FT   gene            complement(737381..737563)
FT                   /locus_tag="BMA10247_A0799"
FT   CDS_pept        complement(737381..737563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0799"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0799"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03362"
FT                   /protein_id="ABO03362.1"
FT                   /translation="MSRGEALGQPESATARASQPLVVTVRRDRIGADRIGMRARSANDR
FT                   RGIETRHAFDARKSQ"
FT   gene            complement(737699..737989)
FT                   /locus_tag="BMA10247_A0800"
FT   CDS_pept        complement(737699..737989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0800"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0800"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02302"
FT                   /protein_id="ABO02302.1"
FT                   /translation="MGLYPLFRQAFEKIDLAPRKSDTATLVLTWVNPRARKHRLRPGGP
FT                   PERHRATSMIAPGDSSPSDRNQTFSPELFRDSYRANIQELKTIFAGENTVS"
FT   gene            738063..739607
FT                   /locus_tag="BMA10247_A0801"
FT   CDS_pept        738063..739607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0801"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF08447; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0801"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01752"
FT                   /protein_id="ABO01752.1"
FT                   /translation="MRNNQPVTQHEFELPDDATLMSTTDPHGRITYANATFVHVSGFSS
FT                   DEIVGAPHNVVRHPDMPRDAFADMWATLKRGEPWTALVKNRRKNGDHYWVRANAVPVIR
FT                   GGQTQGYMSVRTKPARAETAAADALYRDFREGRAGSRRFHKGLIVRTGLLRACSLLQTM
FT                   SVRARIHLPIVALTPAIVGAAWAAGVAGAPLAQLAGATLGGAALAAWWLDAQIARPLRT
FT                   LRRQALDVATGASRRGVNMNRVDEIGMSLRTINQLGLMFRWLIDDVSEQVLTVQRAVNE
FT                   IAQGNHDLSARTEQAATSVQQTAASMAQMTATVSSNAQTATQANRLSESASHAAERGGQ
FT                   AVREVVSTMGEITESSRRISEIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAG
FT                   EVRALAQRSANAAKEIKALIGASVERVESGAQTVDYAGRTMGEIVSQVKRVSDLIAEIS
FT                   ASTSEQRAGVTQVDDAVVHLDSITQQNAALVEQSAAASESLRQQATLLVDAVGVFR"
FT   gene            complement(739695..740798)
FT                   /locus_tag="BMA10247_A0802"
FT   CDS_pept        complement(739695..740798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0802"
FT                   /product="O-methyltransferase"
FT                   /note="identified by match to protein family HMM PF00891"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0802"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03690"
FT                   /protein_id="ABO03690.2"
FT                   /translation="MKPLIPSIDRGGRHRARRRHDLDLARYPAMTLTSPHHDDVAVYDL
FT                   TLGLFACPAMLIAHRAGLFRRLGESPSTLKELGAALGLARRPTEALANTAAALGFVRRD
FT                   ADRYALTALGADLLVERSPTYFGAFLDLMYEASETFSLKSLEAAIRDDAAHAYGSPDVF
FT                   QSHEQQLALAQRFTRAMESVSAAHAPVWPTQLDLSRHRVMLDIGAGSGAHTRGALSAWP
FT                   ALRAIVFDLPGVCELSRPYFETSPVRERVTLHPADMRNDPFPDADLHFYSNVFHACPRE
FT                   KNALLARKSSDALPPGGRIVLHEVLYRDDKSGPLAAAASSLMMISWTEGEQYSSRELTE
FT                   ILANAGFSSLETIPSAGYYSLVTGVKR"
FT   gene            740785..740928
FT                   /locus_tag="BMA10247_A0803"
FT   CDS_pept        740785..740928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0803"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0803"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03073"
FT                   /protein_id="ABO03073.1"
FT                   /translation="MSGFIGDAGSAPKAVSRAGPPCLRRAMRPRGRRRGRPGRRRSRHT
FT                   FR"
FT   gene            complement(741129..742157)
FT                   /locus_tag="BMA10247_A0804"
FT   CDS_pept        complement(741129..742157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0804"
FT                   /product="oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0804"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03443"
FT                   /protein_id="ABO03443.1"
FT                   /translation="MGNEDLDLTNRHNTEDWLPDRIRLRNVWLPLAHTFEIGERASRWY
FT                   VHSEPCYLWRAAGRIHACPWHPGLPAAKRPTPRPRDADAACYPVVERFGYVWVWYGEPE
FT                   AASDAFVPDVPFLPRDGGLPKYMQGNIRVDCCAPLLIENLLDLTHSDFLHAKVFGDQHA
FT                   DEDRVDVSYTSETVTMIRRCKNKSILPIMRWFGGVRAKYQDIHAVVHVHVRSSIALAYG
FT                   RHTPGSDLPLFHPCVPESRNYCRLNFALNATQAPWPLRLLLPFVPYVVGLQDNSMVRRQ
FT                   SGRYLDAGERRDLYSRFDRAGLRYRILLQQLAKRQSEGDFSYADDALPSRDARGILGMP
FT                   NE"
FT   gene            complement(742166..743158)
FT                   /locus_tag="BMA10247_A0805"
FT   CDS_pept        complement(742166..743158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0805"
FT                   /product="Rieske [2Fe-2S] domain protein"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0805"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02751"
FT                   /protein_id="ABO02751.1"
FT                   /translation="MNTVAQIRFDSIARWMPVALSEQVSGRAALAVICMEQPLVLFRDA
FT                   SGAVCAMEDRCAHRRAPLSLGRVTPDGRLQCAYHGWTYDGATGACVAIPNLSASERVPA
FT                   HYAAHGYKTLERDGFIWACARDAPPPAEAIARDARSARRFAGSVTVAIARDEYVAALAD
FT                   GPHLTMRIAGLYITDYVIADATPHDGDIATERGVTWLAHIVDRHFGVHYPWTLRVTSPR
FT                   DGALASVELASRDGATALWASIAITPAARGATNVRWRGGVAADASGFGAKLFRTWARLH
FT                   AAPFAMLAHVDGRALSTLDALYSRAWRGPIPEGIAHTRPMPADYRTRSR"
FT   gene            743288..743407
FT                   /locus_tag="BMA10247_A0806"
FT   CDS_pept        743288..743407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0806"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0806"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02398"
FT                   /protein_id="ABO02398.1"
FT                   /translation="MACIARHARRPAARVFERAATMRAVLGPCAAERRRSTRC"
FT   gene            complement(743451..743993)
FT                   /locus_tag="BMA10247_A0807"
FT   CDS_pept        complement(743451..743993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0807"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0807"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01760"
FT                   /protein_id="ABO01760.1"
FT                   /translation="MRPGESRKISIPVPIPFSTPLPIRLSATRRAHNRGYCRAEDSERE
FT                   RRHHAFDNHADVDADTGRRRGSAPGSAAPAARDRAIAVKGECAIDAIRSDAGGPARPFP
FT                   ASIASRARRHGDRRRPTPLSAPADRAAPNTRCAALRPPAAPHRTATAAMSTAGGHFHGV
FT                   CARLGSPYAADRLARAD"
FT   gene            744779..744901
FT                   /locus_tag="BMA10247_A0809"
FT   CDS_pept        744779..744901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0809"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0809"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03771"
FT                   /protein_id="ABO03771.1"
FT                   /translation="MQRALRARIAVSRDARHASGAHRASHLTHHTATHMYLITT"
FT   gene            complement(744865..746334)
FT                   /gene="gabD"
FT                   /locus_tag="BMA10247_A0808"
FT   CDS_pept        complement(744865..746334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BMA10247_A0808"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01780"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0808"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03097"
FT                   /protein_id="ABO03097.1"
FT                   /translation="MTTAHETLALKDPALLRERAFVAGEWQAADGGATLEVRNPATGAL
FT                   IGTVPAMGAAETRRAIDAANAAWPAWRKKTAKERAAILRKWHDLMIAHADDLALILTTE
FT                   QGKPLAEAKGEIGYAASFLEWFAEEGKRVYGDTIPTPAADKRIVVTKEPVGVCAAITPW
FT                   NFPAAMITRKVGPALAAGCPIVVKPAEATPFSALAMAVLAERAGVPAGVFSVVTGEPKA
FT                   IGGELTSNPIVRKLSFTGSTPVGRLLMAQCAATVKKVSLELGGNAPFIVFDDADLDAAV
FT                   EGAIASKYRNSGQTCVCTNRFYVHEKVYDAFAEKLTAAVAKLKVGPGTEAGVVQGPLIN
FT                   GAAVRKVEAHIADALDKGARVTTGGQRHPLGHGFFEPTVLTGVTPDMKVAKEETFGPLA
FT                   PLFRFSTEEEAIRYANDTEFGLAAYFYSRDIGRVWRVAEALEYGMVGINAGIISNEVAP
FT                   FGGVKQSGLGREGSHYGIDDYVVIKYMCVAV"
FT   gene            complement(746392..747675)
FT                   /gene="gabT"
FT                   /locus_tag="BMA10247_A0810"
FT   CDS_pept        complement(746392..747675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BMA10247_A0810"
FT                   /product="4-aminobutyrate transaminase"
FT                   /EC_number="2.6.1.19"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00700"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0810"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02040"
FT                   /protein_id="ABO02040.1"
FT                   /translation="MNNADLHARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDF
