(data stored in SCRATCH3701 zone)

EMBL: CP000548

ID   CP000548; SV 1; circular; genomic DNA; STD; PRO; 3495687 BP.
XX
AC   CP000548; AAHP01000000-AAHP01000408;
XX
PR   Project:PRJNA13946;
XX
DT   28-FEB-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Burkholderia mallei NCTC 10247 chromosome I, complete sequence.
XX
KW   .
XX
OS   Burkholderia mallei NCTC 10247
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; pseudomallei group.
XX
RN   [1]
RP   1-3495687
RA   DeShazer D., Woods D.E., Nierman W.C.;
RT   ;
RL   Submitted (05-JAN-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [2]
RC   Protein update by submitter
RP   1-3495687
RA   Brinkac L.M., Harkins D.M., Shrivastava S., Durkin A.S., Sutton G.;
RT   ;
RL   Submitted (21-OCT-2009) to the INSDC.
RL   The J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850,
RL   USA
XX
DR   MD5; ce82fed7cf6457f4b9a131c261a20d27.
DR   BioSample; SAMN02604033.
DR   EnsemblGenomes-Gn; BMA10247_0022.
DR   EnsemblGenomes-Gn; BMA10247_0137.
DR   EnsemblGenomes-Gn; BMA10247_0155.
DR   EnsemblGenomes-Gn; BMA10247_0412.
DR   EnsemblGenomes-Gn; BMA10247_0450.
DR   EnsemblGenomes-Gn; BMA10247_0451.
DR   EnsemblGenomes-Gn; BMA10247_0452.
DR   EnsemblGenomes-Gn; BMA10247_0590.
DR   EnsemblGenomes-Gn; BMA10247_0772.
DR   EnsemblGenomes-Gn; BMA10247_0789.
DR   EnsemblGenomes-Gn; BMA10247_0961.
DR   EnsemblGenomes-Gn; BMA10247_0972.
DR   EnsemblGenomes-Gn; BMA10247_1022.
DR   EnsemblGenomes-Gn; BMA10247_1024.
DR   EnsemblGenomes-Gn; BMA10247_1221.
DR   EnsemblGenomes-Gn; BMA10247_1228.
DR   EnsemblGenomes-Gn; BMA10247_1247.
DR   EnsemblGenomes-Gn; BMA10247_1372.
DR   EnsemblGenomes-Gn; BMA10247_1373.
DR   EnsemblGenomes-Gn; BMA10247_1375.
DR   EnsemblGenomes-Gn; BMA10247_1426.
DR   EnsemblGenomes-Gn; BMA10247_1510.
DR   EnsemblGenomes-Gn; BMA10247_1539.
DR   EnsemblGenomes-Gn; BMA10247_1665.
DR   EnsemblGenomes-Gn; BMA10247_1776.
DR   EnsemblGenomes-Gn; BMA10247_1777.
DR   EnsemblGenomes-Gn; BMA10247_1827.
DR   EnsemblGenomes-Gn; BMA10247_1828.
DR   EnsemblGenomes-Gn; BMA10247_1952.
DR   EnsemblGenomes-Gn; BMA10247_1960.
DR   EnsemblGenomes-Gn; BMA10247_1961.
DR   EnsemblGenomes-Gn; BMA10247_1969.
DR   EnsemblGenomes-Gn; BMA10247_1985.
DR   EnsemblGenomes-Gn; BMA10247_2036.
DR   EnsemblGenomes-Gn; BMA10247_2342.
DR   EnsemblGenomes-Gn; BMA10247_2361.
DR   EnsemblGenomes-Gn; BMA10247_2743.
DR   EnsemblGenomes-Gn; BMA10247_2931.
DR   EnsemblGenomes-Gn; BMA10247_3069.
DR   EnsemblGenomes-Gn; BMA10247_3180.
DR   EnsemblGenomes-Gn; BMA10247_3256.
DR   EnsemblGenomes-Gn; BMA10247_3458.
DR   EnsemblGenomes-Gn; BMA10247_3459.
DR   EnsemblGenomes-Gn; BMA10247_3460.
DR   EnsemblGenomes-Gn; BMA10247_3462.
DR   EnsemblGenomes-Gn; BMA10247_3540.
DR   EnsemblGenomes-Gn; BMA10247_3541.
DR   EnsemblGenomes-Gn; BMA10247_3542.
DR   EnsemblGenomes-Gn; BMA10247_3543.
DR   EnsemblGenomes-Gn; BMA10247_3544.
DR   EnsemblGenomes-Gn; BMA10247_3555.
DR   EnsemblGenomes-Gn; BMA10247_3560.
DR   EnsemblGenomes-Gn; BMA10247_3562.
DR   EnsemblGenomes-Gn; BMA10247_3563.
DR   EnsemblGenomes-Gn; BMA10247_3565.
DR   EnsemblGenomes-Gn; EBG00001203360.
DR   EnsemblGenomes-Gn; EBG00001203361.
DR   EnsemblGenomes-Gn; EBG00001203362.
DR   EnsemblGenomes-Gn; EBG00001203363.
DR   EnsemblGenomes-Gn; EBG00001203364.
DR   EnsemblGenomes-Gn; EBG00001203365.
DR   EnsemblGenomes-Gn; EBG00001203366.
DR   EnsemblGenomes-Gn; EBG00001203367.
DR   EnsemblGenomes-Gn; EBG00001203368.
DR   EnsemblGenomes-Gn; EBG00001203369.
DR   EnsemblGenomes-Gn; EBG00001203370.
DR   EnsemblGenomes-Gn; EBG00001203371.
DR   EnsemblGenomes-Gn; EBG00001203372.
DR   EnsemblGenomes-Gn; EBG00001203373.
DR   EnsemblGenomes-Gn; EBG00001203374.
DR   EnsemblGenomes-Gn; EBG00001203375.
DR   EnsemblGenomes-Gn; EBG00001203376.
DR   EnsemblGenomes-Gn; EBG00001203377.
DR   EnsemblGenomes-Gn; EBG00001203378.
DR   EnsemblGenomes-Gn; EBG00001203379.
DR   EnsemblGenomes-Gn; EBG00001203380.
DR   EnsemblGenomes-Gn; EBG00001203381.
DR   EnsemblGenomes-Gn; EBG00001203382.
DR   EnsemblGenomes-Gn; EBG00001203383.
DR   EnsemblGenomes-Gn; EBG00001203384.
DR   EnsemblGenomes-Gn; EBG00001203385.
DR   EnsemblGenomes-Gn; EBG00001203386.
DR   EnsemblGenomes-Gn; EBG00001203387.
DR   EnsemblGenomes-Gn; EBG00001203388.
DR   EnsemblGenomes-Gn; EBG00001203389.
DR   EnsemblGenomes-Gn; EBG00001203390.
DR   EnsemblGenomes-Gn; EBG00001203391.
DR   EnsemblGenomes-Gn; EBG00001203392.
DR   EnsemblGenomes-Gn; EBG00001203393.
DR   EnsemblGenomes-Gn; EBG00001203394.
DR   EnsemblGenomes-Gn; EBG00001203395.
DR   EnsemblGenomes-Gn; EBG00001203396.
DR   EnsemblGenomes-Gn; EBG00001203397.
DR   EnsemblGenomes-Gn; EBG00001203398.
DR   EnsemblGenomes-Gn; EBG00001203399.
DR   EnsemblGenomes-Gn; EBG00001203400.
DR   EnsemblGenomes-Gn; EBG00001203401.
DR   EnsemblGenomes-Gn; EBG00001203402.
DR   EnsemblGenomes-Gn; EBG00001203403.
DR   EnsemblGenomes-Gn; EBG00001203404.
DR   EnsemblGenomes-Gn; EBG00001203405.
DR   EnsemblGenomes-Gn; EBG00001203406.
DR   EnsemblGenomes-Gn; EBG00001203407.
DR   EnsemblGenomes-Gn; EBG00001203408.
DR   EnsemblGenomes-Gn; EBG00001203409.
DR   EnsemblGenomes-Gn; EBG00001203410.
DR   EnsemblGenomes-Gn; EBG00001203411.
DR   EnsemblGenomes-Gn; EBG00001203412.
DR   EnsemblGenomes-Gn; EBG00001203413.
DR   EnsemblGenomes-Gn; EBG00001203414.
DR   EnsemblGenomes-Gn; EBG00001203415.
DR   EnsemblGenomes-Gn; EBG00001203416.
DR   EnsemblGenomes-Gn; EBG00001203417.
DR   EnsemblGenomes-Gn; EBG00001203418.
DR   EnsemblGenomes-Gn; EBG00001203419.
DR   EnsemblGenomes-Gn; EBG00001203420.
DR   EnsemblGenomes-Gn; EBG00001203421.
DR   EnsemblGenomes-Gn; EBG00001203422.
DR   EnsemblGenomes-Gn; EBG00001203423.
DR   EnsemblGenomes-Gn; EBG00001203424.
DR   EnsemblGenomes-Gn; EBG00001203425.
DR   EnsemblGenomes-Gn; EBG00001203426.
DR   EnsemblGenomes-Gn; EBG00001203427.
DR   EnsemblGenomes-Gn; EBG00001203428.
DR   EnsemblGenomes-Gn; EBG00001203429.
DR   EnsemblGenomes-Gn; EBG00001203430.
DR   EnsemblGenomes-Tr; BMA10247_0022-1.
DR   EnsemblGenomes-Tr; BMA10247_0137-1.
DR   EnsemblGenomes-Tr; BMA10247_0155-1.
DR   EnsemblGenomes-Tr; BMA10247_0412-1.
DR   EnsemblGenomes-Tr; BMA10247_0450-1.
DR   EnsemblGenomes-Tr; BMA10247_0451-1.
DR   EnsemblGenomes-Tr; BMA10247_0452-1.
DR   EnsemblGenomes-Tr; BMA10247_0590-1.
DR   EnsemblGenomes-Tr; BMA10247_0772-1.
DR   EnsemblGenomes-Tr; BMA10247_0789-1.
DR   EnsemblGenomes-Tr; BMA10247_0961-1.
DR   EnsemblGenomes-Tr; BMA10247_0972-1.
DR   EnsemblGenomes-Tr; BMA10247_1022-1.
DR   EnsemblGenomes-Tr; BMA10247_1024-1.
DR   EnsemblGenomes-Tr; BMA10247_1221-1.
DR   EnsemblGenomes-Tr; BMA10247_1228-1.
DR   EnsemblGenomes-Tr; BMA10247_1247-1.
DR   EnsemblGenomes-Tr; BMA10247_1372-1.
DR   EnsemblGenomes-Tr; BMA10247_1373-1.
DR   EnsemblGenomes-Tr; BMA10247_1375-1.
DR   EnsemblGenomes-Tr; BMA10247_1426-1.
DR   EnsemblGenomes-Tr; BMA10247_1510-1.
DR   EnsemblGenomes-Tr; BMA10247_1539-1.
DR   EnsemblGenomes-Tr; BMA10247_1665-1.
DR   EnsemblGenomes-Tr; BMA10247_1776-1.
DR   EnsemblGenomes-Tr; BMA10247_1777-1.
DR   EnsemblGenomes-Tr; BMA10247_1827-1.
DR   EnsemblGenomes-Tr; BMA10247_1828-1.
DR   EnsemblGenomes-Tr; BMA10247_1952-1.
DR   EnsemblGenomes-Tr; BMA10247_1960-1.
DR   EnsemblGenomes-Tr; BMA10247_1961-1.
DR   EnsemblGenomes-Tr; BMA10247_1969-1.
DR   EnsemblGenomes-Tr; BMA10247_1985-1.
DR   EnsemblGenomes-Tr; BMA10247_2036-1.
DR   EnsemblGenomes-Tr; BMA10247_2342-1.
DR   EnsemblGenomes-Tr; BMA10247_2361-1.
DR   EnsemblGenomes-Tr; BMA10247_2743-1.
DR   EnsemblGenomes-Tr; BMA10247_2931-1.
DR   EnsemblGenomes-Tr; BMA10247_3069-1.
DR   EnsemblGenomes-Tr; BMA10247_3180-1.
DR   EnsemblGenomes-Tr; BMA10247_3256-1.
DR   EnsemblGenomes-Tr; BMA10247_3458-1.
DR   EnsemblGenomes-Tr; BMA10247_3459-1.
DR   EnsemblGenomes-Tr; BMA10247_3460-1.
DR   EnsemblGenomes-Tr; BMA10247_3462-1.
DR   EnsemblGenomes-Tr; BMA10247_3540-1.
DR   EnsemblGenomes-Tr; BMA10247_3541-1.
DR   EnsemblGenomes-Tr; BMA10247_3542-1.
DR   EnsemblGenomes-Tr; BMA10247_3543-1.
DR   EnsemblGenomes-Tr; BMA10247_3544-1.
DR   EnsemblGenomes-Tr; BMA10247_3555-1.
DR   EnsemblGenomes-Tr; BMA10247_3560-1.
DR   EnsemblGenomes-Tr; BMA10247_3562-1.
DR   EnsemblGenomes-Tr; BMA10247_3563-1.
DR   EnsemblGenomes-Tr; BMA10247_3565-1.
DR   EnsemblGenomes-Tr; EBT00001574178.
DR   EnsemblGenomes-Tr; EBT00001574179.
DR   EnsemblGenomes-Tr; EBT00001574180.
DR   EnsemblGenomes-Tr; EBT00001574181.
DR   EnsemblGenomes-Tr; EBT00001574182.
DR   EnsemblGenomes-Tr; EBT00001574183.
DR   EnsemblGenomes-Tr; EBT00001574184.
DR   EnsemblGenomes-Tr; EBT00001574185.
DR   EnsemblGenomes-Tr; EBT00001574186.
DR   EnsemblGenomes-Tr; EBT00001574187.
DR   EnsemblGenomes-Tr; EBT00001574188.
DR   EnsemblGenomes-Tr; EBT00001574189.
DR   EnsemblGenomes-Tr; EBT00001574190.
DR   EnsemblGenomes-Tr; EBT00001574191.
DR   EnsemblGenomes-Tr; EBT00001574192.
DR   EnsemblGenomes-Tr; EBT00001574193.
DR   EnsemblGenomes-Tr; EBT00001574194.
DR   EnsemblGenomes-Tr; EBT00001574195.
DR   EnsemblGenomes-Tr; EBT00001574196.
DR   EnsemblGenomes-Tr; EBT00001574197.
DR   EnsemblGenomes-Tr; EBT00001574198.
DR   EnsemblGenomes-Tr; EBT00001574199.
DR   EnsemblGenomes-Tr; EBT00001574200.
DR   EnsemblGenomes-Tr; EBT00001574201.
DR   EnsemblGenomes-Tr; EBT00001574202.
DR   EnsemblGenomes-Tr; EBT00001574203.
DR   EnsemblGenomes-Tr; EBT00001574204.
DR   EnsemblGenomes-Tr; EBT00001574205.
DR   EnsemblGenomes-Tr; EBT00001574206.
DR   EnsemblGenomes-Tr; EBT00001574207.
DR   EnsemblGenomes-Tr; EBT00001574208.
DR   EnsemblGenomes-Tr; EBT00001574209.
DR   EnsemblGenomes-Tr; EBT00001574210.
DR   EnsemblGenomes-Tr; EBT00001574211.
DR   EnsemblGenomes-Tr; EBT00001574212.
DR   EnsemblGenomes-Tr; EBT00001574213.
DR   EnsemblGenomes-Tr; EBT00001574214.
DR   EnsemblGenomes-Tr; EBT00001574215.
DR   EnsemblGenomes-Tr; EBT00001574216.
DR   EnsemblGenomes-Tr; EBT00001574217.
DR   EnsemblGenomes-Tr; EBT00001574218.
DR   EnsemblGenomes-Tr; EBT00001574219.
DR   EnsemblGenomes-Tr; EBT00001574220.
DR   EnsemblGenomes-Tr; EBT00001574221.
DR   EnsemblGenomes-Tr; EBT00001574222.
DR   EnsemblGenomes-Tr; EBT00001574223.
DR   EnsemblGenomes-Tr; EBT00001574224.
DR   EnsemblGenomes-Tr; EBT00001574225.
DR   EnsemblGenomes-Tr; EBT00001574226.
DR   EnsemblGenomes-Tr; EBT00001574227.
DR   EnsemblGenomes-Tr; EBT00001574228.
DR   EnsemblGenomes-Tr; EBT00001574229.
DR   EnsemblGenomes-Tr; EBT00001574230.
DR   EnsemblGenomes-Tr; EBT00001574231.
DR   EnsemblGenomes-Tr; EBT00001574232.
DR   EnsemblGenomes-Tr; EBT00001574233.
DR   EnsemblGenomes-Tr; EBT00001574234.
DR   EnsemblGenomes-Tr; EBT00001574235.
DR   EnsemblGenomes-Tr; EBT00001574236.
DR   EnsemblGenomes-Tr; EBT00001574237.
DR   EnsemblGenomes-Tr; EBT00001574238.
DR   EnsemblGenomes-Tr; EBT00001574239.
DR   EnsemblGenomes-Tr; EBT00001574240.
DR   EnsemblGenomes-Tr; EBT00001574241.
DR   EnsemblGenomes-Tr; EBT00001574242.
DR   EnsemblGenomes-Tr; EBT00001574243.
DR   EnsemblGenomes-Tr; EBT00001574244.
DR   EnsemblGenomes-Tr; EBT00001574245.
DR   EnsemblGenomes-Tr; EBT00001574246.
DR   EnsemblGenomes-Tr; EBT00001574247.
DR   EnsemblGenomes-Tr; EBT00001574248.
DR   EuropePMC; PMC2168593; 17933898.
DR   EuropePMC; PMC2612704; 19038032.
DR   EuropePMC; PMC2945939; 20831800.
DR   EuropePMC; PMC3515745; 23227305.
DR   EuropePMC; PMC4029289; 24883196.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000548.
DR   SILVA-SSU; CP000548.
DR   StrainInfo; 341638; 0.
XX
CC   Source DNA and bacteria available from David DeShazer
CC   (david.deshazer@det.amedd.army.mil).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3495687
FT                   /organism="Burkholderia mallei NCTC 10247"
FT                   /chromosome="I"
FT                   /strain="NCTC 10247"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:320389"
FT   gene            25..1626
FT                   /gene="dnaA"
FT                   /locus_tag="BMA10247_0001"
FT   CDS_pept        25..1626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BMA10247_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by similarity to SP:P03004; match to
FT                   protein family HMM PF00308; match to protein family HMM
FT                   PF08299; match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05026"
FT                   /db_xref="GOA:A3MH48"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MH48"
FT                   /protein_id="ABO05026.1"
FT                   /translation="MNDFWQHCSALLERELTPQQYVTWIKPLAPVAFDAAANTLSIAAP
FT                   NRFKLDWVKSQFSGRISDLARDFWNAPIEVQFVLDPKAGQRSPAGATPLAPRAPLPSAN
FT                   PAPVGPGPACAPAVDAHAPAPAGMNAATAAAVAAAQAAQAAQANAAALNADEAADLDLP
FT                   SLTAHEAAAGRRTWRPGAANANSEAADSMYERSKLNPVLTFDNFVTGKANQLARAAAIQ
FT                   VADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQ
FT                   RKAFDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKE
FT                   ISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEGVSLSEDVAFFVAKHLRSNV
FT                   RELEGALRKILAYSKFHGREITIELTKEALKDLLTVQNRQISVENIQKTVADFYNIKVA
FT                   DMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKD
FT                   AQLNHELHVLEQTLKG"
FT   gene            1789..2892
FT                   /gene="dnaN"
FT                   /locus_tag="BMA10247_0002"
FT   CDS_pept        1789..2892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BMA10247_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04034"
FT                   /protein_id="ABO04034.1"
FT                   /translation="MQLVKTERDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSF
FT                   LSTDLELQITTRADFGVGGDQVATTVAARKLLDILRAMPDGQVTLSLADKRLTVQSGKS
FT                   RFALQTLAADEFPTVAQSKDFGASLAVPQKAFRQLLGMVYFAMAQQDIRYYLNGMLLVV
FT                   DGDRLMAVATDGHRLAFSSMKIEGSFGRQEVIVPRKTILELQRLLEDIDDTVKIDIAQT
FT                   QAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFEIGREELQRSLQRAAILTSDKFKG
FT                   VRCIIAPGQLKIMSTNADQEEAQEELEIAYQGDTVDIGFNVTYLLDVLANLKVDTVQVS
FT                   LGDASSSALITVPENDEFKYVVMPMRI"
FT   gene            3081..5549
FT                   /gene="gyrB"
FT                   /locus_tag="BMA10247_0003"
FT   CDS_pept        3081..5549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BMA10247_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06976"
FT                   /protein_id="ABO06976.1"
FT                   /translation="MTEQHNSQPENSYGASSIQILEGLEAVRKRPGMYIGDTSDGTGLH
FT                   HLVFEVLDNSIDEALAGYCNDIHVTIHADNSISVTDNGRGIPTDVKLNDKHEPKRSAAE
FT                   IVMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSSWLRLIVRRDGKKHFMEFHRGIAQ
FT                   NRVLEERDGEQVSPMQVIGETENRGTEVHFMADPTIFGTVEYHYDILAKRIRELSFLNN
FT                   GVRIRLTDLRSGKEDDFAFAGGVKGFVEYINKTKSVLHPTIFHINGEKDSVGVEVAMQW
FT                   NDSYNENVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIADNEIAKKAKVETTGDDMRE
FT                   GLSCVLSVKVPEPKFSSQTKDKLVSSEVRAPVEEVVAKALEEFLLETPNDAKIICGKIV
FT                   EAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPAKSEIYIVEGDSAGGSAKQG
FT                   RDRKFQAILPLRGKVLNVEKARYDKLLSSEQIVTLVTALGCGIGKDDYNLDKLRYHRII
FT                   IMTDADVDGAHIRTLLLTFFYRQMPEMIERGYVYIAQPPLYKVKAGRDERYLKDDTELN
FT                   AHMLRLALQGSELVPTENGTPISGDALGELARSYLLARGVVERLSRLYDPAALEAVMDG
FT                   VAIDLSSEASTEASAKALAAMLSDDSKTEVRVVPAYDAVREQRSLRVERTHHGNVRVSV
FT                   IDEEFQHTADYQQLVNTANTFKGLIGAGAAIKRGERSSNVTDFKEAMKWLMADAERNLS
FT                   KQRYKGLGEMNPEQLWETTMDPAVRRLLRVQIEDAIAADGIFTTLMGDEVEPRRAFIEN
FT                   NALRAGNIDV"
FT   gene            6075..6338
FT                   /locus_tag="BMA10247_0004"
FT   CDS_pept        6075..6338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0004"
FT                   /product="transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05956"
FT                   /protein_id="ABO05956.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            6362..7195
FT                   /locus_tag="BMA10247_0005"
FT   CDS_pept        6362..7195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0005"
FT                   /product="A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04501"
FT                   /protein_id="ABO04501.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            7445..7594
FT                   /pseudo
FT                   /locus_tag="BMA10247_0006"
FT                   /note="molybdenum cofactor biosynthesis protein C, c-term;
FT                   this gene model represents a disrupted reading frame with
FT                   multiple genetic anomalies"
FT   gene            complement(7791..8156)
FT                   /locus_tag="BMA10247_0007"
FT   CDS_pept        complement(7791..8156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0007"
FT                   /product="TonB domain protein"
FT                   /note="identified by match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05214"
FT                   /protein_id="ABO05214.1"
FT                   /translation="MKTYSTYLALPLAASLLAGCAAFAPRDAAKLECTMPVAAYPENAK
FT                   PLERRATVLVRAMITASGNAENVTVTTSSRNAAADRAAVDAMSRIACSQTPARGGEPYP
FT                   FTLTRPFVFEPRAKAPR"
FT   gene            complement(8173..8340)
FT                   /locus_tag="BMA10247_0008"
FT   CDS_pept        complement(8173..8340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05104"
FT                   /protein_id="ABO05104.1"
FT                   /translation="MRASSLRRRTSVNAGTAQGAPRRRSARTKHRRTKRGAESHGGARR
FT                   ACRRFTRWML"
FT   gene            complement(8393..8866)
FT                   /locus_tag="BMA10247_0009"
FT   CDS_pept        complement(8393..8866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0009"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05861"
FT                   /protein_id="ABO05861.1"
FT                   /translation="MKKRIHRIAAAGILVAGVLSLSAAHAQLGDFLKQGADAGNGGAGG
FT                   IAGALGNLGGGGGAASAGSLLTPGSTGNVAGLLQFCVKNDYLGDGGASSIKDALMSKLG
FT                   AGVTSDSTYASGASGILDAGNGRTLDLSGGQSFKQQLTKQVCDKVLSQAKALL"
FT   gene            complement(9405..11192)
FT                   /locus_tag="BMA10247_0010"
FT   CDS_pept        complement(9405..11192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0010"
FT                   /product="O-antigen polymerase family protein"
FT                   /note="identified by match to protein family HMM PF04932"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06625"
FT                   /protein_id="ABO06625.1"
FT                   /translation="MPSSFLRSLSLIALAVALILPYAITNHTYPIPTFYSEFAAFALYW
FT                   VLGASVVLLVKAERAEQPFAAPMALVAPLGFGAVLLAQIALLPLRQPSMNWLAMGYLLG
FT                   ALVAMQAGYALARVNMVDMVARMIAGATIVGGVVAVACQFVQLFHLETTFSPFVVSYGV
FT                   TVERRPYGNMAQANHLATYIAFALAGALYLVQTRRMPALAWAALSALLSVGLALTVSRG
FT                   PWLQVGVMVVAGFWMAFAQARRDPAASRARAWAIPVVLGVLFVAVNVAVRWANVHYHLG
FT                   LAESAADRMRDAGQIAPRLALWKYGLTMFREHPLLGVGWGEFPIHQFELARRLGGVEIA
FT                   NNSHDIFIDLLAKSGLLGLGVLFVALVAWFVRALRVPHTESRVFGFALVGIVLMHALVE
FT                   YPQQYTFFLLPVMFVIGLLETKPLRALPGRAAFVLFAALSVAGLASLYPILRDYQRAEV
FT                   LYYGTNPAEQYRAHPSFLFGAWGDYGAATLLAISRENLPAKLAAHESAIALLPGETVLR
FT                   RYAVLQALDGRETDALDTIERLRVFAEELHDWPVQLAALYKLLDDQPSLKSFKAALVAK
FT                   YGTPAANLSADDEEDDGDD"
FT   gene            complement(11430..11999)
FT                   /locus_tag="BMA10247_0011"
FT   CDS_pept        complement(11430..11999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0011"
FT                   /product="putative type IV pilin"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04868"
FT                   /protein_id="ABO04868.1"
FT                   /translation="MGIARGLRRVWRVSRRRLRARGFTLIELMIVLAIVGVVAAYAIPA
FT                   YQDYLARSRVGEGLALAASARLAVAENAASGNGFSGGYVSPPATRNVDSIRVDDDSGQI
FT                   VVAFTTRVAAAGANTLVLVPSAPDQADTPTARVALSKGAVQAGAITWECFADGKASSSL
FT                   PAPGAGPLPTDAPTLAGKLAPPECRA"
FT   gene            complement(12167..12880)
FT                   /locus_tag="BMA10247_0012"
FT   CDS_pept        complement(12167..12880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0012"
FT                   /product="integral membrane protein, TerC family"
FT                   /note="identified by match to protein family HMM PF03741"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06525"
FT                   /protein_id="ABO06525.1"
FT                   /translation="MFEFFASLHWGAVAQIVVIDILLGGDNAVVIALACRNLPAQQRVR
FT                   GVLWGTAGAILLRVVLIAFAVLLLDVPLLKFAGGVLLLWIGVRLMAPAEDAHENVKPAD
FT                   KLWEAVKTIVIADAVMSLDNVIAIAGAAEQADPGHRIALVIFGLLVSIPIIVWGSTLVL
FT                   KLLDRFPIFITFGAALLGWIAGGLMVNDPAGDRWPLLDTPAAIYGASVAGALFVVIAGY
FT                   VLKKRRTASSATHSR"
FT   gene            complement(13031..13960)
FT                   /gene="sucD"
FT                   /locus_tag="BMA10247_0013"
FT   CDS_pept        complement(13031..13960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="BMA10247_0013"
FT                   /product="succinyl-CoA synthase, alpha subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="identified by match to protein family HMM PF00549;
FT                   match to protein family HMM PF02629; match to protein
FT                   family HMM TIGR01019"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07284"
FT                   /protein_id="ABO07284.1"
FT                   /translation="MAARFFSRRRSNRGHYMSILINKDTKVITQGITGKTGQFHTRACR
FT                   EYANGREAFVAGVNPKKAGDNFEGIPIYASVKEAKAETGATVSVIYVPPAGAAAAIWEA
FT                   VEADLDLAICITEGIPVRDMIEVKDRMRREGRKTLLLGPNCPGTITPDELKIGIMPGHI
FT                   HRKGRIGVVSRSGTLTYEAVAQLTALGLGQSSAVGIGGDPINGLKHIDVMKMFNDDPDT
FT                   DAVVMIGEIGGPDEANAAQWIKDNMKKPVVGFIAGVTAPPGKRMGHAGALISGGADTAE
FT                   AKLEIMEACGITVTRNPSEMGRLLKAAL"
FT   gene            complement(14057..15223)
FT                   /gene="sucC"
FT                   /locus_tag="BMA10247_0014"
FT   CDS_pept        complement(14057..15223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="BMA10247_0014"
FT                   /product="succinyl-CoA synthase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="identified by match to protein family HMM PF00549;
FT                   match to protein family HMM PF08442; match to protein
FT                   family HMM TIGR01016"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04465"
FT                   /db_xref="GOA:A3MH60"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MH60"
FT                   /protein_id="ABO04465.1"
FT                   /translation="MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQELGGPVWVV
FT                   KAQIHAGGRGKGGGVKVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADI
FT                   KKELYVGIVIDRVSQKVVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDL
FT                   AKKIGVPDASIPQAREILKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNA
FT                   LFRHPEIVAYRDLDEEDPAEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGG
FT                   EPANFLDVGGGATTEKVTEAFKLMLKNPGLKAILVNIFGGIMRCDVIAEGVIAGSKAVN