FT                   AAGIAVLNTGHRHPRIVKAIADQLGQFTHTAYQIVPYASYVELAEKINARAPIAQPKKT
FT                   AFFTTGAEAVENAVKIARAYTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKIGFGPFPG
FT                   DVFHAPYPNALHGVTSADSIAAVETLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVR
FT                   ALRKLCDAHGILLIADEVQTGFARTGKLFAMEHYDVSADLMTIAKSLAGGMPLSGVVGR
FT                   ADVMDAAAPGGLGGTYAGNPLAVAAAHAVLDVIDEEKLAERATVLGDKLKAKLAALRAE
FT                   LPQIVDVRGPGAMVAAEFVDPHTRASDAAFTKRVQTLALERGLLLLICGVDANVIRFLF
FT                   PLTIEDAVFDEALGILESVLREAVGVPA"
FT   gene            747817..749511
FT                   /locus_tag="BMA10247_A0811"
FT   CDS_pept        747817..749511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0811"
FT                   /product="transcriptional regulator, gntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0811"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02706"
FT                   /protein_id="ABO02706.1"
FT                   /translation="MRVSVLSDWLAQRIVRGGGAQPIYRQLHRLLQQAILTRELPAGAR
FT                   VPSSRLLAAELGIARNTVTQVYEQLALEGYVSSATGRGTFVADSAPDEIVGAPADSPPG
FT                   LPGPGLPGTRGAAAGAEAAAGIGFDPTLEPGAARRSLSARGARLVGGAGVSKRQGGAFM
FT                   PGVPDVSRFPARVWTRLHNKYWRRLRPELLTYAPGGGLAPLREALADYLRTSRSVRCAP
FT                   EQIIVTTGIHQSIDLAVRLLTDPGDVIWTEDPCYWGVRSVMHVSGLTTRPIPVDEEGIA
FT                   PAAADFAAPPKLMLVTPSHQYPLGMVMSLARRRMLLEYARQHGAWIIEDDYDSEFRYGS
FT                   RPLASLQGLDTAGQVIYVGSFSKTLFPGLRVGYLVAPEPLAESFATASAELYREGQLLQ
FT                   QAVLAEFIAEGHFVSHIRKMRTLYGQRRQTLLDALARRYGDALPAVGGDAGLHLVMRLP
FT                   DGVDDRALARAALERDIVVRALSGYYAQATRAASGLLLGYACVPEDEIGCAFDALSRAI
FT                   DDVAFGRAAAASAAPASTSAAAASSASSASAASTTSAAARMPAAVAR"
FT   gene            complement(749528..751006)
FT                   /locus_tag="BMA10247_A0812"
FT   CDS_pept        complement(749528..751006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0812"
FT                   /product="C4-dicarboxylate anaerobic carrier family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03606"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0812"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03477"
FT                   /protein_id="ABO03477.1"
FT                   /translation="MLAAPAHCADTPRTPDMPDMPDMPDTRGTPAHDASPRPEHKPHGK
FT                   MLHPVVMMIWVLAAAVALTWLVDSGRYARNGKLVVPGTYQVVPKATSLATLVAPAVSKS
FT                   TPQLAMPASLVSAFVAVPGGLVKNAPLIVMVMFVGGMFGVMRRTGVVDAGIDRLLQLTG
FT                   NDVYLLTPLLMILIGLGSTLLGFISEYLVIIPMVMVIAKRLGLSNLFAVALVALAAKIG
FT                   YIASVTNPLALAVAQPLVGVPLFSGVALRAAVFAVYLALGILYLLHHVKRSGYRRERAK
FT                   ALAHAHGVARLSVRHQATLALLAAAVAMLVFGTRELKWGNVELAAFYAFVAIAADAFVD
FT                   GMKSMMLAALLMGLAASVELLLQNSLVLDTLIHLFTRLANGQSPVWVANGLMAVQMVLD
FT                   VFIPSVSGKAAVSMPIIGPIAQLSGVSGQTSVLAFVLGGGLTNLVTPTSGMLLAYLATA
FT                   RVDFGAWLRFVLPLFAVLLALSCGVLAFAVQIGY"
FT   gene            complement(751024..751791)
FT                   /locus_tag="BMA10247_A0813"
FT   CDS_pept        complement(751024..751791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0813"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0813"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02032"
FT                   /protein_id="ABO02032.1"
FT                   /translation="MNYIVDAVDSALKLLSFVAEHPHLGVTELASKLGINKSRTYRMLC
FT                   TLELHRFVVQDARTSTYALGPQAFVIGVAAAQQNALVRAAQRHMLALSQAINETVVLRV
FT                   REGLETVCVARCETTHEIRTIGSVGNRRPVGLGASGKVLLAFAPDAVRNEYFARVRKAA
FT                   QGDPPRLVEELDAISRKGYAVSVGEVTAGAVAIAVPVRDLTGETLASVSVAGPEMRISR
FT                   VEIPDYLERLQACSHAISAELGYVPARAALQPA"
FT   gene            complement(751788..752696)
FT                   /locus_tag="BMA10247_A0814"
FT   CDS_pept        complement(751788..752696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0814"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05013"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0814"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02195"
FT                   /protein_id="ABO02195.1"
FT                   /translation="MLTFNRHTVALDERFACFVAQPLDAALPIVVDSPHSGIAYPPDFG
FT                   AVAPRHAILTSWDAFVDELWAGAPERGCALVGARFPRAYIDPNRAVTDIDAALLAEPWP
FT                   EPLAPQSYTRRGMGLIRRYALPGVPLYDRKLSLDEVRHRIDTYYLPYRRALADAAEPLY
FT                   AKHGALWHVDCHSMKSRGNAMNLDAGAARPDVVVSDRLGTSADPAFTQWTADWFAHAGY
FT                   RVRINAPYQGGDLLNALAAPARRRHSIQIEFNRALYMNEAAFDKHAGFAALKRTVDAYL
FT                   DALAAHVRTQLPPPRGQGVSR"
FT   gene            753039..753329
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0815"
FT                   /note="outer membrane porin protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            753326..753478
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0817"
FT                   /note="conserved domain protein; this region contains one
FT                   or more premature stops and/or frameshifts"
FT   gene            complement(753475..753615)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0816"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(753612..754676)
FT                   /locus_tag="BMA10247_A0818"
FT   CDS_pept        complement(753612..754676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0818"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0818"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01741"
FT                   /protein_id="ABO01741.1"
FT                   /translation="MVSVIAKSDRGQNALLSTIRRAIAREPPCPLRQRYTRGAREPPCA
FT                   DARHPEHGGKRSLRDRGPPPPACPIHVFPPASMEQRFVLLVLLCALLHAVWNALLHASE
FT                   DRVAQLGTMSVPYLLAGAAGALALPPPPAPAWPYVAASALLELGYCAALLRAYRSGDFS
FT                   RIYPIARGLSPLAVCALALIALGERPTPFALAGIALVSLGIASLALRRGLRWSGESVPY
FT                   ALVTGLFIAAYSVVDGRGVRLAGDPLAYVAWVYLLWNAPQFALICRLRGWRALARSRAA
FT                   VSRGLAAGVLSLAAYAIAIAAYRHLPVATVSALRETSSIFAIAIGWFALRERPSARRLA
FT                   ACALVVAGAMLIRM"
FT   gene            754663..755727
FT                   /gene="selD"
FT                   /locus_tag="BMA10247_A0819"
FT   CDS_pept        754663..755727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selD"
FT                   /locus_tag="BMA10247_A0819"
FT                   /product="selenide, water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00476"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0819"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02590"
FT                   /protein_id="ABO02590.1"
FT                   /translation="MTETKQTDAAAPRLTSLSHGGGCGCKIAPGVLSELLRRTAPPALF
FT                   PDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIVDDPFDFGRIAATNALSDVYAMGGK
FT                   PILALALVGMPINVLPHETIAAVLRGGEAVCADAGIPVAGGHSIDSVEPIYGLAALGVV
FT                   HPARVKRNAAARAGDVLVLGKPLGVGVLSTALKKDRLDAQGYAQMIATTTKLNRPGTAL
FT                   AALPGVHALTDVTGFGLLGHTLELARGAGLTARVRYGALPWLAGVEALVADGVLTGASG
FT                   RNWAAYGHDVRLGDGLPAVAQALLTDPQTSGGLLVACAPEAVDDVLACFRDDGFERAAA
FT                   IGEMVDGAARVDVS"
FT   gene            complement(756350..756694)
FT                   /locus_tag="BMA10247_A0820"
FT   CDS_pept        complement(756350..756694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0820"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02730"
FT                   /protein_id="ABO02730.1"
FT                   /translation="MRFGPRALARRSFVSARRADARRLRSARAEGMHRRTVLGQRVRRE
FT                   WPRREWPHSHPMSCARTRGPRIGARDDNHDAGTHHGASYAIDGTTQPSDNAIIKPNGTA
FT                   FIGTAQRARA"
FT   gene            complement(756758..757003)
FT                   /locus_tag="BMA10247_A0821"
FT   CDS_pept        complement(756758..757003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0821"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0821"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03249"
FT                   /protein_id="ABO03249.1"
FT                   /translation="MSQNGGAVREHEDVQSGRQAAAPRAGATHARHASCAAVERNHELS
FT                   AKQPTKQPTNAASARRPMHANERDGRRCAGGGVGRT"
FT   gene            757086..758147
FT                   /locus_tag="BMA10247_A0822"
FT   CDS_pept        757086..758147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0822"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF06516"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0822"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02850"
FT                   /protein_id="ABO02850.1"
FT                   /translation="MLTRSIFSAAVFSLAACAMAPSVAQNNGEAFAEAGAQGRPAKVMI
FT                   ISMFGPEGQAWLDRLGPWKDVAVPGLSPDYPNVHCNKQDVCVVTTGMGYANAASTIMAL
FT                   TFSRRFDLRRTYFLISGIAGVDPARGTLGTAAWAKYLVDFGLQWELDAREIPAGWNGGY
FT                   LGINTKSPSDKPPLDYRTEVFELNGKLADTAYALSRNVQLADSAQAQAARAKFNYAPAN