FT                   LNVPLVVRMKGTNEDLGKKMLAESGLPIISADSMEEAAQKVVAAAAGK"
FT   gene            complement(15303..15914)
FT                   /locus_tag="BMA10247_0015"
FT   CDS_pept        complement(15303..15914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07054"
FT                   /protein_id="ABO07054.1"
FT                   /translation="MPLSEPVPRQLRHRRAIRAEAYERADGLWDIEACLTDHKPRDVSL
FT                   ASGVRPNGLPIHELWLRVTIDRELNIVDVDASSDWVPYPGQCEAAKPAYRVLIGLNLFR
FT                   HFRRDVSRLLSGVAGCSHLTELCAVLPTAAIQAFAGDVWNVQESLGDGANEGDRPAGQP
FT                   PLQLGRCHALRFDGEAVRQFYPRWYGASRPAREGADSAKE"
FT   gene            complement(16206..17189)
FT                   /gene="recX"
FT                   /locus_tag="BMA10247_0016"
FT   CDS_pept        complement(16206..17189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="BMA10247_0016"
FT                   /product="regulatory protein RecX"
FT                   /note="identified by match to protein family HMM PF02631"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04210"
FT                   /protein_id="ABO04210.1"
FT                   /translation="MRKNREGADSQQAGHGARTASAGEPHAERETRATVSGEGRPSGRP
FT                   ATRASDDALVSFRRSAACEAGEPFDPDESFDAHDAARPRASAGGGGAEGVRGVRDAGAG
FT                   GGRAGDARAANRLRAPAGLSSAAKREETAGDVYTRTSQAGPRSRRRASPFHSDSSPSAS
FT                   SETDGAARSSASQRPARTLKGRAVAYLSRREYSRAELARKLTPHADESDDVESLLDALE
FT                   RENWLSDSRFAESLVHRRASRVGSARIISELKRHAVGDALVESVGARLRESEFERAQSV
FT                   WRKKFGAVPQTQAERAKQARFLAMRGFSSATIAKLLKGDADEFGGD"
FT   gene            complement(17189..18259)
FT                   /gene="recA"
FT                   /locus_tag="BMA10247_0017"
FT   CDS_pept        complement(17189..18259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="BMA10247_0017"
FT                   /product="RecA protein"
FT                   /note="identified by match to protein family HMM PF00154;
FT                   match to protein family HMM TIGR02012"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04435"
FT                   /protein_id="ABO04435.1"
FT                   /translation="MEESKKGSGLTAEKSKALAAALAQIEKQFGKGSIMRLGDGEAVED
FT                   IQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQVIAEMQKLGGTAAFIDA
FT                   EHALDVQYASKLGVNVPELLISQPDTGEQALEIVDALVRSGSIDMIVIDSVAALVPKAE
FT                   IEGEMGDALPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKIGVMFGNPETTTGGN
FT                   ALKFYSSVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAIFDILYGEGISRQG
FT                   EIIDLGVQAKIVDKAGAWYSYSGEKIGQGKDNAREFLRENPEIAREIENRIRESLGVAA
FT                   MPQGAGSEAEIMDEEE"
FT   gene            18463..19206
FT                   /locus_tag="BMA10247_0018"
FT   CDS_pept        18463..19206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0018"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05405"
FT                   /protein_id="ABO05405.1"
FT                   /translation="MRILIAEDDSILADGLTRSLRQSGYAVDHVRNGVEADTALSMQTF
FT                   DLLILDLGLPRMSGLEVLRRLRARNSNLPVLILTAADSVDERVKGLDLGADDYMAKPFA
FT                   LNELEARVRALTRRGAGGGPTVVRHGLLSFDQVGRIAYANERVLELSARELGLLEVLLQ
FT                   RIGRLVSKEQLVDHLCEWGEEVSNNAIEVYVHRLRKKIEPSGVRITTVRGLGYCLEKAA
FT                   PAGASDAPNAAASPAAEAVAGQPVR"
FT   gene            19230..20747
FT                   /locus_tag="BMA10247_0019"
FT   CDS_pept        19230..20747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0019"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518; match to protein family HMM PF08521"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06421"
FT                   /protein_id="ABO06421.1"
FT                   /translation="MATPVRPAHASRRASAAAPDTDAARDARYENPFAPPDEADAAEGT
FT                   RPRSLFGEILDWMLAPLLLLWPMSIAITYLVAKTIANGPFDRALETDAYVLARQITPIN
FT                   GVAELRLPQATLDFLRADNVDSLYFQVLGTRGELVAGEADLPLPRDDLLRGNDVRVAYT
FT                   SVALQGATGSQPVLVQVGETLDKRNALANDIIKGVILPQFVILPLAILLVWFGLSRGLA
FT                   PLTALQAHIRGRRPDDLSPVEARRAPPEIEPLVTSFNDLLARLEQNITLQKRFIADAAH
FT                   QMKTPLAGLRTQAEFALRHEVNADVAHSLEQIATSSEQAARLVTQLLALARAENRATGL
FT                   TFEPVEIASLARQAVRDWVQVALAKQMDLGYESPDTDAPLRIDGQPVMLREMLGNLIDN
FT                   AIRYTPAGGRITVRVRAERAAGAVHLEVEDTGPGIPPNERERVVERFYRILGREGDGSG
FT                   LGLAIVREIVAQHGGTLTIDDNVYQTSPRLAGTLVRVSIGLRQEAPE"
FT   gene            20970..22628
FT                   /locus_tag="BMA10247_0020"
FT   CDS_pept        20970..22628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0020"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07322"
FT                   /protein_id="ABO07322.1"
FT                   /translation="MATVGGQIAHAPMTGDEKRVIFASSLGTVFEWYDFYLAGSLAAYI
FT                   SKSFFSGVNPTAVFIFTLLGFAAGFAVRPFGAIVFGRLGDLVGRKHTFLITIVIMGIST
FT                   FVVGFLPGYASIGIAAPVIFIAMRLLQGLALGGEYGGAATYVAEHAPSHRRGFYTSWIQ
FT                   TTATLGLFLSLLVILGVRTAIGEEAFGSWGWRVPFVASILLLAVSVWIRLQLNESPVFL
FT                   RIKAEGKTSKAPLTEAFGQWKNLKIVILALIGLTAGQAVVWYTGQFYALFFLTQTLKVD
FT                   GASANILIALALLIGTPFFVFFGSLSDRIGRKPIILAGCLIAALTYFPLFKALTHFANP
FT                   ALEAATQKAPITVVANPDECSFQFNPVGTAKFTSSCDIAKSALAKSGLNYENVAAPAGT
FT                   LAQIKIGDTAIATYDGKAADAKDQAKAFDKTLASTLKAAGYPAKADPARLNWPMTTVIL
FT                   AILVIYVTMVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGFLPATAFAIVAAKGD
FT                   IYSGLWYPIGVALVTFVIGLLFVKETKDSNIYAQD"
FT   gene            22625..22768
FT                   /locus_tag="BMA10247_0021"
FT   CDS_pept        22625..22768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06401"
FT                   /protein_id="ABO06401.1"
FT                   /translation="MTKAGCGAPAYGRGRAAGGRRWRFGPPPDEGRRHAARRSAAASAA
FT                   ER"
FT   gene            22869..22947
FT                   /locus_tag="BMA10247_0022"
FT   tRNA            22869..22947
FT                   /locus_tag="BMA10247_0022"
FT                   /product="tRNA-Met"
FT   gene            23031..24026
FT                   /locus_tag="BMA10247_0023"
FT   CDS_pept        23031..24026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05652"
FT                   /protein_id="ABO05652.1"
FT                   /translation="MHKLPHLFKSRHGVFYLRLACGGEEVKRSLRTKDFRQARLLALAF
FT                   NLELAMKTPDDKPKAADFNLDAESLKRLDVIFPDGTQVKDINTDDDVRRAKELFGDRFA
FT                   AAVPAPPSFDLPAFSPSVAAAIAAQKAVQETKRKAKPFADVAKLYKKEKALDNTARTIT
FT                   AKERAFADFEKRIGSRPIDAYLIDDAVAYKNALIDEGGSASRINAKLSFLRDLFAYALA
FT                   NGLRAEANPFENVKVSSKSKLEQQKRSYKPFSADDIATIFDPTAYPARMDKPAYRWFPF
FT                   LALYSGARLEELASLSLSQIQREGDVWFFDIQKAKNANSQRRIPLTCPLR"
FT   gene            complement(24054..24887)
FT                   /locus_tag="BMA10247_0024"
FT   CDS_pept        complement(24054..24887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0024"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06674"
FT                   /protein_id="ABO06674.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(24911..25174)
FT                   /locus_tag="BMA10247_0025"
FT   CDS_pept        complement(24911..25174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0025"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04213"
FT                   /protein_id="ABO04213.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            complement(25205..25711)
FT                   /gene="moaC"
FT                   /locus_tag="BMA10247_0026"
FT   CDS_pept        complement(25205..25711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="BMA10247_0026"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="identified by match to protein family HMM PF01967;
FT                   match to protein family HMM TIGR00581"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACX94865"
FT                   /protein_id="ACX94865.1"
FT                   /translation="MSGSGFTHFDAAGHAHMVDVGDKQETRRIAVARGAIRMLPDTLAL
FT                   IRDGRAKKGDVFGVARIAAIQGAKRTADLIPLCHPLALTRVAVDFEFDDALPGVRCSAQ
FT                   VETLGRTGVEMEALTAVQVGLLTVYDMCKAVDRGMTITDVKVMEKHGGKSGDLTCPLQT
FT                   GPAGV"
FT   gene            complement(25723..25836)
FT                   /locus_tag="BMA10247_0027"
FT   CDS_pept        complement(25723..25836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0027"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04630"
FT                   /protein_id="ABO04630.1"
FT                   /translation="MVRWSLRHCNGAPAAARAPLPRAPGRPASRAAMIGAL"
FT   gene            25864..27582
FT                   /locus_tag="BMA10247_0028"
FT   CDS_pept        25864..27582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05244"
FT                   /protein_id="ABO05244.1"
FT                   /translation="MRVKSSFAVLLCAALALPPGGHAQSRGDAPPLESARAAGAEDAAA
FT                   RARDALSTVPSGIAPGVFGMYGGAQSRLADPASGTPSLRAPLRSLQLPDLGDGSGGSLT
FT                   PQAERRLGERVMREVRRDPDYLDDWLVRDYLNSVAAKLSAAAAAQFIGGYMPDFELFAM
FT                   RDPQINAFSLPGGFIGINSGLVAATQTESELASVIGHEMGHVLQRHIARMIGASEKSGY
FT                   AALATMLFGVLAGILARSGDLGSAIAMGGQAFAVDSQLRFSRSAEREADRVGFQLLAGA
FT                   GYDPYGMPGFFERLERASVGDAGVPAYARTHPLTGERIADMDDRARRAPYRQPRQSAEY
FT                   GFVRARLRMLQNRAPTDYANEARRMRAELDDRVAPNVAANWYGIALGEMLGGRYDDADR
FT                   ALAAARDAFARTAAREGEAARTSPSLDVLAAEIARRAGRGDDAVRLAAAAQARWPGSHA
FT                   AIAAHLQALLAARRYGQAQALAQAEANAAPRQPDWWNYLAQASLGRGDALTQRRALAEK
FT                   FALEGAWPSAIRQLREARDLKSAGFYEQSIISARLHEFEARYKEEREEDKDDRRG"
FT   gene            complement(27904..28527)
FT                   /locus_tag="BMA10247_0029"
FT   CDS_pept        complement(27904..28527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04515"
FT                   /protein_id="ABO04515.1"
FT                   /translation="MDDIVKQALAKWPNVPHCTGWLLLDRRGGWRMRDDAAQAAGALGS
FT                   PVRHPALVDFIARNYERDEHGQWFFQNGPQRVYVELAYTPWIVRLAAAPAGGGCEPARV
FT                   ALTDHTGRAFEPARAWLDDAGGVLFADTSTPPRVAALHDHDLALFADRADLDDDGAHGV
FT                   LHLGGGVDLPLEPIRRDDVARRFGFVASPAARAGERAAGGKPTD"
FT   gene            complement(28520..29554)
FT                   /locus_tag="BMA10247_0030"
FT   CDS_pept        complement(28520..29554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0030"
FT                   /product="alpha/beta hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06815"
FT                   /protein_id="ABO06815.1"
FT                   /translation="MSTALPPLPAADETARPAASSFYRAPLWLPTSHAQTIVPALFARR
FT                   PDVAYRRERWDTPDGDFIDVDWLAPPAGAAPGPLAPLAVLFHGLEGSSDSHYARVLMAA
FT                   ARARGWHGVVPHFRSCGGEMNRMPRFYHLADSAEVDWILRRLAKSHRGPLVVVGVSLGG
FT                   NVLLRWLGERRGDTSIVAAAAAVSTPIDVHAGGRALSQGFSMVYTRSFLKTLKWKALVK
FT                   LEQYPGLFDKQALLAARTMHDFDDIVTAPLHGFADANDYWTQATTRPLLAAIDVPTLIL
FT                   NARNDPFLPASALPGPREVSRAVVLDQPEHGGHAGFMTGPFPGRIDWLPARVFEFCSRF
FT                   TDHG"
FT   gene            complement(29574..30020)
FT                   /locus_tag="BMA10247_0031"
FT   CDS_pept        complement(29574..30020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06009"
FT                   /protein_id="ABO06009.1"
FT                   /translation="MPRFARLFEAAADTLNAYYQAVADANLDALMVLWIDEDFASCIWS
FT                   DGTHLHGLEQIRSGFGARLSTQPVTIEPLDIRVYDSLGTVVYTVAEAHQQADLTAEPQM
FT                   VFTTYVMIHERGEWRIAHIHASPIPEQTATQFAAKIRHAQGPLH"
FT   gene            complement(30152..31282)
FT                   /gene="rfaF"
FT                   /locus_tag="BMA10247_0032"
FT   CDS_pept        complement(30152..31282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaF"
FT                   /locus_tag="BMA10247_0032"
FT                   /product="ADP-heptose--LPS heptosyltransferase II"
FT                   /note="identified by match to protein family HMM PF01075;
FT                   match to protein family HMM TIGR02195"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04867"
FT                   /protein_id="ABO04867.1"
FT                   /translation="MGAARAAAPPPQPERGARASRFITTSENDLMRRALVIAPNWIGDA
FT                   LMAQPLFALLKKLHPRIVIDAVAPAWVAPVLERMPEIHDVHATELAHGKLQMLHRWQLA
FT                   SDLRELGYDAAYVLPNSLKSALIPWLAGIPLRIGYTGEHRYALLNVRHANPGKARETRA
FT                   PMAQHYAALAYAPGAKLPESFQTLPPPRLEADLNETARVSARFNLDTRKPLIVFCPGAE
FT                   YGPAKRWPPEHFAALAQSVSQSFPYTQIVALGSPKDAAAAQAIAERAPNVRSLCGQTSL
FT                   TEACVLIARANAVVTNDSGLMHVAAALRRPLVALYGSTDPRHTPPLSELAKVQWLHLEC
FT                   SPCFERECPLGHLKCLRELSPEQVFGDLRGMLVGQR"
FT   gene            complement(31321..31518)
FT                   /locus_tag="BMA10247_0033"
FT   CDS_pept        complement(31321..31518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07279"
FT                   /protein_id="ABO07279.1"
FT                   /translation="MSEIKEMPLIELTAKDLPAYCPNPAMPRWSAHPRVFIDVSHGEAR
FT                   CPYCGTRYKLRDGEVLRGHH"
FT   gene            complement(31584..32507)
FT                   /gene="ilvE"
FT                   /locus_tag="BMA10247_0034"
FT   CDS_pept        complement(31584..32507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="BMA10247_0034"
FT                   /product="branched-chain-amino-acid transaminase"
FT                   /EC_number="2.6.1.42"