FT                   QPPVVTRCDTSSGNTWFSGTLLGERARQWTKLLTDNKGTYCMTAQEDNATFEALKRAAS
FT                   VNRVDLSRVAVLRTGSDFDRPYQGQTSVDNLLNYADQGGFPLATENLYRAGNPLVQDIA
FT                   THWGEWKDGVPRR"
FT   gene            complement(758387..758680)
FT                   /locus_tag="BMA10247_A0823"
FT   CDS_pept        complement(758387..758680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0823"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0823"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03399"
FT                   /protein_id="ABO03399.1"
FT                   /translation="MKRSSLLAFAAIALAVAAPAFADGGIGPAGGYGDASGHGHGARTR
FT                   AEVRAELEQAQRDGTLAALRKSMSYAPPGAELGAPRPYRPDPDTNQLAGAGR"
FT   gene            complement(758740..759162)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0824"
FT                   /note="putative oxidoreductase; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(759613..760617)
FT                   /locus_tag="BMA10247_A0825"
FT   CDS_pept        complement(759613..760617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0825"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0825"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02239"
FT                   /protein_id="ABO02239.1"
FT                   /translation="MDRLQAMQVFTRVVDTNSFTKAAETLGLPRASVTTIIQNLEAFLG
FT                   VRLMHRTTRRLSLTPDGAAYYERCVRILADVEETEASFQVNNRKPHGKLRVDMPGSIGR
FT                   LILIPSLCEFHSRYPDIDLQLGLSDRPVDLLQEGVDCVIRVGALQDSSLVARRVGLFEG
FT                   TTVASPAYLEKYGEPQTIEELAQHKAVNYFSSRTGRTIDWAFLIDGKEVEVKMNGLVSV
FT                   NDADAYVTCGLEGFGLIQPPLFMVLPHLRNGTLKEVLPGHKPLPMPISVVYPHSRHLSP
FT                   KVRVFVDWVAEIFERCPLLSGRKGLDATCSKRTFEEAERAPSLDTPVLNEWVA"
FT   gene            760776..761660
FT                   /locus_tag="BMA10247_A0826"
FT   CDS_pept        760776..761660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0826"
FT                   /product="putative carboxylesterase"
FT                   /note="identified by match to protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0826"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03821"
FT                   /protein_id="ABO03821.1"
FT                   /translation="MDARRRATHVMDAFDFRRQISSTSAESARVRPALAVSDVVIGGYA
FT                   QDIALRLYRRPDKSSLPVVLYFHGGGFVRGSLDDAERAARHLAEHVPALVVSVDYSLAP
FT                   RHPFPAAPEDAYCAARWAEARARAFGGNPRKIGVAGHDAGGQLANCLAFIARDRGEIRI
FT                   AAQALIGPMLDPSLTRLADATRLASSDTSAQECAACYRAYLPQPSQRMHPYAAPLESVR
FT                   LAGLPPTLVATAQNDVLHVEAEKYASCLIDAGVPTQVVRYRDVSHAALADHASALEEVA
FT                   RFFQFRFSAGAPG"
FT   gene            761719..762939
FT                   /gene="bpeE"
FT                   /locus_tag="BMA10247_A0827"
FT   CDS_pept        761719..762939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bpeE"
FT                   /locus_tag="BMA10247_A0827"
FT                   /product="multidrug efflux pump BpeE"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0827"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01902"
FT                   /protein_id="ABO01902.1"
FT                   /translation="MRTSRSRIAAAAFAVVFIAGLGTFGAIRVNAGAPEKSAAPLPEVD
FT                   VATVLSKTITDWQSYSGRLEAVEKVDVRPLVSGTIVSVNFKDGALVKKGDVLFVIDPRP
FT                   YQAEVDRAAAQLAGAQARNGYAQSDWQRAQRLIGDNAIAKRDYDEKQNAAREASANLKA
FT                   AEAALETARINLGYTRITAPVSGRVSRAEITLGNVVSAGASAAPLTTLVSVSPIYASFD
FT                   ADEQTYLQYIGGAKDGRKVPVELGLANESGYSRQGVIDSVDNRLDTSSGTIRVRARFDN
FT                   ADGALVPGLYARVKVGGSAPHPALLIDDAAINTDQDKKFVFVVDQQGRVSYREVQLGAQ
FT                   HGNQRVIVGGLAASERIVVNGTQRVRPGEQVKPHLVPMTGGDDAAAATPVAGGVQRPRA
FT                   AQGNARA"
FT   gene            763001..766186
FT                   /gene="bpeF"
FT                   /locus_tag="BMA10247_A0828"
FT   CDS_pept        763001..766186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bpeF"
FT                   /locus_tag="BMA10247_A0828"
FT                   /product="multidrug efflux pump BpeF"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00915"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0828"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03018"
FT                   /protein_id="ABO03018.1"
FT                   /translation="MNISKFFIDRPIFAGVLSVIILLAGMIAMFLLPISEYPEVVPPSV
FT                   IVKAQYPGANPKVIAETVASPLEEQINGVEDMLYMQSQANSDGNMTITVTFKLGTDPDK
FT                   ATQLVQNRVNQALPRLPEDVQRLGITTVKSSPTLTMVVHLISPNDSYDMTYLRNYALIN
FT                   VKDRLSRIQGVGQVQLWGAGDYAMRVWLDPQKVAQRNLTADDVVRAIREQNVQVAAGVI
FT                   GASPTLPGTPLQLSVNARGRLQNEDEFGDIVVKTAPDGGVTHLRDIARIELDASEYGLR
FT                   SLLDNKPAVAMAINQSPGANSLAISDEVRKTMAELKQDFPAGVDYRIVYDPTQFVRSSI
FT                   KAVVHTLLEAIALVVIVVIVFLQTWRASIIPLIAVPVSIVGTFSLLLLFGYSINALSLF
FT                   GMVLAIGIVVDDAIVVVENVERNIENGLTARAATYKAMQEVSGPIIAIALTLVAVFVPL
FT                   AFMSGLTGQFYKQFAMTIAISTVISAFNSLTLSPALSAILLKGHGDKEDWLTRVMNRVL
FT                   GGFFRGFNKVFHRGAENYGRGVRGVLSRKAVMLGLYLVLVGATLMVSKIVPGGFVPAQD
FT                   KEYLIAFAQLPNGASLDRTEKVIRDMGAIALKQPGVESAVAFPGLSVNGFTNSSSAGIV
FT                   FVTLKPFDQRHGKALSAGAIAGALNQKYAALKDSFVAVFPPPPVLGLGTLGGFKMQIED
FT                   RGAVGYARLADATNDFIKRAQQAPELGPLFTSYQINVPQLNVDLDRVKAKQLGVNVTDV
FT                   FDTMQIYLGSLYVNDFNRFGRVYQVRVQADAPFRQRADDILQLKTRNAAGEMVPLSSLV
FT                   TVSPTFGPEMVVRYNAYTAADVNGGPAPGYSSGQAQAAVERIAAQTLPRGVKFEWTDLT
FT                   YQQILAGDSAFWVFPISVLLVFLVLAALYESLTLPLAVILIVPMSILSALTGVWLTQGD
FT                   NNIFTQIGLMVLVGLSAKNAILIVEFARELEHDGKTPFEAAVEASRLRLRPILMTSIAF
FT                   IMGVVPLVLSTGAGAEMRHAMGVAVFFGMLGVTLFGLMLTPVFYVVLRTLAGGKIHVAQ
FT                   KDSAGYGVPAPDA"
FT   gene            766197..767729
FT                   /gene="oprC"
FT                   /locus_tag="BMA10247_A0829"
FT   CDS_pept        766197..767729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprC"
FT                   /locus_tag="BMA10247_A0829"
FT                   /product="outer membrane efflux protein OprC"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0829"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03555"
FT                   /protein_id="ABO03555.1"
FT                   /translation="MNKTNINERIARVAKIAAASGLLVALLAACAVGPDYRRPDVATPA
FT                   AFKEAPALAPGEQAGTWKAAEPADAAHRGEWWRVFGDPVLDALETQALAANQNLKAAAA
FT                   RVEQARAATRAARSQWFPQVGVGFGPTREGLSSASQFQPQGSGPTNATLWRAQGTVSYE
FT                   ADLFGRVGRNVEASRADEAQSQALFRSVQLALQADVAQNYFELRRLDSDQDLYRRTVGL
FT                   REEALKLVQRRFAEGDISELDVSRAKNELATAQADAVGVARRRAASEHALAILLGKAPA
FT                   DFSFSETPIAPVAVRVPAGLPSALLERRPDIAAAERAMMAANARIGLAKSAYFPKLDIT
FT                   GAFGYEAATLGNLFLWSSRTFLLGPFAGTALTLPIFDGGRRSAGVAQARAKYDEEVANY
FT                   RQQVLVAFREVEDNLADLRLLDDQIRAQSDAVNASRRAAKLSRTQYQEGAVSYLDVIDS
FT                   ERSVLESQLQSNQLTGTQAVSTVNLIRALGGGWGSDAALGSREPGKQDVAAR"
FT   gene            767781..767951
FT                   /locus_tag="BMA10247_A0830"
FT   CDS_pept        767781..767951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0830"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0830"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01688"
FT                   /protein_id="ABO01688.1"
FT                   /translation="MPAGAHGRRNANVGRGARGQAETRGARRRADGIDRASAGTFKNLR
FT                   EAGPEKRRLRT"
FT   gene            768115..768258
FT                   /locus_tag="BMA10247_A0831"
FT   CDS_pept        768115..768258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0831"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0831"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02154"
FT                   /protein_id="ABO02154.1"
FT                   /translation="MTGGIDDEAWNGATAASRRRHTACDARRIGPACMLQREFCFVRSG
FT                   LD"
FT   gene            complement(768679..769920)
FT                   /locus_tag="BMA10247_A0832"
FT   CDS_pept        complement(768679..769920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0832"
FT                   /product="transporter, dicarboxylate/amino acid:cation (Na+
FT                   or H+) symporter (DAACS) family"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0832"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03805"
FT                   /protein_id="ABO03805.1"
FT                   /translation="MTLANKKISLPLQMILGLALGVVFGLLAPAASRDLAFISTLFGHA
FT                   IKMVVLPLILLSVTLGAFRAGTQRGRLGKTAAFSLVFFVLMTVIAAALGLALNWLFRPG
FT                   IGASHAQTASMPANLASGIDWMKFLTDMIPSNIVGALAAGNSLPVLVFGVLLGCALAAV
FT                   EDRAAPFVAVCESMLAAFFKMTEWVVSLSPIAIFAAIAVLLSSKGLAAMAPLAKLLGIA
FT                   YLGMALLAAWLTLIVKLAGHSPRAVVRKVSEPLILGFTTRSSEITFPVHLKKLTEMGVP