FT                   /note="identified by match to protein family HMM PF01063;
FT                   match to protein family HMM TIGR01122"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06107"
FT                   /protein_id="ABO06107.1"
FT                   /translation="MSMADRDGKIWMDGKLIEWRDAKIHVLTHTLHYGMGVFEGVRAYK
FT                   TADGGTAIFRLKEHTKRLLNSAKIFQMDVPFDQETLEAAQRDVVRENKLESCYLRPIIW
FT                   IGSEKLGVSAKGNTIHVAIAAWPWGAYLGEEGLAKGIRVKTSSFTRHHVNVSMVRAKAS
FT                   GWYVNSILANQEATADGYDEALLLDVDGYVSEGSGENFFLVNRGKLYTPDLASCLDGIT
FT                   RDTVITLAKEAGIEVIEKRITRDEVYTADEAFFTGTAAEVTPIRELDNRTIGGGARGPI
FT                   TEKLQSAFFDVVNGKSAKHADWLTKI"
FT   gene            32729..33478
FT                   /locus_tag="BMA10247_0035"
FT   CDS_pept        32729..33478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0035"
FT                   /product="AzlC family protein"
FT                   /note="identified by match to protein family HMM PF03591"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05293"
FT                   /protein_id="ABO05293.1"
FT                   /translation="MLARLSATDRFALAQGFRDFSPTLMAILSWGLVTGIAMSKSVLTT
FT                   GQALGMSILVYAGLSQLAVLPLFAAKLPVWTILLTAAMVNMRFVIFSAGLAPHFSYLPL
FT                   WRRLAIGYFNGDVIYLLFQKQGFVAGHVPGKEAYFWGMALTSWFAWQASSLVGIALASA
FT                   FPDSWGLALAGTLALIPIMVSAISNRSTLAAVAVAGIVSLVAFDLPYRLALPLAVVAAL
FT                   AAGSAADWFVERADWRRIRAAGTEDAE"
FT   gene            33475..33798
FT                   /locus_tag="BMA10247_0036"
FT   CDS_pept        33475..33798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0036"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF05437"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04535"
FT                   /protein_id="ABO04535.1"
FT                   /translation="MSDWQVWLAIAGMTLVTAITRALFLAGGERTVLPERAQRSLRYAP
FT                   AAALVAVVLPDVLETPEGLSFALSNHDFYAAAAGLAWFLWRRSMLGTIVVGMLVFTALR
FT                   ILF"
FT   gene            33930..35258
FT                   /gene="pgk"
FT                   /locus_tag="BMA10247_0037"
FT   CDS_pept        33930..35258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="BMA10247_0037"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="identified by match to protein family HMM PF00162"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05970"
FT                   /protein_id="ABO05970.1"
FT                   /translation="MALSGIFSRARRAGLAAQSRRAARGARRGSPRASNRLPSSTFISP
FT                   MSQVKRLTDLIAEGKLSGKRVFIRADLNVPQDDHGNITEDTRVRASVPAIQAALDAGAA
FT                   VMVTSHLGRPTEGEFKPEDSLAPVAKRLAELLGRDVPLVANWVENGVEVAPGQVVLLEN
FT                   CRVNKGEKKNSDELAQKMAKLCDVYVNDAFGTAHRAEATTHGIAKYAPVACAGPLLAAE
FT                   LDALGKALGNPKRPLVAIVAGSKVSTKLTILKSLAEKVDQLIVGGGIANTFMLAAGLAI
FT                   GKSLAEADLVGEAKAIIDEARKRGASVPIPTDVVVAKEFSPTAAATVKKVADIEADDMI
FT                   LDIGPDTAKALAGQLEKAGTIVWNGPVGVFEFDQFGNGTKTLADAIASSAAFSIAGGGD
FT                   TLAAIAKYGIHDKVSYISTGGGAFLEFLEGKKLPAVEVLETRA"
FT   gene            35339..35614
FT                   /locus_tag="BMA10247_0038"
FT   CDS_pept        35339..35614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0038"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06502"
FT                   /protein_id="ABO06502.1"
FT                   /translation="MPGLTRVARRAGRAAYVGRRAARPQRARRTRINDAAPAVHAGARV
FT                   QSDAGRTHRRAFRSGGGWAARLRLSRRYIQRFHSVRRGDSCTAPPR"
FT   gene            35593..37029
FT                   /gene="pyk"
FT                   /locus_tag="BMA10247_0039"
FT   CDS_pept        35593..37029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="BMA10247_0039"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="identified by match to protein family HMM PF00224;
FT                   match to protein family HMM PF02887; match to protein
FT                   family HMM TIGR01064"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07079"
FT                   /protein_id="ABO07079.1"
FT                   /translation="MHRATKIVATIGPASSSPEVLSQMMHAGLDVVRLNFSHGSADDHR
FT                   ERAEMVREAARRVGREIAIMADLQGPKIRVGKFEAGKTTLTPGQPFILDATCELGNDER
FT                   VGLDYKDLPRDLKPGDVLLLNDGLIVLKVDRVLGDEIHTTVKVGGDLSNNKGINRQGGG
FT                   LSAPALTAKDMEDIRTAMSLGADLVAVSFPKNATDMEMARQLANIAGAPYGIKPKMIAK
FT                   IERAEAIPALQEILDASDGIMVARGDLAVEVGNAAVPALQKRMIRMARESNKLVITATQ
FT                   MMESMIHAPVPTRAEVSDVANAVLDGTDAVMLSAETATGKYPAVTIEAMAAVCVEAEKS
FT                   EHVELDKDFLDRTFTRIDQSIAMGALFTAYHLGAKAIVALTESGATALWMSRHYTHVPI
FT                   FALTPRVGSERAMALFRNVTPLHVDFNSDRDSALQQALELIVRRGYVAHGDMVVLTVGE
FT                   PMGQAGGTNTLKIVRVGEHY"
FT   gene            37310..38374
FT                   /gene="cbbA"
FT                   /locus_tag="BMA10247_0040"
FT   CDS_pept        37310..38374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbA"
FT                   /locus_tag="BMA10247_0040"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01521"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03937"
FT                   /protein_id="ABO03937.1"
FT                   /translation="MPLVSMRQLLDHAAENGYGLPAFNVNNLEQVQAIMAAADEVGAPV
FT                   IMQASAGARKYAGEAFLRHLIEAAVESYPHIPVVMHQDHGQSPAVCMAAIRSGFTSVMM
FT                   DGSLEADGKTVASYEYNVDVSRKVVEMAHSIGVTVEAELGVLGSLETMKGDKEDGHGAE
FT                   GTMTREQLLTDPEQAADFVKLTQCDALAIAIGTSHGAYKFTKKPTGDILSIQRIKEIHA
FT                   RIPNTHLVMHGSSSVPQDLLAEIREFGGDMKETYGVPVEEIQEGIKHGVRKVNIDTDLR
FT                   LAITGAIRRYMFENPGKFDPRDYLKPAREAAKKICVARYLAFGCEGQAAKIKPVPLEKI
FT                   AEKYKAGDLAQVVR"
FT   gene            38564..39454
FT                   /gene="purC"
FT                   /locus_tag="BMA10247_0041"
FT   CDS_pept        38564..39454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="BMA10247_0041"
FT                   /product="phosphoribosylaminoimidazolesuccinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="identified by match to protein family HMM PF01259;
FT                   match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04896"
FT                   /protein_id="ABO04896.1"
FT                   /translation="MSTLYESTLRSLPLLGRGKVRDNYALGNDKLLIVTTDRLSAFDVI
FT                   MGEPIPNKGRVLNQMANFWFDRLAHIVPNHLTGVAPETVVAADEVEQVKGRAVVVKRLE
FT                   PILVEAVVRGYLAGSGWKDYQATGKVCGVELPAGLSNAQKLPEPIFTPAAKAEMGHHDE
FT                   NISFEETERRIGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDEHGELFLM
FT                   DEALTADSSRFWPADEYRVGTNPPSFDKQFVRDWLEAQNWNKAPPAPKLPDDVVAKTSA
FT                   KYQEALERITGKTLD"
FT   gene            39490..40008
FT                   /gene="purE"
FT                   /locus_tag="BMA10247_0042"
FT   CDS_pept        39490..40008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="BMA10247_0042"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04012"
FT                   /protein_id="ABO04012.1"
FT                   /translation="MSEVQTAHTHSAPLVGVLMGSSSDWDVMKHAVAILQEFDVPYEAR
FT                   VVSAHRMPDEMFDYAQQARERGLRAIIAGAGGAAHLPGMLAAKTTVPVLGVPVASKYLK
FT                   GVDSLHSIVQMPKGVPVATFAIGEAGAANAALFAVSILSGTSADYANRLAAFRVRQNEA
FT                   AHAMALPPL"
FT   gene            40088..41284
FT                   /gene="purK"
FT                   /locus_tag="BMA10247_0043"
FT   CDS_pept        40088..41284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="BMA10247_0043"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02222; match to protein
FT                   family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04963"
FT                   /protein_id="ABO04963.1"
FT                   /translation="MTALPTPNSPILPGAWLGMVGGGQLGRMFCFAAQAMGYRVAVLDP
FT                   DPTSPAGAVADKHLRAAYDDEAALAELAQLCDAVSTEFENVPAASLELLAQSTFVAPAG
FT                   RCVAIAQDRIAEKRFIAASGVPVAPHVVIESHAQLAALADADLAAVLPGILKTARLGYD
FT                   GKGQVRVATVREARDAYASLGGVPCVLEKRLPLEYEVSALIARGANGASAVFPLAQNTH
FT                   HGGILSLSVVPAPAASDALVREAQQAAVRIADSLGYVGVLCVEFFVLEDGSLFANEMAP
FT                   RPHNSGHYTVDACETSQFEQQVRAMTRLPLGSTRQHSPAAMLNVLGDVWFANGVSGEPV
FT                   TPPWDEVAAMPTARLHLYGKEEARAGRKMGHVNFTAATRDEAVAGATACARLLRIALD"
FT   gene            41296..42321
FT                   /locus_tag="BMA10247_0044"
FT   CDS_pept        41296..42321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0044"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="identified by match to protein family HMM PF01300;
FT                   match to protein family HMM PF03481; match to protein
FT                   family HMM TIGR00057"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05401"
FT                   /protein_id="ABO05401.1"
FT                   /translation="MSNDRPFPSAEAIEDAAARLDAGELVAFPTETVYGLGADAQNPAA
FT                   VARIYAAKGRPANHPVIVHLAPGSDPGYWVEALPADAKKLIDAFWPGPLTLILKRATHI
FT                   PDAVSGGQDSVGLRCPSHPVAQALLRAFDARRGGHGGVAAPSANRFGHVSPTTAQHVRD
FT                   EFGDAVHVLDGGPSDVGIESTILDLSRGFPALLRPGHVSPRQIADVLGVAPRLPDGSDA
FT                   TAPRASGTLKAHYAPRTPLALAAFERLEPLLAAARDTGEPVALVARASRAGAWAHAAGV
FT                   HFVAAPEDPAAYARELYGLLRALDRAQVARILVEKLPDTAEWTAVNDRLGRAAAAFDAQ
FT                   A"
FT   gene            42376..42513
FT                   /locus_tag="BMA10247_0045"
FT   CDS_pept        42376..42513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0045"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06844"
FT                   /protein_id="ABO06844.1"
FT                   /translation="MLLSPKPKPKPKPKPKPKPKYRSTEVPKYRNAAIPKRQRPVTHHA
FT                   "
FT   gene            complement(42609..43748)
FT                   /locus_tag="BMA10247_0046"
FT   CDS_pept        complement(42609..43748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05838"
FT                   /protein_id="ABO05838.1"
FT                   /translation="MNPLQRQQQPAGAARRRFWRGAQVALASAAFALLAACGGGDDNGS
FT                   SQPSAGVNMQVVSFGDSLSDVGTYSPQILIGFGGGRFTTNPGQVWTQDVAAYYGDTLTP
FT                   AFEGGFGVPLQAAGGLGYAQGGSRVTQQPGIGHADASVANADYAQATTVPVATQVQQYL
FT                   QQHGSFNANQIVLVNGGANDIFYQVQVAQAQGNTPAAQLAAAQQIGLAAQQLAGVVQQI
FT                   VAAGATHVFVSNVPDIGGTPLAASTGQQAALTQLSTIFNSTLVAALKALNVDPAKAVLI
FT                   DAFTWQDGIAANYQGNGFSVANTGTACNLQSMIAAATKAGVANPTAFGSSLFCSPQMYT
FT                   VANADQTYMFADTVHPTTRLHALFAQYVEQQIAKTGVGK"
FT   gene            complement(43853..44509)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0047"
FT                   /note="C-5 sterol desaturase family protein; this gene
FT                   contains a premature stop which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF04116"
FT   gene            complement(44522..44770)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0048"
FT                   /note="C-5 sterol desaturase family protein; this gene
FT                   contains a premature stop which may be the result of a
FT                   sequencing error"
FT   gene            complement(44979..45146)
FT                   /locus_tag="BMA10247_0049"
FT   CDS_pept        complement(44979..45146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0049"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06062"
FT                   /protein_id="ABO06062.1"
FT                   /translation="MGVRRATLIRARHARRRRFRRRARSGTDSASPFPSPFPSPFPSPF
FT                   PSPFPSPDAA"
FT   gene            complement(45122..46663)
FT                   /gene="dacB"
FT                   /locus_tag="BMA10247_0050"
FT   CDS_pept        complement(45122..46663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="BMA10247_0050"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF02113;
FT                   match to protein family HMM TIGR00666"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04422"
FT                   /protein_id="ABO04422.1"
FT                   /translation="MNHHACRIAASPSPPPPAAVRARRTLARGAMLVAACAALAFAAPA
FT                   DARRKPKPPRYPAAVSAARNVLPASVLVALQRARVPASSLSVVVERIGDRTPAVAWNAS
FT                   RPMQPASTMKLVTTYAGLSLLGADYRWRTSAYADGDVDENGTLHGTLYIKGTGDPKLVP
FT                   EELIDLVNKIRRAGIVNVDGALVLDKTFFAPQTRDLPPLDDDASAPYNVGPDPLLYAFK
FT                   ALSFTVTPTDSGAIAVDVVPALANLNVDNRLVEGQGSCDAARPTLVTDANGELTASFAG
FT                   DYPPSCGPTTTNLAVLNHSTFFARGFLALWRQTGGSFSGTIAEGKVPGRARPVASHHGP
FT                   VLSSVVHDINKFSNNVMARNLFLTIGAVEHRPPATPAQSADTIRAFLAHSGLPTDGLAL
FT                   ENGSGLSRDERVSALGLADMLQAANASPVAQAFVDSLPIAGVDGTMRNRLTNAPVGGNA
FT                   HIKTGTLRDVRAIAGYVASADGSSYVVVSFINDDRASAARAAHDALLEWVYEGPR"
FT   gene            46841..47503
FT                   /locus_tag="BMA10247_0051"
FT   CDS_pept        46841..47503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0051"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04222"
FT                   /protein_id="ABO04222.1"
FT                   /translation="MRILLVEDDRMIAEGVRKALKADGCAVDWVQDGDAALTALGGEAY
FT                   DLLLLDLGLPKRDGIDVLRTLRARGLALPVLILTARDAVADRVKGLDAGADDYLVKPFD
FT                   LDELAARMRALIRRQSGRSESMIRHGALTLDPASHQVTLDGAPVALSAREFALLEALLA
FT                   RPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGSDLIRNVRGLGYMVVKEA"
FT   gene            47507..48823
FT                   /locus_tag="BMA10247_0052"
FT   CDS_pept        47507..48823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0052"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05576"
FT                   /protein_id="ABO05576.1"
FT                   /translation="MRSIRHQLLIWLLAIVVAGVGLAGWMIYRQALAAANELFDYQLQQ
FT                   IAAALPSEPFSQVLGSQTNGDEGIVIQIWNRNGVLMYFSHPRAPIAPRAELGFSTERTE
FT                   RGAWRVYGAIVGDNVVQLAQPLSVRNRLAASVALRTLWPLIVLLPFLGAAVWMIVGRGL
FT                   APLQRVTRAVEARRPEALDPLPDSPLPLEVRPLVRALNGLLARLSAALDTQKAFVADAA
FT                   HELRTPLAAVQIQAQLVARAQDDVSRREAIVDLQSGVTRATRLAEQLLALARAEPGDAT
FT                   VRERVDLRAIVEECVAAHAPLAQRRDIDLGFERVEDASVDADPAALRVMFNNLLDNAVK
FT                   YTPAGGRIDVSLTRGEGARACVQIGDSGPGIPAAERERVFDRFYRDTSARARTDVAGSG
FT                   LGLAIVKRVAAQQRASVTLGEAAAGGLLVSVSLPCAGPA"
FT   gene            49321..50772
FT                   /locus_tag="BMA10247_0053"
FT   CDS_pept        49321..50772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0053"
FT                   /product="serine protease"
FT                   /note="identified by similarity to SP:P09376; match to
FT                   protein family HMM PF00089; match to protein family HMM
FT                   PF00595; match to protein family HMM TIGR02037"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06130"
FT                   /protein_id="ABO06130.1"
FT                   /translation="MAVAAALSAGYVAGTRRAEPQIITPAVAALMPAEAAAKTGIPDFS
FT                   GLVETYGPAVVNISAKHVVQRAAQRRAAPQLPIDPDDPFYQFFRHFYGQIPGMGGGRQP
FT                   QPDDQPSTSLGSGFIISADGYILTNAHVIDGANVVTVKLTDKREYKAKVVGADKQSDVA
FT                   VLKIDASGLPIVKIGDPAQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDENYTPF
FT                   IQTDVPVNPGNSGGPLFNLNGEVIGINSMIYSQTGGFQGLSFAIPINEAMKVKDELVKT
FT                   GHVSRGRLGVAVQGLNQTLASSFGLQKPDGALVSSVDPKGPAAKAGLQPGDVILAVDGV
FT                   PVQDSSTLPAQIAGMKPGTKADLQIWRDKSRKTVSVTLASLADDQAKAGADEPVEQGRL
FT                   GVAVRPLSPRERNGSSLTHGLVVQQSAGPAASAGIQPGDVILAVNGRPVTSAEQLRDAV
FT                   KRAGNSLALLIQRDDAQIFVPVDLG"
FT   gene            50932..51354
FT                   /locus_tag="BMA10247_0054"
FT   CDS_pept        50932..51354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06736"
FT                   /protein_id="ABO06736.1"
FT                   /translation="MRQQSVSQYLIVAALAFGLAGVARAQPGLPDVQHHGDVGFVSGGV
FT                   GLDESTAFQRSESSWPLALRFTGAGGEYLSDVHVSVLDAQGGEVLKTDARGPYMLVRLK
FT                   PGRYTVRASYNGSEQTHAVTVPAKGGTKAAFSWKAQ"
FT   gene            51482..51847
FT                   /locus_tag="BMA10247_0055"
FT   CDS_pept        51482..51847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04248"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04585"
FT                   /protein_id="ABO04585.1"
FT                   /translation="MSDAAGHRIEIEPNRHRVRVIHRGITYADSLAAYTLREPGAPDVQ
FT                   YLPRDDVNMSRLVPSDRVALEHCAHKGPATYFHLHTEDGVIENAAWSYEEPSGIANAIR
FT                   QYVAFDAACVDRIDVTS"
FT   gene            51875..52603
FT                   /locus_tag="BMA10247_0056"
FT   CDS_pept        51875..52603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0056"
FT                   /product="carbon monoxide dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF06240"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06205"
FT                   /protein_id="ABO06205.1"
FT                   /translation="MELNDALYIPLAPSVVWDALQDLALVRASLDHCESFSRLARGEYA
FT                   LALTVPLGPLRARYDVRAHVVGERHDEPVHTRRTLNFRARADGIGALRGQIDVVLAPAD
FT                   DERGASRRAPTTRIEYAVWATASGPLAELPGRQIQNALHELADDFFNEFCAVVQAKHGL
FT                   APNRARDGAPQRQHVFLRPAAFTGIARRAHAQHLGGALTGRAASALHHRESNPVPLWAW
FT                   AVMIFFVALLLYAARWLNGG"
FT   gene            complement(52930..53565)
FT                   /gene="bpeR"
FT                   /locus_tag="BMA10247_0057"
FT   CDS_pept        complement(52930..53565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bpeR"
FT                   /locus_tag="BMA10247_0057"
FT                   /product="multidrug efflux pump repressor protein BpeR"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM PF08361"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05425"
FT                   /protein_id="ABO05425.1"
FT                   /translation="MARRTKEEALATRDRILDAAEHVFFEKGVSHTSLADIAQHAGVTR
FT                   GAIYWHFASKSELFDAMFDRVLLPIDELKAGTGEPHADPLGRIREILIWCLLGAARDPQ
FT                   LRRVFSILFMKCEYVADMGPLLQRNREGMRDALRNIEADLAQGVANGQLPADLDTWRAT
FT                   LMLHTLVSGFVRDMLMLPGEIDAERHAEKLVDGCFDMLRMSPAMRKDD"
FT   gene            53975..55237
FT                   /gene="bpeA"
FT                   /locus_tag="BMA10247_0058"
FT   CDS_pept        53975..55237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bpeA"
FT                   /locus_tag="BMA10247_0058"
FT                   /product="multidrug efflux periplasmic linker protein BpeA"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05478"
FT                   /protein_id="ABO05478.1"
FT                   /translation="MRVERVPYRLITVATAAVFLAACGKKESAPPPQTPEVGVVTVQPQ
FT                   PVPVVSELPGRTSAYLVAQVRARVDGIVLRREFTEGSDVKAGQRLYKIDPAPYIAQLNS
FT                   AKATLAKAQANLATQNALVARYKVLVAANAVSKQQYDDAVAAQGQAAADVGAGKAAVET
FT                   AQINLGYTDVVSPITGRVGISQVTPGAYVQASQATLMSTVQQLDPVYVDLTQSSLDGLK
FT                   LRQDIQSGRIKTEGPGAAKVTLILEDGKPYPERGKLQFSDVTVDQTTGSVTIRAIFPNK
FT                   QRVLLPGMFVRARIEEGVNENAFLVPQIGVTHDPKGQAIAMIVDGKGKVEPRVLVTGGT
FT                   QGQNWVVESGLQAGDRVIVQGIDKVRPGMTVKAAEAQLPAAAAGASGAAPAGGSPAQAA
FT                   AASAAASGAAPSSAAAASSAQ"
FT   gene            55253..58453
FT                   /gene="bpeB"
FT                   /locus_tag="BMA10247_0059"
FT   CDS_pept        55253..58453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bpeB"
FT                   /locus_tag="BMA10247_0059"
FT                   /product="inner membrane multidrug efflux protein BpeB"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00915"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04719"
FT                   /protein_id="ABO04719.1"
FT                   /translation="MAKFFIDRPIFAWVIAIILMLAGVAAIFTLPIAQYPTIAPPSIQI
FT                   TANYPGASAKTVEDTVTQVIEQQMSGLDNFLYMSSTSDDSGNATITITFAPGTNPDIAQ
FT                   VQVQNKLSLATPILPQVVQQLGLSVTKSSSSFLLVLAFNSEDGSMNKYDLANYVASHVK
FT                   DPISRINGVGTVTLFGSQYAMRIWLDPTKLTNYGLTPVDVTSAISAQNVQIAGGQLGGT
FT                   PAVPGTVLQATITEATLLQTPEQFGNILLKVNQDGSQVRLKDVAQIGLGGETYNFDTKY
FT                   NGQPTAALGIQLATNANALATAKAVRAKIDEMSAYFPHGLVVKYPYDTTPFVRLSIEEV
FT                   VKTLLEGIVLVFLVMYLFLQNLRATIIPTIAVPVVLLGTFAIMSMVGFSINVLSMFGLV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKAMGQITGALVGVALVLSAVFVPVAF
FT                   SGGSVGAIYRQFSLTIVSAMVLSVLVALILTPALCATILKPIPQGHHEEKKGFFGWFNR
FT                   TFNSSRDKYHVGVHHVIKRSGRWLIIYLAVIVAVGLLFVRLPKSFLPDEDQGLMFVIVQ
FT                   TPSGSTQETTARTLANISDYLLTQEKDIVESAFTVNGFSFAGRGQNSGLVFVKLKDYSQ
FT                   RQSSDQKVQALIGRMFGRYAGYKDALVIPFNPPSIPELGTAAGFDFELTDNAGLGHDAL
FT                   MAARNQLLGMAAKDPTLRGVRPNGLNDTPQYKVDIDREKANALGVTADAIDQTFSIAWA
FT                   SKYVNNFLDTDGRIKKVYVQSDAPFRMTPEDMNIWYVRNGSGGMVPFSAFATGHWTYGS
FT                   PKLERYNGISAMEIQGQAAPGKSTGQAMTAMETLAKKLPTGIGYSWTGLSFQEIQSGSQ
FT                   APILYAISILVVFLCLAALYESWSIPFSVIMVVPLGVIGALLAATLRGLENDVFFQVGL
FT                   LTTVGLSAKNAILIVEFARELQQTEKMGPIEAALEAARLRLRPILMTSLAFILGVMLLA
FT                   ISNGAGSASQHAIGTGVIGGMITATFLAIFMIPMFFVKVRAVFSGEKEDADEALRLAHE
FT                   HMHRDDKPEHGDDAGKKD"
FT   gene            58457..60001
FT                   /gene="oprB"
FT                   /locus_tag="BMA10247_0060"
FT   CDS_pept        58457..60001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprB"
FT                   /locus_tag="BMA10247_0060"
FT                   /product="outer membrane efflux protein OprB"
FT                   /note="identified by similarity to GB:CAH34807.1; match to
FT                   protein family HMM PF02321; match to protein family HMM
FT                   TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05862"
FT                   /protein_id="ABO05862.1"
FT                   /translation="MKRKHALTALAVALLAAGCTLAPRYERPAAPVSGAFPADGVYAAQ
FT                   PGAAPGARSANGQAAVDIGWREFFVDPRLQRLIEIALKNNRDLRVSVLNVEASRAQYQI
FT                   TRAGLFPTLSGTGTGTIQRTPAGVSITGQPLISRTYNVGVSASWELDLFGRVQSLKDQA
FT                   LAQYFATAQARKAAEISLVASVADQYLTLLSTDDLLQVTQNTLKSARASYDLTKLQFDN
FT                   GTGSELDLCQAQTVVETALASQQAQARARAQALNALVLLIGEPLPDDLPADLPLNAQNL
FT                   LTDIPAGLPSDLLTRRPDIMQAEETLRAANANIGAARAAFFPKISLTSAFGTASTTLGG
FT                   LFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHVQKRIEIANYEKAIQSAFREVSDGLA
FT                   ARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVDSYLSVLTAQTDLYSAQQQLISARL
FT                   ARWTNLVDLYRALGGGWLERAGETPRPADAPVDYGKAAPAPAAAVPAASASAPAAG"
FT   gene            60439..61179
FT                   /pseudo
FT                   /locus_tag="BMA10247_0061"
FT                   /note="isrso15-transposase; this gene contains a premature
FT                   stop which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01610"
FT   gene            61180..61659
FT                   /pseudo
FT                   /locus_tag="BMA10247_0062"
FT                   /note="ISBma1, transposase; this gene contains a premature
FT                   stop which may be the result of a sequencing error"
FT   gene            61656..61823
FT                   /locus_tag="BMA10247_0063"
FT   CDS_pept        61656..61823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0063"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06155"
FT                   /protein_id="ABO06155.1"
FT                   /translation="MNLFSLRVSRRGGAAVRFAPRTAACPAPRGLPRHRDSMRGWRLNA
FT                   GSTFDIDGAP"
FT   gene            complement(61895..62626)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0064"
FT                   /note="xanthine/uracil permease family protein, truncation;
FT                   comparison of this gene to its homologs suggests this gene
FT                   has been truncated; identified by match to protein family
FT                   HMM PF00860"
FT   gene            62714..62977
FT                   /locus_tag="BMA10247_0065"
FT   CDS_pept        62714..62977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0065"
FT                   /product="transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04704"
FT                   /protein_id="ABO04704.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            63001..63834
FT                   /locus_tag="BMA10247_0066"
FT   CDS_pept        63001..63834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0066"
FT                   /product="A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04706"
FT                   /protein_id="ABO04706.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(63862..64386)
FT                   /locus_tag="BMA10247_0067"
FT   CDS_pept        complement(63862..64386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0067"
FT                   /product="xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07068"
FT                   /protein_id="ABO07068.1"
FT                   /translation="MQSNTVHPCDEVLPTGKLLTLGLQHVLVMYAGAVAVPLIVGGALK
FT                   LPKDQIAFLISADLFACGIATLIQTLGVWLFGIRLPVIMGCTFAAVGPMIAIGTNPGLG
FT                   ILDIFGSTIAAGAIGIVLAPMIGKLLRFFPPVVVGTVISVIGLSLMEVGINWAAGGVGN
FT                   PNYGDLTCPLR"
FT   gene            64548..66152
FT                   /pseudo
FT                   /locus_tag="BMA10247_0068"
FT                   /note="xylulokinase; this gene contains a frame shift which
FT                   may be the result of a sequencing error; identified by
FT                   match to protein family HMM PF00370"
FT   gene            complement(66428..67462)
FT                   /locus_tag="BMA10247_0069"
FT   CDS_pept        complement(66428..67462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0069"
FT                   /product="DJ-1/PfpI family protein/transcriptional
FT                   regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05003"
FT                   /protein_id="ABO05003.1"
FT                   /translation="MAAQTPLRHRTTTVDVVIYPGFKAIEAVGVINVFDYANARLAAAG
FT                   LAPVYDLQIAAPAKGAVKSDTLIVLEATKALDTLAVPDTAIVVDARDIERALRDTSMLV
FT                   GWCRDVSARIGRMVGLCSGCFFLAEAGMLDGRRATTHWSVAPLLRARYPAVKVEPDAIF
FT                   VREGNVWTSAGVTAGLDLALAMVEEDLGREIALAVARDLVIYLKRPGGQSQFSVYLASQ
FT                   MTAHASIRDIQDWILNALDARLSIAQLARRAAMSERNFIRVFVRETGYRPAEFIEIARL
FT                   EKARRLLEQEALPLKTVAVRSGFRSDDQLRRVFMRRLGVTPGAYRERFSGTGVREARGS
FT                   GDVD"
FT   gene            67667..68773
FT                   /locus_tag="BMA10247_0070"
FT   CDS_pept        67667..68773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0070"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase/class
FT                   III alcohol dehydrogenase"
FT                   /EC_number="1.1.1.284"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240; match to protein
FT                   family HMM TIGR02818"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04300"