FT                   SSVASNVLPLSYIFNREGAVLYTVLAVCYLADAYQLAWSWPLMITIAVLTIITIDGAAN
FT                   VPSGAVVAITVILAAIGLPADAVLLILGVDAFFDMGRTALNVYASTVATTLASRVSGAA
FT                   PEIAQATTAHASRA"
FT   gene            complement(769904..770563)
FT                   /locus_tag="BMA10247_A0833"
FT   CDS_pept        complement(769904..770563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0833"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0833"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01768"
FT                   /protein_id="ABO01768.1"
FT                   /translation="MEKISSDTGSAYDEIRSRIFDGRLSPGQKISHRGLAHELGVGQMP
FT                   VRSALQLLASEGLVNIVDKSGTFVNEPTRDDLREIYELRLALESTAAYLAARGGVTDGL
FT                   SRSHAQMRRLVDENIADIMTEQKIGWVFHDEIFKAARNDRLFTTYKLLRAQTHALNELP
FT                   RNDFATVRRGTLEHLEIYAAIDARDAETARRRMWNHVIDGTPDRIRLIRAQYDTGQ"
FT   gene            770719..771189
FT                   /locus_tag="BMA10247_A0834"
FT   CDS_pept        770719..771189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0834"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0834"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03077"
FT                   /protein_id="ABO03077.2"
FT                   /translation="MLVHQQSYSIVTVPVASVLPLRARILLDGDENASRFPCDDHDATL
FT                   HLAARTSDGIVAVATICRQPFREFPPDGAWRLRGVAVEPLMQGHGVGTRLMHACIEHAQ
FT                   RQDARVVWCTARDSARGFYAALGFATSGTPLAIAARPDMVFHEMHLLLPGRA"
FT   gene            771186..771383
FT                   /locus_tag="BMA10247_A0836"
FT   CDS_pept        771186..771383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0836"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0836"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03444"
FT                   /protein_id="ABO03444.1"
FT                   /translation="MTLARGGAAPRVPLFVRAGGVCFVLLAARGAAHARAYAMGDGRWR
FT                   AAETIRIAKPSARSFRAACQ"
FT   gene            complement(771377..772276)
FT                   /locus_tag="BMA10247_A0835"
FT   CDS_pept        complement(771377..772276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0835"
FT                   /product="putative auxin efflux carrier"
FT                   /note="identified by match to protein family HMM PF03547"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0835"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03753"
FT                   /protein_id="ABO03753.1"
FT                   /translation="MASLILVLACLVAGAALARSKRLPANFPASLNYFVIQISLPALVL
FT                   QHLHRIAIGADVVWLFATPAIVFAATAALALAAGALLRLDKATVGCLTLVCGTSNTSIV
FT                   GVPVVQALIGSAAVGHALVVDQANFIVMCTAGLVAADLYAGGATRWRGVARQLAGYRPI
FT                   QAMALALLLRPVPFAPVVEDVLTLLGATLTPIAMISVGASFSVRHARDAARNFLVGIGL
FT                   KLLVVPAIVLACGLYVFSQQGVPLAVALVQATMPPMIVAGLIAIDKKLDPPLAGALMTL
FT                   GVPVSIAAAWLWRGVLPY"
FT   gene            complement(772403..772714)
FT                   /locus_tag="BMA10247_A0837"
FT   CDS_pept        complement(772403..772714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0837"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0837"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01735"
FT                   /protein_id="ABO01735.1"
FT                   /translation="MRRRCRARRCVTMRLTSKRATRRASARRTRGAFMRRRRANTVRAR
FT                   LRLRLRVRMRLRLRLRVRVRVRVRVRVRVRVRVRVRQAPPFIAAALRQPSRLARPAGL"
FT   gene            complement(772747..774612)
FT                   /locus_tag="BMA10247_A0838"
FT   CDS_pept        complement(772747..774612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0838"
FT                   /product="AMP-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0838"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03736"
FT                   /protein_id="ABO03736.1"
FT                   /translation="MSSIQSALAACRSLTAPPPLAPAANFADVLRYRAETTPDEFAYGY
FT                   LGFGRMPDRVMRYGDIHRRALGIAREIVAHGRPADPVLLIFPSAADFVEAFFGCLYAGR
FT                   MAVPALPPRTEKERRRLISIARDCAPSFAICGNGEMDAVLAELCAAGVVAPPCREVGAI
FT                   ADGGDAGDAPGALPAIAPGSIAFLQYTSGSTSDPKGVMVGHDNLLANERLLRRHWGSDR
FT                   ERWLIVSWLPHYHDMGLIGGILQPIYAGRPAVFMSPQDFLQHPARWLHAVSDYGATCSG
FT                   APNFGYELCRRRASRMDLARLDLSTWEQAFNGAEPVRPRTLREFADAFACAGFRYDAFA
FT                   PCYGLAELTLAATSKQIGESVVIRRADRAALAAGRFEPQQDGGRSVDAVSVGALEHAHQ
FT                   TFCIVDPATGEPQPTGAIGEICVASDSVCHGYFGRPDATEATFHAYRSSAFPDGMLRTG
FT                   DLGFIDEAGHLFVSGQIKDLIILNGINHYPQDIEGAVLNVSDQIRANRLAAIMVERDEQ
FT                   AGVVVVLEAIGRFDLAALAPEIAREVWDACQLTLSSVIRVKKGEIHTTSSGKIQRATCA
FT                   KMLADGAFTIEDAHLHDTARAWLAPVVERCGRACREPSADTPAVA"
FT   gene            complement(774629..775528)
FT                   /gene="fabD-1"
FT                   /locus_tag="BMA10247_A0839"
FT   CDS_pept        complement(774629..775528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD-1"
FT                   /locus_tag="BMA10247_A0839"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="identified by match to protein family HMM PF00698;
FT                   match to protein family HMM TIGR00128"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0839"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02068"
FT                   /protein_id="ABO02068.1"
FT                   /translation="MKALIFPGQGAQAAGMGAGLFERFPEIVATANDVMGLSIERLCLD
FT                   DPHGQLADTRYAQPAIFVVNALHLAAWRDAHDTGDGAPVWLAGHSLGEYSALLAAGVFD
FT                   FRTGLEIVKRRGELFASAGGGAMAAVVGVTAAELGRRLRAAGFDDIDLANLNSAEQTVI
FT                   AGPAASVDAAASMLDAGGDVTVHPLKVSGAFHSRRMTPLKPAFEAFVSRFALAEPARPV
FT                   VSNVTARPYQPPGTPADYLVEQLDQPVRWRDSVRHMLRAGVDEWIELGPGRRILTRLVD
FT                   AIRLEPPERHAAPQPALP"
FT   gene            complement(775529..775960)
FT                   /locus_tag="BMA10247_A0840"
FT   CDS_pept        complement(775529..775960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0840"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0840"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01903"
FT                   /protein_id="ABO01903.1"
FT                   /translation="MKLVLFLHLIFVAAWMSCVIVEGIFEHAIDRSPEQRAFISKLHWT
FT                   TDKYVEIPAFTIVLITGAVLLMHRAPTPLLLTKVAFGTLAIALNAVCVWIVIRRMRYAA
FT                   QADHAAWERIDRLQHKLGGVVAISMLVALGIGGYLFAGG"
FT   gene            complement(776028..777887)
FT                   /locus_tag="BMA10247_A0841"
FT   CDS_pept        complement(776028..777887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0841"
FT                   /product="AMP-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0841"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02573"
FT                   /protein_id="ABO02573.1"
FT                   /translation="MSSLSQQLSALGSRIFTSAPFGPGVSMQNLAEWSSLAHVQLLGRV
FT                   AAEFGVDIDIEEAYRLDSFERLLHYIERQRGPGDEAPPASAASATAAGDAGEAPATIGA
FT                   LLRARAAALPDEPFLFFPADDRSYTYRAFHGLACAAAETLRAHGLARGDRLCVVLPNGP
FT                   EFLAYYFGAHLLGVVSVPINPALTAAECAYIVRNSGAKLVVFDRRMTNLREAVRTELAD
FT                   DRGARLASADAASGFGLEALAAAADHATLAPEPGLAADDDASILYTSGTTGHPKGVVLS
FT                   HRNLLSDARALVDWFAFEPGTRTMCILPLFHNNGQVITLLSPLIAGGSSVILEGKSALP
FT                   SFWKLIDTYRVNWTSVMPAFLSAFLEYGLKRTDDTLRGIVCGGQVLLDEVRSRFETEYR
FT                   VPVFEGFGLTETTSFATMNRHPAERRRFGSIGVALPCNALRIVDANGREAAANETGEIL
FT                   IRGENVAARYHGRAELTAERFRNGWLHTGDYGYRDDDGHFFFATRVDDLIIKGGENIYP
FT                   AEIENVLHGCGDVVECAALGVPDPILGQEVCVYVKLRPASTLGKDDIRRLCEGRIAHYK
FT                   CPRHVVLLNELDDLPELPKGPTRKILRRKLLAHFTTLRERAAA"
FT   gene            complement(777917..779176)
FT                   /locus_tag="BMA10247_A0842"
FT   CDS_pept        complement(777917..779176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0842"
FT                   /product="putative diaminopimelate decarboxylase"
FT                   /note="identified by match to protein family HMM PF00278;
FT                   match to protein family HMM PF02784"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0842"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02922"
FT                   /protein_id="ABO02922.1"
FT                   /translation="MNANLHAFTAADTAPSTEYWWARERLHYRGNALHFCGRDVAELAA
FT                   AFAEPVFLYDPQRALDNVARLQRALGDLQRGDFRLHYAMKANRFRPLLSELRRSPLFGI
FT                   DACSPEELREALACGFAPERISYTAHGMMPDEAALLAALPGVHVNCDTLSAIALLGSRS
FT                   PGREIGIRVNPGVGIGYGDSERLSYAGAAVTKFGIYAEQFGAALELAARHGLAVTWLHC
FT                   HAGCGYLDAQLESFERVLDALDAFAARVPGLRGINLGGGLGLPHRATDRPLDLERWRAA
FT                   VHARFGGRPLAIAIEPGDFIAKDAGMLVLRVAYVELKRNRRFVGLNGGFNLAIEPAFYD
FT                   LPCEPVPCVRRPGPAQSVCVAGNINEALDVWGNDVSLPPVEPGDFIALLNAGGYASSMS
FT                   SNHCLRGQFRELALFDAAPH"
FT   gene            complement(779173..780654)
FT                   /locus_tag="BMA10247_A0843"
FT   CDS_pept        complement(779173..780654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0843"
FT                   /product="FkbH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0843"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03597"
FT                   /protein_id="ABO03597.1"
FT                   /translation="MSARRLYVGATFTASPLDPLLRARGFGDVAFARYNQLLQALVAPD
FT                   PRHADDATLLLVRLADFVRHEANDRAQSPDALAALLAQRADAWLDALASFAAGRARPPC
FT                   IVVLPSPALDARGAAPADTGRRLERALLGVPGLRALDWADFAASSAIAQPFDPIADKLG
FT                   HVPLSIEGFAAFAQWLAERLRGEAGEAAHAGKHGGDAAPAGANANPSARAEADAARSPA
FT                   GAHANVDPHAAADIAAATGRAAAAHPGAEAAGPADAAAARAAVPAHARAPADAPAPAAS
FT                   PAAPSPSLARFFERLQLRIAGVALDDETALAKSARLSHTAATFHLSGRPYLEADLLDAT
FT                   SRDAAALALTAADRFGQYGCSGFVLVRADAGLPVLAEFVLSCTVLGKQVEHGVLLALAQ
FT                   AAQRAALPAVALDYVRTDGNQPAVDFVDAIAAQAGVALDRSGPRARLRIAPCALAEAVL
FT                   ACAKAPQALAAAAQALDLAPLFSHSNATAHPAAHR"
FT   gene            complement(780651..781550)
FT                   /locus_tag="BMA10247_A0844"
FT   CDS_pept        complement(780651..781550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0844"
FT                   /product="putative ketol-acid reductoisomerase"
FT                   /note="identified by match to protein family HMM PF07991"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0844"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03434"
FT                   /protein_id="ABO03434.1"
FT                   /translation="MNDLIYQDEHASLQPLEGLTVTVIGYGIQGRAFAANLRDSGVAVR
FT                   VGNIDDRYFELARAEGHRVTDIAEAVAHADIVLLLIPDEAHGAVFDVDIAPNLREGALL
FT                   CVAHGHSLVQGDVRPLAGRDLAMLAPRMYGDPIRRYYLAGQGAPALVDLVETGFQVLVE
FT                   RGFNPKAALLEVYGSGEMGKMMLDGADIGLDEVVALQGSPTCQVGYHRWRGRTLPAAVR
FT                   ELAARVLDQIDSGDFAAYLKEHAANDYAALDEARRAALKRPLNVAHAQVRAAFRFPTEA
FT                   AGGLYQAAPAGAEPELAR"
FT   gene            complement(781556..793861)
FT                   /locus_tag="BMA10247_A0845"
FT   CDS_pept        complement(781556..793861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0845"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0845"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03927"
FT                   /protein_id="ABO03927.1"
FT                   /translation="MAALTRTARAFQNPTQTIPMTASPPSSALVTAVEAAVLSLAGDVA
FT                   GRAFDASAAACPLHALGFDSVQYVELSGCLNEYYGLDLAPTLFFDVHVPRRIAEHLVAR
FT                   HPAALARKHGIGAGDDADTAARARAAAAENGAPQPDMRAGAARPAGEPLLDTHASPGEP
FT                   RGDAHENPCDDTRGAAAADAHESAADIAIVGMAGIFPQSADLDAFWRHLAAGDDLIAEA
FT                   PASRWDWRAGDGEPASRWGGFIPRIEYFDAAFFGISPREAEQMDPQQRLLMQTAWAALE
FT                   DAAVRPSDLMGSDAAVFVGISTSDYMALLPGADGHLAVGNAHAMLPNRLSHLLGAHGPS
FT                   EAVDTACSSSLVALHRAVRALRRGESSVAIVGGVNVMLTTRLHRALAAAGMLSPDGRCK
FT                   TFDAAANGYVRGEGIAALVLMPLERARANGHPVRAVIKGSAVNHGGRAAFLTAPDINAQ
FT                   AALIEAAYRDAGVDPATVSYIEAHGTGTSLGDPIEVQALRQGLDACARDLAGTASHAPA
FT                   RCGLGSVKTNIGHLEAAAGLAGVVKVVLAMDRRMLPPSLHCRELNPYLKLDGSRYHVVT
FT                   EPTPWPDEATPTPLRAGVSSFGFGGSNAHVVLQSAHARPIARASAPPPPHPNEQAGADA
FT                   PAADGPRAWFIPLSARTDAALHARAAQLAHWLDTEPADDAWLPALAKTLSIGREPMARR
FT                   FGITCASLDELRAQLAIALGGRATSLARDDARLRPHAPACAAWLAGETDPLPAAWDDAT
FT                   PRLRLPVYPFEGERHWPTEAAPAARFALAPDADGAYRIAIAPDAPLVADHRLAGEPVLA
FT                   AAAQIVIAWRAFEADALAGDAGQAGDVGESMESMESMESNGSSASKPAATSADSGTAAD
FT                   SRDLHDSYHSHDFRHTIDTIDTNATSAATPIALCDIEWLAPIAIGAPTDLCITLARDAH
FT                   GDIDARRGEAAHRRANGRAARFAIAAAPAIDTPLGRGHATRIASAPSNAPELDIEAIRA
FT                   RCTQAVSADACYDAFAAIGIDYGPTFRPLRAIAVGRDEALAEFDASALARTTGDARIVA
FT                   LLDGAFQAIAGLTLAHAASLESGLLPASLARIEFTGPLADSVRAWIREAPSDTGRRTFD
FT                   IDLVTASGRSCASLRGLALASGRSATSREAPRITTPGDHLFAPQWLPCATNAAGAATPS
FT                   PRAGALAIMGGTPAQRAALAATRAAAQRLIDDIAELDANVSHLVWLPSAPADAHAPLAQ
FT                   CASLDGLRLVKRLLALGAGDRAFDLTVLTVRSWTMPGDAPAFPAHADLAGLCGALANEY
FT                   PHWRVRLIDLPDAAALPADWHARSAEGGHPLLLHRHGQWFARRLVPLAALPAPAAQPYR
FT                   PGGVYVAIGSAGGLGRVWTEHAIRACGAQVVWIGRRPLDAQIDAHCDALAALGPRPSYL
FT                   SADASDAESLRAARDAVLERFGRLDGVVHTAIVLEDGGLAQLDEARFSAALNAQVATTA
FT                   NLARVFGSDPLDFILFFSSLQSAFVAAGQSNYAAGCTFRDAFADWLRTQLRCAVKVVNW
FT                   GYWGQTGVVATEPYRARMAALGIGSIEPAPAMAVVDALLASNVDQVGYLKTIASAAVPT
FT                   LAPALAARIAPRTRALAGTPPRVDATDDSAAWRDALAALERAIALRLFAELGALRVFGG
FT                   SGAPGGHAFDDGAARNSAAGKCSADDRAPDAAPPTPDAARAEWARARAELERTALLDAH
FT                   LALVDATLDALPAILQGSVPATSILFPDGDLSRVEAVYQRNEQADRCNRALADAVLHLV
FT                   GDASSAQPAALAEIGAGTGGTTVPLLAALDARGARLGRYDFTDISKAFLLNAEQTFGRG
FT                   RDMLRYRLFDVERPIAGQALDTGGYDIVIATNVLHATQDIGVTLRNAKALLKAGGHLII
FT                   NELLGTHGFAHATFGLLPGWWRHRDSARRLPGSPLLSRDGWTRALREAGFAVLDGGSAG
FT                   AAAGQGVIVALSDGVIVQPSHADARAASCAASRAAPGDDAGAHASAARPAASACSTASP
FT                   AHAPAASPIAAAPTGASLRARCVQALAQLVARTLKMPVGKLAPDQPLGSYGVDSILVIG
FT                   LTKTLRETFGVALSNATLFEHATLNALAEFFVAEHRAACERVLGGDAEPAPNAPNGSNA
FT                   ASAAAATRPAMPPARAGAPSPAAASAAPKPRESNVCAPPSADDTAVAVIGMSGRYAQAD
FT                   NLREFWANLRAGRHCITEVPAERWDWRTHFDAEKGAPGRTYSRWGGFLTQIDRFDAAFF
FT                   RIAPNDAEQIDPQGRLFLEESWAAIEDAGYTSDTLSADRRVGVFVGVMNGDYPTGAQFW
FT                   SIANRVSHALDLHGPSLAVDTACSSSLTAIHLALDSLRSGTCDCALAGGVNLIQSPKHL
FT                   VGLASLTMLSAGDACRAFGAGADGFVDGEGVGVLVLKPLSRALADGDAIHGIIRGSMIN
FT                   AGGKTHGLTVPNPRAQQAVVGAALARSGVPARAVGYIEAHGTGTALGDPIELAGLTRAF
FT                   AEATDELGFCALGSVKSNIGHCESAAGVAGVTKVLLQMKHRELVPTLHAHEPNPDIDFA
FT                   RSPFVLQRTLAPWPQPALDGWPRIAGVSSFGAGGANAHVVLEEFIETRAAAGGDDAGPA
FT                   IVVLSAATDAALRRRARQLHAALAAGEIGDERLHDLAYTLQIGRAAMVSRFGCVAGSAA
FT                   ELQAQLAAFVEGDASRGWHAHRLAGDRRGLAELDADPELRASLVEQCVAAGKLDRLAAL
FT                   WCQGLGIDWPALHRGRARRRMHLPTYPFDGPRYWLRDDAAHAAEPAPADGAAEDASADA
FT                   PNAANAPTPDVATLVRRTVAQVLGYPDVDMNESFLSLGGDSIRAARAHRVLQRALDTRI
FT                   PLSLMLEASTLAECAQAIDALLSTQPEPASALACETNAGAAGAPIADAAAFESSAPPSR
FT                   ESASPPHPASPPRDARPRVHPLSSNQQQFFFLDRLNPANPAFNLPGALRVRGEWHAHAL
FT                   EATYQALIDTHDVLRTRFVVRGGEPCAEVAPHRAAAIRRHDLTALLPKHQAARVAECLT
FT                   ESSREGFALEQGEPSRLTVLELRDDDHVILLNLHHIVGDAVSVVVLLDALARAALTGRA
FT                   AAPDRARPQYAQWAAHERDALPATIARELPYWLERLRDVPPPLPLPCDRARPPVPSYRG
FT                   RSVPLAFAPALITLLDAYCKAHGLSRFVVMLAAFKLALRVLSGRDDVVVGSPYANRAED
FT                   DTADMIGSLAYALVLRTRLGEAQTFADAVALVRRTVHGAFDHLGVPYPRLVEALNPARH
FT                   GGANPLYQIMFNVIPMPALPEGVEPVEVDSGWLDYDLFVRLRASSHAIDGVLQFSADLF
FT                   DRSTAEAIAAYYVELLHTLLAHPSLPLASLAPPAELALERTIADAMPPLRIEIASTFTD
FT                   RPLAGTLRYWGTATGQPIEPNFAPYGQLFQTLYDPSTPFHANRHGTNVVLVRPCDWLRF
FT                   DDANADAARADLTGDAGAAAAERIALYADELADALRDAAPSLAVPVLVLVLPDDAASLA
FT                   ARDEHTGTATEAPAEALADARAGKPSPDTSLAPYRMLRAALADLPSITVAHWRDVAAIY
FT                   PVADVFDPHADAAGHVPFTSEYYAALASYIARTAFQHASVPLDDAWNRLAAQIRDDAEH
FT                   LLAAPADGARARRAPHAAPTNETQATLLPIFAAALKLDDPGIDDNFFDCGGHSILAIGV
FT                   VHQINEAFGTSLSVADIFMAPTVRRLAERMRDAPDGPEYVELASAAALPDDIAPLPGPV
FT                   ADAPRALLLTGATGFVGRHLLRELIDRTSATIYCLVRAPDAAQGLARIRATLGRWSLWR
FT                   DGDAARVIAVPGDLGRPRIGLSDAARARLVAEVDAIYHNGTSMNHLESFEMARAANVGG
FT                   VIELLRIATEGRPKTFNYVSTLAVFSMRERTGTHVFDEAAPIDGERHPSDQGYTTSKWV
FT                   GEQLTHLAAARGVPCNVFRLGLVTGDVRHGHYDELQAYYRLLKSCILMGAAFDDFRYDL
FT                   VITPVDYVARALAHLGARHSQGGRVFHLSTMQVTPMRTVFEMMNAHLRTPMRMLTHRAW
FT                   IDELRVRYRRGDVQSIVPVVQWMMNMSDAELVKLAREREETTFIYDCTATHRELEQAGI
FT                   VVPVFDDALLQRYLRGMFNDDADLRALAARLDGGECASPLHSHT"
FT   gene            complement(793849..795261)
FT                   /locus_tag="BMA10247_A0846"
FT   CDS_pept        complement(793849..795261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0846"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /EC_number="1.2.1.3"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0846"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02408"
FT                   /protein_id="ABO02408.1"
FT                   /translation="MLINGLCIEGGGEPLSIVDPATGEPLAAPAAASAADLERAVAAAE
FT                   AAFPAWRATTPATRASLLLALADEIDRQAGALARIESRNTGKPLHLVVQDELLAVADCF
FT                   RFYAGAARTASGPSAGEYVEGHTSMVRRDPIGVVAQIAPWNYPLMMAAWKLAPALAAGN
FT                   TIVFKPSEWTPLSIVALEAALARIFPTGVVNIVLGDGASVGRALATHPRVRMISLTGSV