FT                   /protein_id="ABO04300.1"
FT                   /translation="MKTKAAIAWKAGEPLTIEEVDLEGPRAGEVLIEVKATGICHTDYY
FT                   TLSGADPEGIFPAILGHEGAGVVVDVGPGVGTLKKGDHVIPLYTPECRECKFCLSRKTN
FT                   LCQKIRATQGRGLMPDATSRFSVGGKPIFHYMGTSTFSNYIVVPEIAVAKVREDAPFDK
FT                   ICYIGCGVTTGVGAVVYSAKVEAGANVVVFGLGGIGLNVIQGARMVGADKIIGVDLNPK
FT                   RVELARKFGMTHFINPNEVENVVDHIVQLTDGGADYSFECIGNVKVMRQALECTHKGWG
FT                   QSFIIGVAAAGEEISTRPFQLVTGREWKGSAFGGARGRTDVPKIVDWYMEGKINIDDLI
FT                   THTLPLEKINEGFELMKKGESIRSVVLY"
FT   gene            68787..69647
FT                   /gene="fghA"
FT                   /locus_tag="BMA10247_0071"
FT   CDS_pept        68787..69647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fghA"
FT                   /locus_tag="BMA10247_0071"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.2.12"
FT                   /note="identified by match to protein family HMM PF00756;
FT                   match to protein family HMM TIGR02821"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06557"
FT                   /protein_id="ABO06557.1"
FT                   /translation="METTTLECVSSHACHGGEQRFYRHESKTIGLPMKFSAYLPPQAAH
FT                   GRVPALFYLAGLTCTEETFAIKAGAQRFAAQHGIALVAPDTSPRGAGVPGEADAWDFGV
FT                   GAGFYVDATEAPWSAHYRMESYVSGELREIVAAELPIDAARLGIFGHSMGGHGALVLAL
FT                   RHPQLYRSVSAFAPIAAPTRCPWGEKAFSGYLGADREAWKRHDASELVARADAKRFAEG
FT                   ILIDQGLADPFLPTQLHPDAFEAVCRAAGQPLTLRRHAGYDHGYYFISTFIADHLAHHA
FT                   RVLGR"
FT   gene            complement(69792..70616)
FT                   /locus_tag="BMA10247_0072"
FT   CDS_pept        complement(69792..70616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0072"
FT                   /product="putative cation ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00950"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04839"
FT                   /protein_id="ABO04839.1"
FT                   /translation="MRIHMAAGTHTMFEYEFMINAFAAAGIVAVLAGIVGYFLVLRGQT
FT                   FAGHALSHVGFAGATGAALFGLSPIWGMLGFTLAAGIGMGALGERLAGRDVAIGVILSV
FT                   ALGCGLLFLHFYTNYATQVTALLFGNVLGVSHATLVVLAAIGAVSLAALAAIARPLLFA
FT                   SLQPELAEAKGVSLRLVSILFLSIGALAVAACTQIVGVLLVFTLLVGPAAAAQNLATRL
FT                   STGVWLAAAFALGEAWLGITLAYYTDWPTSFWITALSALVYGASLVGRRHHA"
FT   gene            complement(70576..71436)
FT                   /locus_tag="BMA10247_0073"
FT   CDS_pept        complement(70576..71436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0073"
FT                   /product="putative cation ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04106"
FT                   /protein_id="ABO04106.1"
FT                   /translation="MHALELDHVTLALGGRTILRDVSFAVESGEFVGVLGPNGAGKTTL
FT                   MRAVLGLVPAHSGAIRVAGEPVARGNPAIGYMPQIRSALAGRRVRGRDFVAMAADGHRW
FT                   GLPHTSAAVAADVDRVLDLVGASALAKRPLSELSGGERQRLLLAQCLLGTPTLLLLDEP
FT                   LISLDPNHQRGVVELVRRVQRELGITVLFSAHELNPLLNALDRVLYLGNGVAALGTVDE
FT                   VITKPVLSRLYGSPIDVMRVNGRIFVMSGDVEVEKHDHGHEDEHDHGHEHGHAHSHGGG
FT                   HSHDV"
FT   gene            complement(71471..72409)
FT                   /locus_tag="BMA10247_0074"
FT   CDS_pept        complement(71471..72409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0074"
FT                   /product="putative cation ABC transporter, periplasmic
FT                   cation-binding protein"
FT                   /note="identified by match to protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07359"
FT                   /protein_id="ABO07359.1"
FT                   /translation="MFASCSSRSPSAPLALRASPLLRAARALAAGVAALALASAAFAQN
FT                   ATLKIVAAENFYGDVAKQIGGARVAVSSVLSNPDQDPHLFEASPKVARELQHADLVIYN
FT                   GADYDPWMAKLLAASKNAKRATVVVAELVGKKAGDNPHLWYDPATMPAAARALAAALGS
FT                   ADPAHKAEYDANLAKFVASMKPIDAKVAGLRARYKGVPVTATEPVFGYMADAIGLDMRN
FT                   PRFQLATMNNTEASPADIAAFENDLKRRQVHVLIYNSQAVEPMTKRMLKLAQDARVPTV
FT                   SVTETQPAGKTFQQWMLAQLDALGAALGKRP"
FT   gene            complement(72622..73086)
FT                   /locus_tag="BMA10247_0075"
FT   CDS_pept        complement(72622..73086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0075"
FT                   /product="transcriptional regulator, Fur family"
FT                   /note="identified by match to protein family HMM PF01475"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06133"
FT                   /protein_id="ABO06133.1"
FT                   /translation="MASTHSLAARLSRADAFAAEHGLAWTPLRRQVYERVLAAGRPIGA
FT                   YDLLTELEPQRGRVPPTTVYRALEFLVEHGFIHRIESKNAFIACCEIGKPHEGQFLICE
FT                   ACGDTVEIPGGDLAKQLSSSPPAHGFEVHRQVVELTGLCGQCKTKHAHHG"
FT   gene            73380..74156
FT                   /locus_tag="BMA10247_0076"
FT   CDS_pept        73380..74156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0076"
FT                   /product="L-iditol 2-dehydrogenase"
FT                   /EC_number="1.1.1.14"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05832"
FT                   /protein_id="ABO05832.1"
FT                   /translation="MRLQEKVAILTGAASGIGEAVARRYLEEGARCVLVDLKPADGALA
FT                   RLIDAHAGRAIAVSADVTRRDDIARIVATAVERFGGVDILFNNAALFDMSPLLDESWDV
FT                   FDRLFAVNVKGLFFLMQAVAQRMVEQGRGGKIVNMSSQAGRRGEALVSHYCATKAAVLS
FT                   YTQSAALALARHGINVNGIAPGVVDTPMWEQVDALFARYENRPLGEKKRLVGEAVPLGR
FT                   MGVPDDLTGAALFLASADADYITAQTLNVDGGNWMS"
FT   gene            74161..75117
FT                   /locus_tag="BMA10247_0077"
FT   CDS_pept        74161..75117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0077"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05030"
FT                   /protein_id="ABO05030.1"
FT                   /translation="MAAIVAAGELLAEFVAAKRGQGFDAPGEFAGPFPSGAPAIFADQA
FT                   ARMGASVAYAGCVGRDAFGDAIVARLASHGVDVAHIRRAARPTGIACVAYRADGGRQFV
FT                   FSIEGSASALLEPADVVPSMFAGCRYFHVMGSSLTSENAIAAVKRGVIEAARVGAKISF
FT                   DPNVRAEILAFAPMRAALREMLDACHLFLPSEADLPFFCGPQPAERAIAGLLATHPLLE
FT                   RVVLKRGAAGSAAFDRTGSVAAPAYETAEVDPTGAGDCFGGTFVACAIAGLPVASALAR
FT                   ANAAGALAVSRIGPMEGNSMPADIDRFLAERGVRCAA"
FT   gene            75105..76550
FT                   /pseudo
FT                   /locus_tag="BMA10247_0078"
FT                   /note="tagatose 6 phosphate kinase; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF08013"
FT   gene            76645..77973
FT                   /locus_tag="BMA10247_0079"
FT   CDS_pept        76645..77973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0079"
FT                   /product="putative sorbitol/mannitol ABC transporter,
FT                   periplasmic sorbitol/mannitol-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05019"
FT                   /protein_id="ABO05019.1"
FT                   /translation="MQRKTLTAAAARVAAFAALASSALAAQAATLTIATLNNPDMIELK
FT                   KLSSAFEKANPDIRLNWVILEENVLRQRATTDITTGSGQFDVMAIGTYEAPQWGKRGWL
FT                   APMSNLPADYDLNDVIKTARDSLSYNGQLYALPFYVESSMTFYRKDLFAAKGLKMPEQP
FT                   TYEQIAEFADKLTDRANGTYGICLRGKAGWGENMAYVSTVVNTFGGRWFDENWNAQLTS
FT                   PEWKKAINFYVNLLKKNGPPGASSNGFNENLTLTASGKCAMWIDATVAAGMLYNKQQSQ
FT                   VAEKIGFAAAPVAATPKGSHWLWAWALAIPKTSKQQDAAKKFVTWATSKQYVEMVGKDE
FT                   GWASVPPGTRQSTYQRAEYKAAAPFSEFVLKAIQTADPTDPSLKKVPYTGVQYVGIPEF
FT                   QSFGTVVGQAIAGAVAGQTSVDQALAAGQAAAERAVRQAGYRK"
FT   gene            78069..79025
FT                   /locus_tag="BMA10247_0080"
FT   CDS_pept        78069..79025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0080"
FT                   /product="putative sorbitol/mannitol ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04278"
FT                   /protein_id="ABO04278.1"
FT                   /translation="MVPIMRHLRLPLAHSASLVGAGPAADERARGKPARWLAAPSVAVL
FT                   LLWMAIPLAMTIWFSLTRYNLLNPDVKGFAGLDNYRFLATDPSFLPAIWHTLALIGSVL
FT                   AITVAGGVLMAVLFDRKFYGQGIARLIAIAPFFVMPTVSALIWKNMILHPVYGLVARAM
FT                   RALGMQPIDWFAQYPLTSIVIIVAWQWLPFAFLILFTAIQSLDQEQKEAARIDGAGAFA
FT                   MFFYITLPHLRRAIAVVVMMETIFLLSIFAEIYTTTGGGPGDATTNLSYLIYALGLQQF
FT                   DVGLASAGGILAVVLANVVSFFLVRMLARNLKGEYEA"
FT   gene            79022..79888
FT                   /locus_tag="BMA10247_0081"
FT   CDS_pept        79022..79888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0081"
FT                   /product="putative sorbitol/mannitol ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06104"
FT                   /protein_id="ABO06104.1"
FT                   /translation="MSGLTVSTPRGAFGAPRAALGALKRALPGLLAWLVALALFFPIFW
FT                   MAITAFKTEQQAYSSALFFVPTLDSFREVFARSNYFAFAWNSVLISAGVTVICLLLAVP
FT                   AAYAMAFFPGRRTQKVLLWMLSTKMMPSVGVLVPIYLMWKNAGLLDTVSGLVIVYTLIN
FT                   LPIAVWMTFTYFNEIPKDILEAGRIDGASTWQEIVYLLMPMALPGLASTALLLVILSWN
FT                   EAFWSINLSSSNAAPLTVFIASYSSPEGLFWAKLSAASLLAVAPILVVGWLSQKQLVRG
FT                   LTFGAVK"
FT   gene            79885..80583
FT                   /locus_tag="BMA10247_0082"
FT   CDS_pept        79885..80583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0082"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05318"
FT                   /protein_id="ABO05318.1"
FT                   /translation="MTAPANDARVLICDCDGVLIDSETIAADVLVRELEARWPGVAARP
FT                   IVLPLLGLRTERVLDCASARVGRALADSDIEAIRRSVEAAAVQAPIVDGIDAALARIDL
FT                   TIACASNSRRHYVDATLRRTGLKRFFGERLFCADGVARPKPAPDVYLAAAQALGVAPSQ
FT                   CLVVEDSATGVTAASAAGMTVLGFVGGGHASPRQVDALRAIGARRVFDDMRELPGLVSR
FT                   WAETGVVEPH"
FT   gene            80644..81756
FT                   /locus_tag="BMA10247_0084"
FT   CDS_pept        80644..81756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0084"
FT                   /product="ABC transporter, carbohydrate uptake
FT                   transporter-1 (CUT1) family, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF03459; match to protein
FT                   family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07340"
FT                   /protein_id="ABO07340.1"
FT                   /translation="MASVLLRNIGKRYDDNEVLRNVNLDIADGEFVVFVGPSGCGKSTL
FT                   MRMIAGLEEISGGELLIDGAKVNDVPSAKRGIAMVFQSYALYPHMTLYDNMAFGLKLAG
FT                   AKKQEIDDAVKQAARILHIDHLLDRKPRQLSGGQRQRVAIGRAITRKPKVFLFDEPLSN
FT                   LDAALRVKMRLEFARLHDELKTTMIYVTHDQVEAMTLADKIVVLSAGSVQQVGAPNALY
FT                   HAPANQFVAGFIGSPKMNFLAGVVESASADGALVRFESGETQRAAVDASTLRAGERVTV
FT                   GIRPEHLHVGVTGGDGIVARTMAVESLGDAAYLYAESAVAPDGLIARIPPLDTYRAGEM
FT                   LRVGAQPEHCHLFDADGRAFKRKPRHALAA"
FT   gene            complement(81722..81964)
FT                   /locus_tag="BMA10247_0083"
FT   CDS_pept        complement(81722..81964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0083"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04616"
FT                   /protein_id="ABO04616.1"
FT                   /translation="MSAARGPAGRRGGGRARAPRALPASRTRRTACATSRRIRHGASAP
FT                   VGPVGGSPHARRARVRPAARPRRRVTRPARASACA"
FT   gene            complement(81961..83514)
FT                   /locus_tag="BMA10247_0085"
FT   CDS_pept        complement(81961..83514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05720"
FT                   /protein_id="ABO05720.1"
FT                   /translation="MPTRPRRPARRARIRRRIRLRIRSARQNRPRRARRSHFDIRMSVF
FT                   DGRAVLWATMLGGTRLCRRIGGRHAAGPAPARESPSENSMKTGRRHFVRSVASASAALA
FT                   AAAWSPARAAIDAPASPATALSLTPGRWSPNNVARLRAVLAGHGASSPRYRPEHRPYAV
FT                   FDWDNTSIMNDCEEALLMHQIDGLHYRLTPEQFSAILRQGVPDGPFDAKLGYTSVDGKP
FT                   VRMEDIAADVDADYRWLHANYRGLAGDKPLDEIHRSEQFRDFRAKLYFMYDAICDTYPV
FT                   EIGYKWIMYWYVGMTRDELQAMAFDSNVANLGDALRKVTYESSRALPGKAGVIAATHFH
FT                   GIRIHEEIRAVMDTLRSNGIDVYVSTASLDDVVRVFAGHPAFGYGVPAENVIGMRLTMA
FT                   DGKYMNEYLPNWHFNYGPGKTVGIRRELEAKKGYGPLLVFGDSDGDAWMLRDFADTAVG
FT                   VIVNRMKKGEIGIDSRKAAEQIGAKDARLVLQGRDENTGLMVADERSIKYGKRDPKLLA
FT                   "
FT   gene            complement(83633..84517)
FT                   /locus_tag="BMA10247_0086"
FT   CDS_pept        complement(83633..84517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0086"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04763"
FT                   /protein_id="ABO04763.1"
FT                   /translation="MESLSGFVVFVQVAETRSFVAAARALGVSASAVGKRIARLEARLN
FT                   VRLFHRSTRSIALTAEGARFLERCRRVLAEIEEAEQELSRSAHAPSGRLRVSLPALSAP
FT                   VLPVLADFMAAYPDIQLDLDFTDRLVDVIDEGFDAVVRGGEPRDSRLSARRLGTFAQVV
FT                   VGSPDYFARRGTPRTPADLAHHTCLLYRFPTTGKLERWPLRPAPGDADVEPPRSMICNN
FT                   VETRVCFAIRGRGLACVPDFAVRDELASARLRTVLDAYIERPQTFHVLWPSGRHASPKL
FT                   RAFVDFIVGRMFA"
FT   gene            84655..85851
FT                   /locus_tag="BMA10247_0087"
FT   CDS_pept        84655..85851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0087"
FT                   /product="putative esterase"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05677"
FT                   /protein_id="ABO05677.1"
FT                   /translation="MVLSSWSALGERVDAAIDAALAQRRLVGAVVLVARRGELAYRRAA
FT                   GLADREAGVPMREDALFRFASVSKPIVSAAAMRAVAAGKLDLDASIARWLPAFTPALAG
FT                   GRPARITARQLLSHTAGLGYRFLETHAHGPYARAGVSDGMDRAGISLAENLRRIASVPL
FT                   LYEPGTSWAYSLATDVLGALIEAVCDKPLEDAVAEFVTTPLGMVDTRFYAHDAARLAAA
FT                   YVDASDAAAPGGPRRMAALEIASPFPDTAGIRFEPARALDAHAFASGGAGMVGTASDVL
FT                   ALIEALRTGGDGWLPAARIDEMARIQPGAEDLPTAPGYGFGLGFSVLRDPAAARSPESV
FT                   GTWRWGGAYGHAWFVDRAAGLSVVALTNTAYEGMSGRFVADLRDAVYGAGAAAQERAA"
FT   gene            85848..87059
FT                   /locus_tag="BMA10247_0088"
FT   CDS_pept        85848..87059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0088"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04899"
FT                   /protein_id="ABO04899.1"
FT                   /translation="MSDCTTRPAGFARPSREAARLPLAGLLALATAGFITIVTEALPAG
FT                   LLPLMGRDLRVSDALVGQLVTVYAAGSIVAAMPLVAATRGMRRRPLLLAALAGFVVANT
FT                   ATAASPYYAPVLVARCVAGVSAGLLWALLAGYASRMVDARQRGRAIAIAMLGAPVAMSV
FT                   GIPLGTALGAALGWRATFAGVTALTLALIAWVRASLPDAPGRPSGERLPVARVLRMPGV
FT                   LPVLAVMFAYVLAHNILYTYIAPFLASAGMGTRIDATLFAFGAASFAGIGLTGVWIGNG
FT                   LRRLALASIALFALASVLLGVASGSPAVVYASVAVWGLTFGGAATVFQTASANAAGEAA
FT                   DVAQSMIVTVWNLAIAAGGVAGGVLLERFGAGAMPWALVALLVPAWLGAWRARRHGFPA
FT                   ARAP"
FT   gene            complement(87221..88168)
FT                   /locus_tag="BMA10247_0089"
FT   CDS_pept        complement(87221..88168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0089"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF04198"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07074"
FT                   /protein_id="ABO07074.1"
FT                   /translation="MSKSSEKLDLATRAAWLYYVAGDTQNEIAEKLQVSRPVAQRLVAF
FT                   AVEKNLIRVRVDHRIADCLDLAAQLSKRYGLAMCEVVPIDGDAPDAIDRKLAVAGAQVM
FT                   ERYLNEERPMVIAVSSGRTLKAAVAQIAQLERPQHRLVSMVGAIAQDGSSNPYDVAQHI
FT                   SEKTGGKHFLLPAPLFADSEAERAQWCNHRLYRIVEKLSAQADVAFVGVGNIGAHCPLF
FT                   EDGFITAAELGEMVELGAVAEMLGLPIDAQGRPIVASTSTRVTSVALDAPPSRPTIGFA
FT                   GGPRKRAAVLAALRGRWLSGLVTDETCARAALAE"
FT   gene            complement(88255..89727)
FT                   /gene="xylB-1"
FT                   /locus_tag="BMA10247_0090"
FT   CDS_pept        complement(88255..89727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB-1"
FT                   /locus_tag="BMA10247_0090"
FT                   /product="xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01312"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06275"
FT                   /protein_id="ABO06275.1"
FT                   /translation="MYLGIDLGTSEVKVLLLSPDGAVVGTAGTPFTVARAHPRWAEQHP
FT                   DDWWAGTLAALRARHPQAFAAVRGIGLSGQMHGAVLLDSGDRVLRPAILWNDMRSADEC
FT                   ALLEARAPELHAIAGNLAMPGFTAPKLLWVARHEPDVFGRIACVLMPKDYLRLKLTGEK
FT                   VSDPSDAAGTLWLDAARRDWSGALLAAGGMTRAQMPRIVEGNAPSGTLRADVARALGLA
FT                   ESVVVAGGGGDNATSALGIGATQPGDGFVSLGTSGVLSVVGNRFRPNPASAVHAFCHAI
FT                   PERWQQMSVVLSAASCLRWVCKLTSTDEPALLAEIAALDPAARENAPLFLPYLSGERTP
FT                   HNDPYAQGVFFGMTHGTERALLGYAVLEGVTLALADGFDALIAGGTQTDALSLIGGGAR
FT                   SAYWAQLIADALGVRTRRHGGGETGAALGAARLGWLAVGGAPRDVLAKPPLRDEFAPDA
FT                   ARHAALRARLDAFRALYRHVRPLFEPSRARLA"
FT   gene            complement(89838..91280)
FT                   /locus_tag="BMA10247_0091"
FT   CDS_pept        complement(89838..91280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0091"
FT                   /product="mannitol dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF01232;
FT                   match to protein family HMM PF08125"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05508"
FT                   /protein_id="ABO05508.1"
FT                   /translation="MIYTKFGGREPAVRRHGMSSPSTAAPAILHIGVGSFHRAHQAWYL
FT                   HRVNEASPAAERWSLVVGDIRDDLRASREALAAQHGVYTLETVTPQGERAYETIRSITR
FT                   VLPWSMDLAALVDAGAAPACRIVSFTVTEGGYYLDEHDRLDVANPDLAADLQGARLTIY
FT                   GALAALLAERAARGAGPLTLQSCDNLRNNGARFRAGMRAFLARRGLVELLAWFDANVAC
FT                   PSSMVDRITPRPTPDVRERVRAATGFDDACPVMGEAFIQWVIEDRFAAGRPAWEKAGAE
FT                   LVDDVHPYEEAKIRILNATHSCIAWAGTLAGHSYIHEGTRDAHIRRFAHAYVTDDVIPY
FT                   LTPSPLDLARYRDVVLERFGNPHIRDTNQRVAADGFSKIPGFIAPTLAESIARGVEPVS
FT                   TAVLPALFLRFLQRWAQGALPYAYQDGVMDARVARAIAGAADPVAALAGERPLWGALAG
FT                   TPALERALRAGAARVDAWLASR"
FT   gene            complement(91452..92348)
FT                   /locus_tag="BMA10247_0092"
FT   CDS_pept        complement(91452..92348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0092"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04707"
FT                   /protein_id="ABO04707.1"
FT                   /translation="MTFDLRQLRAFTTIAASGSLGRAADALHVTQPALSRILKRLEEQI
FT                   GAPLFERHSKGVQLTAIGEALLPHEAEHAREEIDALRGLAKGTIKVGAVGSIASFVLPV
FT                   ALGRVLDRWPNLRVVIVEGVWDRLVDALLTHEIDIALSTRVPDTDEVVAIAECRWDDVS
FT                   HVVAAPDHPLRAAARAPLTLADTRAARWAIPPRGTAPFEQMRAAFDAHGLAPPDIAVET
FT                   RSVTALKSLVAHAGFLSWMAEPMYRAERRARTIDTLAVEGVAATRTLTAFRRRHGILPG
FT                   PAARLLEALALLTREPF"
FT   gene            92449..94068
FT                   /gene="mdlC"
FT                   /locus_tag="BMA10247_0093"
FT   CDS_pept        92449..94068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlC"
FT                   /locus_tag="BMA10247_0093"
FT                   /product="benzoylformate decarboxylase"
FT                   /EC_number="4.1.1.7"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06637"
FT                   /protein_id="ABO06637.1"
FT                   /translation="MTPPDLRADAPARAPYTVRDAVIDLLRRFGIRKVFGNPGSTELPM
FT                   FRNFPDDFEYVLGLHEAVAVGMADGYAQASGNAAVVNLHSAAGVGNAMGVLFTAYRNKT
FT                   PLVVTAGQQARSILPFEPFLASVQAAELPKPYVKWSIEPARAEDVPAAIARAYHVAMQE
FT                   PRGPVFVSIPADDWDRPAEPMPARTVSSEVRPAPEALARLGDALDASERPAFVVGAAVA
FT                   RAGAWDDAVRLAERHRARVYAAPMSGRCSFPEDHPLFAGFLPPIRERIVEQLAGHDFIL
FT                   AFGAPVFTYHIEGFGPHVPAGAALHQLVDDPSVAAWTPVGDAVVGNLRLAARDLLARAA
FT                   PRERPMPAPRAPRGRVGPGAPGERMPVAFALQTLADVRGSRDVVVEEAPSARPAMHEHL
FT                   PFSSADTFYTMDSGGLGYGMPAALGIALGSPGRRVIALIGDGSSLYSIQALWSAVHLKL
FT                   PVTFVILNNARYAALQDFAPVFGFRDGEPVQGTALPGLDFVSLARGFGCDGVRVSDAAR
FT                   LRDALEQALASPVPVVVDVDVA"
FT   gene            94183..95634
FT                   /locus_tag="BMA10247_0094"
FT   CDS_pept        94183..95634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0094"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07232"
FT                   /protein_id="ABO07232.1"
FT                   /translation="MQDISMLIGGERRPATGGATFERRNPLDGELATRAPAATAADARA
FT                   AVDAASAAFAPWAALGPSARRALLLKAAAALEGKRDAFIAAMAAETGASAIWARFNVEL
FT                   AANGLVEAAALTTQIGGELIPSDVPGSLAMGVRQPAGVVLGIAPWNAPVILGVRALALP
FT                   LACGNTVVFKGSELCPATHGLIADALHEAGLPRGVVNFVTNAPADAGAVVDAMIAHPAV
FT                   RRVNFTGSTRVGRIIAERCARHLKPAVLELGGKAPFVVLDDADLDAAVAAAAFGAFANS
FT                   GQICMSTERIIVDERIADAFVAKLADKAASLPLGDPRNGPVVLGSVIDAQTVERCNALI
FT                   DDALAKGAVLRCGGKADSTLMPATLVDRVTPAMRLYAEESFGPVKGIVRVAGEEAAIAC
FT                   ANDNAFGLSSAVFSRDVARAMRVAARIEAGICHVNGPTVHDEAQMPFGGMKDSGFGHFG
FT                   GKAGIAEFTDLRWITVQTAPRHYPF"
FT   gene            95639..96595
FT                   /gene="panE_1"
FT                   /locus_tag="BMA10247_0095"
FT   CDS_pept        95639..96595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE_1"
FT                   /locus_tag="BMA10247_0095"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="identified by match to protein family HMM PF02558;
FT                   match to protein family HMM PF03721; match to protein
FT                   family HMM PF08546; match to protein family HMM TIGR00745"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05095"
FT                   /protein_id="ABO05095.1"
FT                   /translation="MATIEMTALRIAMLGAGAMGSLFGGLLAECGHDVTLVDVNAAHVD
FT                   AIARDGLRLDTDRGERRVARLAALRPDGVAAHAGMPPDLVIVFTKTLHTRAALAGARAL
FT                   FGPRTHALTLQNGLGNVETLAEYVPLERILVGVTTWPADLAGPAHVRSHGAGWVRLMSA
FT                   DGAMRPIVQASAHALDRAGLNCAIDTGVWATIWEKVGFNAALNTLCALTRGTVDALGAR
FT                   EDGPALALAIVAEVAAVARAKGIGVDERRMRENVLHAIREHRGHRPSMLQDVLAGRRTE
FT                   IDAINGAVVAAAGELGVAVPHVRTLLQLVRLIDAQGG"
FT   gene            complement(97077..97265)
FT                   /locus_tag="BMA10247_0096"
FT   CDS_pept        complement(97077..97265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0096"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04295"
FT                   /protein_id="ABO04295.1"
FT                   /translation="MGFMSSPECPLDRRVALTRPAPAFFETVRDVAGTPCGARASSASH
FT                   EPRAARDGKRSRGRALI"
FT   gene            97275..98729
FT                   /locus_tag="BMA10247_0097"
FT   CDS_pept        97275..98729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0097"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04901"
FT                   /protein_id="ABO04901.1"
FT                   /translation="MFRRGAPPHRRIERRAPEARMSARHGGAPLALDIGATLDHGPFTA
FT                   MQRVAVLLAAFAIVLDGFDSQLIGFAIPVLIKEWGITRDAFAPAVAAGLFGMGVGSACA
FT                   GLFADRFGRRWAIIGSVFVFGAATCAIGFAPNVATIAALRFVAGLGIGGALPTATTMTA
FT                   EYTPARRRTMMVTATIVCVPAGGMLAGLFAHEVLPAYGWRGLFWLGGALPLALGLLLVR
FT                   ALPESPRYLARNPARWRELGALLARMGRPVADGTAFTDLAEARAHEGQRRGVRALFSAA
FT                   YARDTIALWCAFCMCLLAVYSAFSWLPTMLTSQGLSVSVAGSGLTAYNLGGVLGALGCA
FT                   LAIGRFGSRWPLAFCCAGGAASAAWLLGVDAGSHAGWLIVGLAAHGFFVNAVQSTMYAL
FT                   CTFIYPTPVRATGTAGAVAFGRVGAILSAFAGAYVISAGGANAYLAMLAAAMAVVLVAL
FT                   LALRRHIPRLRRGGLPAADELARTAP"
FT   gene            complement(98755..99675)
FT                   /gene="kynA"
FT                   /locus_tag="BMA10247_0098"
FT   CDS_pept        complement(98755..99675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kynA"
FT                   /locus_tag="BMA10247_0098"
FT                   /product="tryptophan 2,3-dioxygenase"
FT                   /EC_number="1.13.11.11"
FT                   /note="identified by match to protein family HMM PF03301;
FT                   match to protein family HMM TIGR03036"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06394"
FT                   /db_xref="GOA:A3MHE1"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR017485"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHE1"
FT                   /protein_id="ABO06394.1"
FT                   /translation="MQPPGDDAAPRCPFAGAHAPDAPHVPEAAGDDVQAGWHRAQLDFS
FT                   QSMSYGDYLSLDPILDAQHPRSPDHNEMLFIIQHQTSELWMKLALYELRAALASIRDDA
FT                   LPPAFKMLARVSRVLEQLVQAWNVLATMTPSEYSAMRPYLGASSGFQSYQYRELEFILG
FT                   NKNAQMLRPHAHRPAIHAHLEASLQAPSLYDEVIRLLARRGFPIAPERLDADWTQPTRH
FT                   DRTVETAWLAVYREPNAHWELYEMAEELVDLEDAFRQWRFRHVTTVERIIGFKQGTGST
FT                   SGAPYLRKMLDVVLFPELWHVRTTL"
FT   gene            complement(99774..101024)
FT                   /gene="kynU"
FT                   /locus_tag="BMA10247_0099"
FT   CDS_pept        complement(99774..101024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kynU"
FT                   /locus_tag="BMA10247_0099"
FT                   /product="kynureninase"
FT                   /EC_number="3.7.1.3"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM TIGR01814"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07333"
FT                   /db_xref="GOA:A3MHE2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHE2"
FT                   /protein_id="ABO07333.1"
FT                   /translation="MKTREEALALDRDDPLAPLREQFALPAGVIYLDGNSLGAQPRAAA
FT                   ARAQQVIGAEWGEGLIRSWNTAGWFALPRRLGDRLAPLIGAADDEVAITDTISINLFKL
FT                   LAAMLRHQARHAPKRRVIVSERSNFPTDLYIAQGLIAQLDRDYELRLIDDPADLPDALD
FT                   DETAVAMITHVNYRTGYMHDMPSVTQTVRQAGALMLWDLAHSAGAVPVDLNGALADGAV
FT                   GCTYKYLNGGPGSPAFVWVPKRHQRAFEQPLSGWWGHRAPFAMQPAFEPDPGIARFLCG
FT                   TQPIVSMSMVECGLDVFAQTDMHAIRRKSLALTDAFVALVESRCAGQPLKLVTPRAHHQ
FT                   RGSQASFEHPHGYEVMQALIARGVIGDYREPRILRFGFTPLYTRFVDVWDAVETLRDIL
FT                   DTEAWRAPEFATRAAVT"
FT   gene            complement(101066..101707)
FT                   /gene="kynB"
FT                   /locus_tag="BMA10247_0100"
FT   CDS_pept        complement(101066..101707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kynB"
FT                   /locus_tag="BMA10247_0100"
FT                   /product="arylformamidase"
FT                   /EC_number="3.5.1.9"
FT                   /note="identified by match to protein family HMM PF04199;
FT                   match to protein family HMM TIGR03035"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04524"
FT                   /db_xref="GOA:A3MHE3"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR017484"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHE3"
FT                   /protein_id="ABO04524.1"
FT                   /translation="MDTIWDISPPIAPATPVWPGDTPVGIERVWRIEAGSPVNVARVTL