FT                   EAGKSVLAAAAGNLKRTHLELGGKAPVLVFDDADLDAAVAGIRYAGFYNAGQDCTAATR
FT                   IYVQRGIYDTLAQRLADAASTLRVGPPDRADAEMGPLVSAAHRARVERFVREAAALRHA
FT                   RVLTGGAPLPGPGCYYAPTVIAGVRHDDAPMRREAFGPVVTLTPFDTESQALRWANDSE
FT                   YGLASSVWTRDAARGMRLAACIDAGVTWVNAHFTYTADMPHGGTKQSGYGSDLSTLGLA
FT                   DYTQPRHVMWRH"
FT   gene            complement(795255..796676)
FT                   /locus_tag="BMA10247_A0847"
FT   CDS_pept        complement(795255..796676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0847"
FT                   /product="putative
FT                   adenosylmethionine-8-amino-7-oxononanoate aminotransferase"
FT                   /note="identified by match to protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0847"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01649"
FT                   /protein_id="ABO01649.1"
FT                   /translation="MAYRNDSLLTSAQQDTRHLLHPWADLSALGRETPTVIVEAQGTRV
FT                   TDAEGRTYLDAIGGMWCVTLGYGRREIADAIRDQALRMPFYTPFGAMTNEPAAALGARL
FT                   AELAPGDLKRVHLTTCGSTAVESALRFAHYYFGATGRPRKRHIVTRGDAYHGSTYLAAS
FT                   ISGKAWDRTCFHYDSTIVHHLSSPNPYRRPAGMSVDAFCASLVDEFDALIAKLGAEQIA
FT                   CFIAEPILASGGVIVPPPGYLAAMRERCRRHDILYISDEVVTGFGRVGHFFASHAHFGI
FT                   EPDMIVVAKGLTSGYQPLGAVLISERLVDAVSGEHAYGNGVFTNGFTYSGHPVACAAAL
FT                   ANIELMERERICEHVRDVGPYFIRRLDALRRLPIVGDVRGDHLMACIECTSGAGATGAL
FT                   PTPADIAIAQRVDRHCEEMGLLVRPYESMCILSPPLTVTRADIDEICAILAAALERTQR
FT                   ELAQHAPVREENETC"
FT   gene            complement(796685..797710)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0848"
FT                   /note="putative syringomycin synthesis regulator SyrP; this
FT                   gene contains a premature stop which may be the result of a
FT                   sequencing error"
FT   gene            complement(797979..798107)
FT                   /locus_tag="BMA10247_A0849"
FT   CDS_pept        complement(797979..798107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0849"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0849"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03585"
FT                   /protein_id="ABO03585.1"
FT                   /translation="MAGFGVRAGDRGIGANVAAYAPAGVATPLDARMCAATTHRCR"
FT   gene            complement(798726..799244)
FT                   /locus_tag="BMA10247_A0850"
FT   CDS_pept        complement(798726..799244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0850"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0850"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01930"
FT                   /protein_id="ABO01930.1"
FT                   /translation="MTITLIEPVQQRTGIYPSSDLKVEDGYPSSDTFQIIQTQDGRGAG
FT                   VRVLKAFARGRRMARVSGQITAFCRLHTLQINAHTHLYDPHFSGLLLHSCDPNVRLDMA
FT                   GFELWSLRDIAAGEMLTMDYASTEDVLMRQFECHCGAPNCRRWITGAKELPNDSGQTLL
FT                   AGLRAAEIA"
FT   gene            complement(799344..807458)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0851"
FT                   /note="thiotemplate mechanism natural product synthetase;
FT                   this gene contains a frame shift which may be the result of
FT                   a sequencing error; identified by match to protein family
FT                   HMM PF00106; match to protein family HMM PF00109; match to
FT                   protein family HMM PF00501; match to protein family HMM
FT                   PF00550; match to protein family HMM PF00698; match to
FT                   protein family HMM PF00975; match to protein family HMM
FT                   PF02801; match to protein family HMM PF08659"
FT   gene            complement(808238..808675)
FT                   /locus_tag="BMA10247_A0852"
FT   CDS_pept        complement(808238..808675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0852"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0852"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03284"
FT                   /protein_id="ABO03284.1"
FT                   /translation="MSADSTRTTQASADDRTGHARKTVRARGAPGLVAERSVLDGRRAA
FT                   RGAPRCCGDGPSPQRIGNGISDYFGQSKVQFAFKLSQIISYIEIKTAPRARIHPGQEGN
FT                   PIEFPNLFFGIYIIKFINAAYIIFPDDIYNASNQHCGFRIS"
FT   gene            complement(808692..809012)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0853"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            809055..809771
FT                   /locus_tag="BMA10247_A0854"
FT   CDS_pept        809055..809771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0854"
FT                   /product="autoinducer-binding transcriptional regulator,
FT                   LuxR family"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF03472; match to protein
FT                   family HMM PF04967"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0854"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02230"
FT                   /protein_id="ABO02230.1"
FT                   /translation="MFEGLSIGSFNEILNATCKKSLFEQTAYHVRQLGFKNFAYRHQIS
FT                   GAASSRCMLDGFPAEWRLRYDAADYLSIDPVVQHCRCRTVPLIWHDDLYTTSRAKLMRD
FT                   EAKSYGLVYGLSCPVHDRSGAISMLSMATDDPFEHDASDILRLLSLSQLLASFVHAAMH
FT                   ELLDCRLRRQGSCDLTARERESLQWAGRGKTAWEISKILGISERTVVFHLSNAARKIGA
FT                   NNRAQAVVIASARGLI"
FT   gene            complement(809934..810059)
FT                   /locus_tag="BMA10247_A0855"
FT   CDS_pept        complement(809934..810059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0855"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0855"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03053"
FT                   /protein_id="ABO03053.1"
FT                   /translation="MQAKLPAPTLLRGGAAASFRNELRSMIGPGGEDGLRSDFAK"
FT   gene            810101..810940
FT                   /locus_tag="BMA10247_A0856"
FT   CDS_pept        810101..810940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0856"
FT                   /product="putative D-methionine-binding lipoprotein metQ"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0856"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02421"
FT                   /protein_id="ABO02421.1"
FT                   /translation="MQSRLFLARLLRRASRAAAAAFALAVFAEFAVPLAHADSTPLKVG
FT                   IATSPQIDALKVAAKEAKAQGLDVKIIEFTDWNTPNAALANQDIDVNYFQHIPFLENAK
FT                   KQRGYDFVAIAPGTIMKIGLYSKKIKSFDQLKNGATVAIANDPVNGGRGLLLLQRAGLI
FT                   ALKPGADYRATTRDIVSNPKHLKILQLEASQLARSLDDVDLAQGYPSFIKLAGTADPNG
FT                   ALLFDGLENKLFALQWVVRPERANDPRIRRFIAIYQHSPAVRQALDDAFGRLYAIAW"
FT   gene            810934..812352
FT                   /locus_tag="BMA10247_A0857"
FT   CDS_pept        810934..812352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0857"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0857"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02811"
FT                   /protein_id="ABO02811.1"
FT                   /translation="MVKPQARAMTNKKILLNAFDMNCVGHINHGLWTHPRDRSAQYTDL
FT                   DYWSDLARTLERGKFDAIFLADIVGVYDVYGGGPDLALRESVQVPVNDPLLLVPAMAQV
FT                   TKHLGFGVTANLTYEPPYLFARRMSTLDHLTKGRIGWNIVTGYLDSAARGMGLARQIGH
FT                   DDRYARADDYMEVVYQLWERSWDDDAVIRDRAARVFARPDKVRRVRHDGPYYSVDAIHL
FT                   SEPSPQRTPVLYQAGASARGVEFAAKHAECVFVNGQSKAAARSAVADIRAAAARIGRDP
FT                   ASIKVFAGITVVTDENERAAREKFDEYRRHANPEAGLAHFASSTGIDFSRFGLDEPIAH
FT                   VKTDSIQSAVDAISKKSASGAWTVRRMLEQMSIGGRYQPVVGSPSQVADELAAWVDETD
FT                   VDGFNVTRTVVPESFDDFVDRVVPALQDRGLYKEDYDRAPTLRAKLFGAGGRLPDWHAG
FT                   ARHRFGCARETART"
FT   gene            812349..813563
FT                   /locus_tag="BMA10247_A0858"
FT   CDS_pept        812349..813563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0858"
FT                   /product="ABC transporter, methionine uptake transporter
FT                   (MUT) family, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF09383"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0858"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03833"
FT                   /protein_id="ABO03833.1"
FT                   /translation="MIERRGDPMAQLLDSPGFIERSAAVPHKAAAAPATRDAAAPAAVP
FT                   GAAVSFELVGKVFDGPRGPAAALREVTLDIARGGVFGVIGRSGAGKSTLLRLVNGLERP
FT                   TSGAVRVNGVDVGTLDERGLVALRRRIGMVFQHFNLLSAKTVAQNIGLPLKIAGVPKAE
FT                   RARKVDALLDLVGLAAKRDAYPASLSGGQKQRVGIARALVHDPALLLCDEATSALDPET
FT                   TQSILALLADINRRLGLTIMLITHEMEVIRAVCDTVAVVEQGEVVETGPVWRVFGDPRH
FT                   GATRALLRTLAHDLPADLAAHVRPLDGAAPLPCGAQLLLDVRYTGASGGEPDLGALTAA
FT                   LARNVGDAVHFVHGGLDRIQGRVQGRLVIAASLAARGAAGPDRIAAALAAARRHANRVE
FT                   VLGYV"
FT   gene            813556..814212
FT                   /locus_tag="BMA10247_A0859"
FT   CDS_pept        813556..814212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0859"
FT                   /product="ABC transporter, methionine uptake transporter
FT                   (MUT) family, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0859"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03322"
FT                   /protein_id="ABO03322.1"
FT                   /translation="MSELWLPELADAIRDTLWMVGASALVAALVGVPLALVLVTTAPGG
FT                   LYERRGVNAALGAIVNAFRSTPFVILLVALLPFTRFVIGTTIGVWAAIVPLSIAAIPFF
FT                   ARIAEVSLREVDKGLVEAAQAMGAERRHIVLHVLLPEALPGIVGGFTITVVALIGSTAM
FT                   AGAVGAGGLGDLAIRYGYQRFDTAVMATVIAILIALVTVVQFTGDRVVRRLAKRA"
FT   gene            complement(814357..814545)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0860"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            complement(814833..814964)
FT                   /locus_tag="BMA10247_A0861"
FT   CDS_pept        complement(814833..814964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0861"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0861"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01965"
FT                   /protein_id="ABO01965.1"
FT                   /translation="MAGLPVDAAAARDITRAHALRRLVWSIARLAVWCASNTSAGHL"
FT   gene            815007..816161
FT                   /locus_tag="BMA10247_A0862"
FT   CDS_pept        815007..816161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0862"
FT                   /product="monooxygenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0862"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01805"
FT                   /protein_id="ABO01805.1"
FT                   /translation="MTEQAGRTPRTLAELIAALRASAPERDRAGGHAAREKRWIADAGL
FT                   LTLAVPREFGGQEAGWPVIYHTIRALAHLLGFQCLQIVSVDVWGSAAQRERYLRGTVEH
FT                   DWWWGNAVNPLDTRLVARATGDGGYRLDGVKGFCSGTRGSQRMTVSAHDSVTGKPVFAV
FT                   VPTQREGIAVRDDWDPIGQRQTDSGSVAFDGVRVVPDEVLHRSEAPPTPRATLRALVSQ
FT                   LVLTNLFVGIAEGALAEARDYVQRAGRPWLHSGVERAADDPYTLQRFGDMRVQTVSAEA
FT                   LADRAARALQGAWAKHDALTADARAEVALAISEAKIVAQRAALDVSEALFDACGARATA
FT                   APLALDRFWRNARTYTLHDPLDYRLRDVGRYALTGALPDASLYT"
FT   gene            complement(816263..817021)
FT                   /locus_tag="BMA10247_A0863"
FT   CDS_pept        complement(816263..817021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0863"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0863"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03622"
FT                   /protein_id="ABO03622.1"
FT                   /translation="MKARPMLEYALHPLEDRLVHVDELCRADPVPRGWARCPLCLEALY
FT                   VVQLRDRSHARRFAHLAGEFARCPLVNDALPNPLAVHVGPPLDEHGRQARATFFRHWQR
FT                   HLHTIRQTASAFGIARFMRAIELADVLKLWAWPTLAQRDIPYILLVLTEFIAAPRGERK
FT                   QAAWSRFWFDASVQRVDDLRKPRGVLPRLFRLRYRLPRMSKFPNARHLIDCQPVLMNDI
FT                   GPSDAALGTPRADIAMFEAFAARFARRPAE"
FT   gene            817020..817373
FT                   /locus_tag="BMA10247_A0864"
FT   CDS_pept        817020..817373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0864"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0864"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02825"
FT                   /protein_id="ABO02825.1"
FT                   /translation="MSVPVRPGRRGARAPAPDASLEINEERSQPENRYPESDTRYVTRR
FT                   CAVRDGRRFSRRRAAPRRNRMPGRRRRPGPRGCSPYRGNVRGARARASFVAAIGHAAAS
FT                   RAGGRKGVFANPL"
FT   gene            complement(817386..817952)
FT                   /locus_tag="BMA10247_A0865"
FT   CDS_pept        complement(817386..817952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0865"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0865"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02639"
FT                   /protein_id="ABO02639.1"
FT                   /translation="MSPDHPWNSLEIVKLAAEVLTPVSVAAFGWLVSHRLKQLELVQWT
FT                   NQKLIEKRLALYDTIAPLLNRLLCFYTWVGPWKDISPDDVIRAKRELDQTIHIYRHLFD
FT                   DDVYRAYQAYLDALFDTHSGAGRDARIKSTIASPDGDRIGNGTYRWNPAWAERFTDANV
FT                   ASRDEVRARYQRIMDGLRISLGVAR"
FT   gene            complement(818006..818839)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0866"
FT                   /note="transcriptional regulator, GntR family; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00392; match to protein family HMM PF07729"
FT   gene            819117..819923
FT                   /locus_tag="BMA10247_A0867"
FT   CDS_pept        819117..819923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0867"
FT                   /product="cysteine-rich domain protein"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0867"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03687"
FT                   /protein_id="ABO03687.1"
FT                   /translation="MDSSPQTAGAPGGTRETPRVGLFVTCLANLFRPSAALAAVQLLEA
FT                   AGCAVDAPRAQTCCGQPALNSGDFDDARGIARRTIEAFERYDYVVAPSGSCIRTLRHDY
FT                   PDLLANDPAWRPRAERLAARAHELTSFLVDVLGWAGPERAAVPECTLTYHDTCSGLRGL
FT                   GIKAQPRALLARVEGVALTEMKDAEVCCGFGGTFCVKYPEISTKIVSDKTANVAASGAT
FT                   VLAGGDLGCLMNIGGRLKREGSAVRVYHVAEVLAGMNVEPICGEGE"
FT   gene            819935..821368
FT                   /locus_tag="BMA10247_A0868"
FT   CDS_pept        819935..821368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0868"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by similarity to GP:17428628; match to
FT                   protein family HMM PF00037; match to protein family HMM
FT                   PF02589; match to protein family HMM TIGR00273"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0868"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03059"
FT                   /protein_id="ABO03059.1"
FT                   /translation="MNAPATFKARARAALHDAQLQEALGMLGEGWIEKRRRVVSLLPEF
FT                   EMLRERAKAVKDHVLANLDTYLERYEAAVTRAGGVVHWASDAAQAREIVLRICRDANAK
FT                   TITRGKSMVGEEIGLPAALEGAGMEVVETDLGEYIVQLAHEGPSHIVFPALHKTIGQVT
FT                   ELFAGNHSSAQYDGPRETVADVVGEARQVLREKFFVADVGITGANYLVAETGSNVICTN
FT                   EGNGDLTSTLARVHIVTAGIERVVPTLDDVALFVRLLGRSATGQEITSYTTFSTGPRRG
FT                   DDLDGPQEYHVVLVDNGRTRMLAGEFRDMLRCIRCGACMNHCPVYGAVGGHAYGWVYPG
FT                   PMGAVLTPLLQGIEHDTDLPNACTLNGRCAEVCPVKIPLPTLLKKLRGMQFDARLTAPG
FT                   TRFLLRAFGAIARRPALYHWLTRVGARALRALGGKRGSIARVPFASGWTDSRELPKPPP
FT                   RTFFETWDATCTNQPEVRR"
FT   gene            821365..822090
FT                   /locus_tag="BMA10247_A0869"
FT   CDS_pept        821365..822090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0869"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02589"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0869"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03738"
FT                   /protein_id="ABO03738.1"
FT                   /translation="MSARDDILGRIRAALGSERARLAAQFPAPVQAKGAGASAAPNANA
FT                   AFAPDASLSTASSAARDSAISLGDVDLVARFVAKAQQVSATCTHIATAAGAPAAVDAYL
FT                   RDAGLADAPLVVAAALDALPWRAHRALPGVDLRRDGLVSVTPSFAAIAETGSVVCLSSS
FT                   ATPTSLNFVAATHVVLVNRSAIVATMEDAWARVRATIATLPRAVNVITGPSRTADVEQT
FT                   VQVGVHGPKRVLVLICDDA"
FT   gene            822458..824176
FT                   /locus_tag="BMA10247_A0870"
FT   CDS_pept        822458..824176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0870"
FT                   /product="transporter, lactate permease (LctP) family"
FT                   /note="identified by match to protein family HMM PF02652;
FT                   match to protein family HMM TIGR00795"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0870"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02119"
FT                   /protein_id="ABO02119.1"
FT                   /translation="MQVWNQVYLPLGGVGWSALAAGAPIILFFVSLAVLRLKGHVAGAL
FT                   TLALALVIAIAVYGMPAERAFASAAYGFAYGLWPIAWIIVTAVFLYKIVVKSGQFDVIR
FT                   SSIVSLTDDQRLQMLLIGFSFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIA
FT                   DTAPVAFGALGIPVIVAGQVSGLDPMAVGAMAGRQLPFLSFFLPFWLVFVMDGVKGVRE
FT                   TWPAALVAGGSFALVQFFTSNYIGPELPDVTSALASLVALASFLKVWRPLRAREAARAQ
FT                   RLVSAGGGALALGGMPGGLGGARATGGREPSPYSFAQIARAWSPFVVLTVMVTIWSMKP
FT                   FKALFAKGGALAFTTLQFHVAHLDKLTQKMAPVVAHPTPVPAVFNWDLLAATGTAILLS
FT                   AIVSMAILNVPARTGVRTFFEVLKDLKRPVLSIGLVLAFAFVENYSGMSTTLALLLAGT
FT                   GAAFPFFSPLLGWIGVFLTGSDTSSNALFCSLQATTAQQIGVPSTLLVAANTTGGVAGK
FT                   MISPQSIAVACAAVGLVGHEADLFRFTLRHSLFFALVVGVMTCVQAYWLTGMIVH"
FT   gene            824245..824508
FT                   /locus_tag="BMA10247_A0871"
FT   CDS_pept        824245..824508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0871"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0871"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02184"
FT                   /protein_id="ABO02184.1"
FT                   /translation="MFESPESPESPEAFEAFEAFDPAVHTGGERARTRRTAAFTRVSYG
FT                   LPCKDLLQPFAWNDGRDLLFWRIYEIRRARRGVRRLIRGGHA"
FT   gene            824505..824942
FT                   /locus_tag="BMA10247_A0873"
FT   CDS_pept        824505..824942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0873"
FT                   /product="DoxD-like family protein"
FT                   /note="identified by match to protein family HMM PF07681"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0873"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01731"
FT                   /protein_id="ABO01731.1"
FT                   /translation="MTRSVDSGVIFFARLLLAVLFLWGGAMKLMGYGEFVGYLKGLGVP
FT                   FTQVAAPVIVALEAIGGVLLIVGYQVKPLALVLALYTLAAALIGHNFWDATSSALQRDM
FT                   VVHFWKNVAIAGGFLLLYVTGAGGASIDGARRPSSSYGSLR"
FT   gene            complement(824919..825104)
FT                   /locus_tag="BMA10247_A0872"
FT   CDS_pept        complement(824919..825104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0872"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0872"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03606"
FT                   /protein_id="ABO03606.1"
FT                   /translation="MSEDAGAKAKKRPRKREPSGNGIDAVYAARLPNAAGARLRFKRRA
FT                   ARAAHAAKRSAQRSVG"
FT   gene            complement(825138..826673)
FT                   /pseudo
FT                   /locus_tag="BMA10247_A0874"
FT                   /note="putative methylenomycin A resistance protein; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error; identified by similarity to SP:Q00538;
FT                   match to protein family HMM PF07690"
FT   gene            complement(826941..828233)
FT                   /locus_tag="BMA10247_A0875"
FT   CDS_pept        complement(826941..828233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0875"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0875"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03719"
FT                   /protein_id="ABO03719.1"
FT                   /translation="MPASELSAVSSAPPRALTGRDYKTLGLAALGGALEFYDFIIFVFF
FT                   APAIGQLFFPHDIPDWLRQLQTFGIFAAGYLARPLGGIVMAHFGDLVGRKRMFTLSVLL
FT                   MSVPTLLMGLLPTYDSVGILAPVVLLLLRVLQGAAVGGEVPGAWVFVSEHVPPQRIGYA
FT                   CGTLTAGLTIGILLGSLVATAVNSRFSTAEVAAFAWRIPFLLGGVFGLFSVYLRRWLHE
FT                   TPVFAEMKARKTLAAEIPLKAVIRDHGRAVIVSMLITWMLSAAIVVVILMTPTLLQKQF
FT                   HIAPATALFANSIATLCLTAGCITAGSLADRFGAKAVLSIGGVALAACYYAMYTQIAVD
FT                   AARLVPLYGLAGFTVGTIGAVPFVLVKSFPAVVRFSGISFSYNVAYAVFGGLTPVIVSL
FT                   LMKSHSLAPAHYVAAICVLGAVAMLFSKDAE"
FT   gene            complement(828575..829609)
FT                   /locus_tag="BMA10247_A0876"
FT   CDS_pept        complement(828575..829609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0876"
FT                   /product="malate/L-lactate dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF02615"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0876"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03790"
FT                   /protein_id="ABO03790.1"
FT                   /translation="MHDRPDLARPDVVLSLDDVRALALRVLAHHGLSDAHARAIANVIT
FT                   QGQRDECHSHGVYRLLVCARSLRLGKVDPQAVPTLRRLSPSIVAVDAHRGFSLLAFETG
FT                   LPVLVEMARRHGIAAMAINRCYHFSALWPEVEALAAHGLAGLAMNPSHGWVAPEGGTRP
FT                   VFGTNPLAFAWPRPGGTPFVFDFATSAIARGDLELHAKAGKPIPPHWAIDANGAPTTDP
FT                   QAALQGAMRTFGGHKGSALAAMIELLAGALIGDMTSAESLAFDEGASATPCHGELVIAL
FT                   DPKTFLGDALDAGLARGERMFEAIVAQGARLPSQRRFDARARSAAHGVRIPARLHDEIV
FT                   ALLD"
FT   gene            complement(829602..831194)
FT                   /locus_tag="BMA10247_A0877"
FT   CDS_pept        complement(829602..831194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0877"
FT                   /product="aldehyde dehydrogenase (NAD) family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0877"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02055"
FT                   /protein_id="ABO02055.1"
FT                   /translation="MRLTGELLIGQSATFGQHGAFRAIEAATGAPLEPAFGGASLQDLD
FT                   AACALADDAFDAYRETSLDARAAFLDAIGRHIVALGDALIERCAAESGLPRARIEGARA
FT                   RTVGQLALFAAVVRDGGFIDARIDPARAQRKPLPRVDLRLRNIAIGPVAVFGASNFPLA
FT                   FSVAGGDTASALAAGCPVIVKAHGAHPGTSELVGRAIQAAVRECGLPAGVFSLLFDASR
FT                   EIGQALVADPRIKAVGFTGSRRGGVALMRIAAARPEPVPVYAEMSSINPVVLMPGALAA
FT                   RHDAIAQQFVASLTLGAGQFCTNPGLILAIDGPALRAFEKAAAAAIDAAAAQTMLTPPI
FT                   HASYREGVARLASHRAVERLGEGPAGGPFAARAALFATTADALLWHAELRDEVFGPASL
FT                   VVRCADADALHRVLKSLEGQLTIAAHLGERDAPLFAALRPTLERRAGRILVNGFGTGVE
FT                   VGHAMVHGGPFPATSDPRTTSVGARAIERFLRPVSYQDVPDALLPDALRDANPLRVPQR
FT                   IDGALAPREARNA"
FT   gene            complement(831270..833198)
FT                   /locus_tag="BMA10247_A0878"
FT   CDS_pept        complement(831270..833198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0878"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0878"
FT                   /db_xref="EnsemblGenomes-Tr:ABO01967"
FT                   /protein_id="ABO01967.1"
FT                   /translation="MRPPPIAARAALRARCAMRDAADRAPALRFARRRCRAKPPRRLAR
FT                   APQHDSAESAGRAAADRRAPRRRTGRPARRHASAAVTAEAAAAGAPSAPPAAALPCAAA
FT                   PRPPLETIETRPSNQGDKPMPAQGNAQRTAPLARPAPTDAGHGKFKKQLSLTDLTFIGL
FT                   GAIFGSGWLFAASHVSTIAGPAGILSWLLGGFAVLLLGIVYCELGAALPRAGGVVRYPV
FT                   FSHGPLLGYLMGAITLIAFSSLIAIEVVAARQYAAAWFAGLTVEGSGNPTTLGWLVQAA
FT                   LLCFFFYLNYSSVKTFAKANNVISVFKFVVPLAVIVVLFAFFKPANLTLHGFAPFGMPG
FT                   VEMAVSAGGIIFAYLGLTPIVSVASEVRDPQRTIPIALILSIVLSTLIYVLLQLAFLGG
FT                   IPSAMLAGGWLAYMVVADAMISPSGCGNIYMNATPRVVYGWAKTGTFFKVFARVDEASG
FT                   IPRAGLWLTFALALFWTLPFPSWEALINTVSAALVLSYAVAPVSVAALRRTAPGLPRPF
FT                   RASAFALTGPASFVIAALIVYWSGWRTVSWLLGLQIAMFAVYLACRRRVPTAHLSLAEQ
FT                   VRSCAWLIAFYALMIVASYFGGFGGTGQLAHPYDTFAVAAVALVIYYWGAHTGVPSAKL
FT                   QLDDDEN"
FT   gene            complement(833290..834210)
FT                   /locus_tag="BMA10247_A0879"
FT   CDS_pept        complement(833290..834210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0879"
FT                   /product="dihydrodipicolinate synthetase family protein"
FT                   /note="identified by match to protein family HMM PF00701"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0879"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02513"
FT                   /protein_id="ABO02513.1"
FT                   /translation="MSRHAIQWSGVFPAVSTQFKPDFSLDVDATHRVVKNLVNDGVSGL
FT                   VVCGTVGENTSLGTAEKLAVIEAARDAAGGKVPVIAGVAEFTTEFARNTVREAQRVGVD
FT                   GVMVMPALVYSAKPHETAAHFRAVASSTDLPVMVYNNPPIYRNDVTPDVLIALQDCENI
FT                   VCFKDSSGDTRRFVDLRNAVGDRFVLFAGLDDVVVESIAVGAQGWVSGMSNAFPKEGET
FT                   LFRLAKQKRFDEALALYRWFMPLLHLDARPDLVQCIKLCEELVGRGSALTRPPRLALQG
FT                   DTLAHVKAIVAKALETRPTLPDVGL"
FT   gene            complement(834221..834403)
FT                   /locus_tag="BMA10247_A0880"
FT   CDS_pept        complement(834221..834403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0880"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0880"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03343"
FT                   /protein_id="ABO03343.1"
FT                   /translation="MWVFDDARDEIGTARRARRRSRPDCADFIFSRLEKAQASRRADGD
FT                   TGSRTDAPVGHLIRT"
FT   gene            834461..835393
FT                   /locus_tag="BMA10247_A0881"
FT   CDS_pept        834461..835393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_A0881"
FT                   /product="putative proline racemase"
FT                   /note="identified by match to protein family HMM PF05544"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_A0881"
FT                   /db_xref="EnsemblGenomes-Tr:ABO02898"
FT                   /protein_id="ABO02898.1"
FT                   /translation="MKHIHIIDSHTGGEPTRVVVSGFPALGGGTMAERLAVLAREHDRY
FT                   RAACILEPRGSDVLVGALLCEPVSAGAAAGVIFFNNAGYLGMCGHGTIGLVRTLHHMGR
FT                   IGPGVHRIETPVGDVEATLHDDLSVSVRNVLVYRHAKDVVVDVPGHGAVTGDVAWGGNW
FT                   FFLVSDHGQRVAGENVAALAAYASAVRAALERAGVTGRDGAPIDHIELFADDPEYDSRS
FT                   FVLCPGHAYDRSPCGTGTSAKLACLAADGKLVAGVTWRQASVIGSVFSASYAAAEGGVV
FT                   PTIRGSAHLSAEATLVIEDDDPFGWGIAS"
FT   gene            835390..836541
FT