FT                   SPHTGAHADAPLHYDADGTPIGAVPLDAYLGRCRVIHCIGARSAVTPEHVRAALAGAPP
FT                   RVLLRTYGQAPQHAWDSAFCAVAPETIDLLAAHGVRLVGIDTPSLDPQESKTMDAHRRI
FT                   RAHRMAILEGLVLDEIAAGDYELIALPLKFATLDASPVRAVLRALPAAPR"
FT   gene            101837..102340
FT                   /locus_tag="BMA10247_0102"
FT   CDS_pept        101837..102340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0102"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05175"
FT                   /protein_id="ABO05175.1"
FT                   /translation="MHAITLDATDCRILAVLQEEGRISNLDLAERISLSPSACLRRMRL
FT                   LEEQGVIERYRACLSREKLGFELEAFVQVSMRNDQTQWHERFAQAVREWPEVVGAFVVT
FT                   GETHYLLRVLAHNLKHYSDFVLNQLYKTPGVLDIRSNIVLQTLKDEAGPPVALARTGPA
FT                   IKAV"
FT   gene            complement(102327..102842)
FT                   /locus_tag="BMA10247_0101"
FT   CDS_pept        complement(102327..102842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0101"
FT                   /product="flavin reductase domain protein"
FT                   /note="identified by match to protein family HMM PF01613"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05360"
FT                   /protein_id="ABO05360.1"
FT                   /translation="MKHLQASPPNFDTAAFRQALGQFATGVTVVTTRAPSGQLIGITAS
FT                   SFNSVSLDPPLVLWSLAHKSASMPVFRTNSHYVVNVLSASQHDLCMRFATLKGNRFEGV
FT                   SHAQGDSGMPVLDGALAWFECHNRSRYDEGDHVIFVGEVERCGVHPDAAALAPLVFQSG
FT                   GFHGLTRL"
FT   gene            103217..103774
FT                   /gene="msrA"
FT                   /locus_tag="BMA10247_0103"
FT   CDS_pept        103217..103774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="BMA10247_0103"
FT                   /product="peptide-methionine (S)-S-oxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="identified by similarity to SP:Q8Y1C6; match to
FT                   protein family HMM PF01625; match to protein family HMM
FT                   TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05758"
FT                   /protein_id="ABO05758.2"
FT                   /translation="MSEATSEVATLGGGCFWCQEAVFLDVDGVTAVESGYAGGHTRNPG
FT                   YRDVCDGDTGHAEVVSVSFDPARIGYREILEIFFATHDPTQLNRQGNDVGTQYRSVIFT
FT                   HSDAQRDAALELIRTLERDKLYDDPIVTQVEPLNGNYWPAEAYHQNYYARNPGQGYCAV
FT                   VIGPKLAKFRQKFAHRLKSRGA"
FT   gene            complement(103820..104161)
FT                   /locus_tag="BMA10247_0104"
FT   CDS_pept        complement(103820..104161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0104"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06707"
FT                   /protein_id="ABO06707.1"
FT                   /translation="MRALARRGGITRAARDASPAPVRGRAAAADSAKSRRPLAPHAERD
FT                   DRPIRRVTRGGAAQQRRGSTAGRPRDAPTRRYAHRPARANRSRATRSRHAAQRDARRQR
FT                   PARRRHARP"
FT   gene            complement(104131..105699)
FT                   /locus_tag="BMA10247_0105"
FT   CDS_pept        complement(104131..105699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01904"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04779"
FT                   /protein_id="ABO04779.1"
FT                   /translation="MGDGSTRRKPAPPRQGDAQGDQFDLFGVEPLPLPERPSSTPSASP
FT                   ASSPSPATAADGKRQRAPRGRRRDASPDAAAAGDAPVSNDIARTSAPAATDAPGTNDPA
FT                   HGEDDEADARDSTRAKPATAALPTPDSGMAGTVGDANGAGDRADPADPADSADPGVPDD
FT                   PADPDDPPEPAATPALPGFDAPPAAAPKKRTRRRGVAPAAIADDVAAAARELPPHVRLG
FT                   TSSWYFPGWKDIVYGDDYAQSKLSREGLEAYAAHPLLKSVSLDRSFYAPLTVANYLRYA
FT                   QQVPDDFRFVVKAPALVTDAVLRGARGEPTGPNPAFLNAQLAADEFVRPCLEGLGNKAG
FT                   ALVFQFPPLPDTLLADPAALVDRLSTFLGALPALPAAPDGPRYAVEIRDASLLTPRFIR
FT                   ALAAAGVRYCVGLHAKMPDPLRQAAALALLDGEPSGPLIVRWSLHGGFKYEQAKAKYEP
FT                   FDRLVDEDPHTRTALAELAARYVLAGQPVLITVNNKAEGSAPLSCIALAKEIAAACVRW
FT                   RGEAA"
FT   gene            complement(105726..106946)
FT                   /gene="cfa"
FT                   /locus_tag="BMA10247_0106"
FT   CDS_pept        complement(105726..106946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cfa"
FT                   /locus_tag="BMA10247_0106"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="identified by match to protein family HMM PF02353;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04055"
FT                   /protein_id="ABO04055.1"
FT                   /translation="MFWEKKLAQWANEVREKADIPARLVLWNGQQLDFGTFAAPQVTLK
FT                   VNSASALPLLLEPSLDNLGEAYVKGKIDIEGKLADIINIGYSLARSTVTSASKLARVKR
FT                   YFNHSKHSDRKAIQYHYDVSNEFYQLWLDENMVYSCAYFENGDEDLGTAQIKKIDHILT
FT                   KIGVQPGQRLLDIGCGWGALVLRAAGKFGARCVGVTLSQNQFDLATERVKRAGLENQIE
FT                   IRLQDYREIDGQFDRITSVGMFEHVGRKNLPLYFSRIRELLADDGIAMNHGITSTDAES
FT                   GETALGGGEFIDRYVFPDGELPHISLALEAAQRGGLEAVDVESLRRHYARTLDIWTENF
FT                   EAKAEETRKLVDDEKFRIWRVYLAGCAYAFEHDDVSIFQIVCRKAGQSAKTLPWSRRYM
FT                   YEHALPR"
FT   gene            complement(107078..107722)
FT                   /gene="pdxH"
FT                   /locus_tag="BMA10247_0107"
FT   CDS_pept        complement(107078..107722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="BMA10247_0107"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="identified by match to protein family HMM PF01243;
FT                   match to protein family HMM TIGR00558"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04885"
FT                   /db_xref="GOA:A3MHF0"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHF0"
FT                   /protein_id="ABO04885.1"
FT                   /translation="MTTLADLRTNYSRASLDAADVNPNPFVQFDVWFKEALDAQLPEPN
FT                   TMTLATVDESGRPSARIVLIKGADERGFVFFTNYESRKGRELAHNPNAALLFYWIELER
FT                   QVRVEGRIEKTSEEESDRYFASRPLGSRIGAWASEQSAVIESRALLEAREKEIGARFGE
FT                   NPPRPPHWGGYRLVPSSIEFWQGRPSRLHDRLLYTRDAASASGWKITRLAP"
FT   gene            107856..108722
FT                   /locus_tag="BMA10247_0108"
FT   CDS_pept        107856..108722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0108"
FT                   /product="HesA/MoeB/ThiF family protein"
FT                   /note="identified by match to protein family HMM PF00899"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06059"
FT                   /protein_id="ABO06059.1"
FT                   /translation="MSRTDAIATPHDVTPQPSGELDADRARRFGGVARLYGADALAAFE
FT                   RARVAVIGIGGVGSWAAEALARSAVGELTLIDLDNVAESNTNRQIHALDGNYGKPKVDA
FT                   MAERIALIDPACRVVKIEDFVEPDNLDALLGGGFDYIVDAIDSVRTKVALIAWCVARAQ
FT                   PLVTVGGAGGQLDPTRIRIDDLAQTIQDPLLSKVRAQLRKQHGFPRGPKARFKVSAVYS
FT                   DEPLIYPEAAVCDVDDVAMHTATDAQAPGPTGLNCAGFGSSVCVTASFGFAAAAHALRA
FT                   LAARAGR"
FT   gene            complement(108995..109684)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0109"
FT                   /note="thioredoxin; this gene contains a premature stop
FT                   which may be the result of a sequencing error"
FT   gene            complement(109691..109843)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0110"
FT                   /note="thioredoxin; this gene contains a premature stop
FT                   which may be the result of a sequencing error"
FT   gene            complement(109897..110778)
FT                   /locus_tag="BMA10247_0111"
FT   CDS_pept        complement(109897..110778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02678;
FT                   match to protein family HMM PF05726"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05272"
FT                   /protein_id="ABO05272.1"
FT                   /translation="MTDSIKAILKPHVRDIGNLTVRRTLPALAARTVGPFIFFDHMGPA
FT                   AQPAGAGLDVRAHPHIGLATVTYLFDGAIMHRDSLGSAQKIVPGDVNWMTAGRGIVHSE
FT                   RTPDEERARGQTVHGIQTWVALPREHEAREPSFEHHAGATLPKLERDGVALTVIAGDAF
FT                   GARSPVTTFSRTLYVAAVFAAGGALALDADHDERAVYLVDGDLTIDGAPLEPAQMAVLA
FT                   PGARVALASAGSARAMLLGGDKLDGERFIEWNFVASSRDTIERAKRAWAAQQMGTVPGE
FT                   TEWIPFPEHRAH"
FT   gene            110963..111847
FT                   /locus_tag="BMA10247_0112"
FT   CDS_pept        110963..111847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0112"
FT                   /product="putative transporter"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06425"
FT                   /protein_id="ABO06425.1"
FT                   /translation="MAPKDLLLALVVILAWGVNFVVIKVGLHGVPPMLLGGLRFLLASV
FT                   PAVFFVRRPRIPWRLLVLYGSTILLGQFVFLFSAMYVGMPAGLASLVLQAQAFSTLFFA
FT                   RFALGERLRAQNLVGLAIAAVGLVAIAVQGGRGMTLAGFALTIGAAALWALGNVVTKKV
FT                   GKVDLVSLVVWASLVPPVPFFALSYGFEGPQRIGAALTSLSGASIFAIVYLAFVATLLG
FT                   YGLWSRLMSRYPAGQVAPFSLLVPVVGLASSALLLDERLTHAQLAGAALVMAGLAVNVF
FT                   GDRVVRRLFAAAS"
FT   gene            112064..112183
FT                   /locus_tag="BMA10247_0113"
FT   CDS_pept        112064..112183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0113"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07254"
FT                   /protein_id="ABO07254.1"
FT                   /translation="MAIDAPMIVGTTVTRRAWRGGASRRRPKWEPKRQAAATR"
FT   gene            complement(112365..113813)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0114"
FT                   /note="N-acetylmuramoyl-L-alanine amidase; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF01520"
FT   gene            complement(113895..114449)
FT                   /locus_tag="BMA10247_0115"
FT   CDS_pept        complement(113895..114449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0115"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /note="identified by match to protein family HMM PF02367;
FT                   match to protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05994"
FT                   /protein_id="ABO05994.1"
FT                   /translation="MPEQPSHAHAAPPLPAPLAERTLALADEAATIALGERLAHALDAM
FT                   RGARAAAHAFDGLQIQLYGDLGAGKTTLVRAMLRGLGHAGRVKSPTYTLVEPYALARSD
FT                   GELEVYHFDLYRFSDPAEWADAGFREYFNSGAICIVEWPQRAGALLGVPDLVFSLDVAG
FT                   EGRLLTARAYSASGKACLERC"
FT   gene            114467..115696
FT                   /locus_tag="BMA10247_0116"
FT   CDS_pept        114467..115696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0116"
FT                   /product="putative iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF08331;
FT                   match to protein family HMM TIGR00276"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05908"
FT                   /protein_id="ABO05908.1"
FT                   /translation="MDRNPELAIADARPSQDGRAAPSRLDDAQLAELASRIKAWGRELG
FT                   FGAIGISDTDLSEAEAGLAAWLEAGCHGEMDYMAKHGMKRARPAELVAGTRRVISARLA
FT                   YLPAGTLDGAPDAQGARRDWRAREAARIADPQAAVVSVYARGRDYHKVLRNRLQTLAER
FT                   IEAEIGVFGHRVFTDSAPVLEVELAQKAGVGWRGKHTLLLQRDAGSFFFLGEIYVDVPL
FT                   PADAQTSPDAAPETPGAHCGSCTRCLGACPTGAIVAPYRVDARRCISYLTIELHGSIPE
FT                   PLRPLIGNRVYGCDDCQLVCPWNKFAQAAPVADFDVRHGLDRASLVELFEWTAEQFDER
FT                   MQGSAIRRIGYERWLRNLAVGLGNALRAAPGGIEPDARAAIVAALRARLDDPCVSALVR
FT                   EHVEWALRAA"
FT   gene            115766..116233
FT                   /gene="ogt"
FT                   /locus_tag="BMA10247_0117"
FT   CDS_pept        115766..116233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="BMA10247_0117"
FT                   /product="methylated-DNA-protein-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by match to protein family HMM PF01035;
FT                   match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06511"
FT                   /protein_id="ABO06511.1"
FT                   /translation="MFNAVIDAPFGKVGIRTDASVVREIVYLPESIKRVAPGTPLAKQA
FT                   ARQIELYFERASARFDLPLAEVGTPFQHRVWHAICAIPPGVVLTYGQIAKQIGSAPRAV
FT                   GQACGANYFPLVIPCHRVVASGGLGGFANHDDEGYFLKVKRWLLAHEGVRY"
FT   gene            116233..117234
FT                   /gene="xerD"
FT                   /locus_tag="BMA10247_0118"
FT   CDS_pept        116233..117234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="BMA10247_0118"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899; match to protein
FT                   family HMM TIGR02225"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06979"
FT                   /protein_id="ABO06979.1"
FT                   /translation="MARAVHACAADTAGGDAGRAPAPPADRPVDALAASPAWLDSRASI
FT                   DLFCDAMWLEHGLSRNTLDAYRRDLQLFAQWLAARHAASVDHASEPTLTEYIAARSDGK
FT                   ATSSNRRLSVFRRYYGWAVREHRAAVDPTLRIASAKQAPRFPSTLSEAQVEALLAAPDV
FT                   DTPLGLRDRTMLELMYASGLRVSELVTLKTVEVGLNEGVVRVTGKGSKERLVPFGEVAH
FT                   GWIERYLRDARPALLGARAADALFVTARGDGMTRQQFWNIIKRHAQQADVRVHLSPHTL
FT                   RHAFATHLLNHGADLRVVQLLLGHSDISTTQIYTHVARERLKTLHAAHHPRG"
FT   gene            complement(117506..119071)
FT                   /locus_tag="BMA10247_0119"
FT   CDS_pept        complement(117506..119071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0119"
FT                   /product="AMP-binding enzyme domain protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04908"
FT                   /protein_id="ABO04908.1"
FT                   /translation="MTIEFSPGAAIDADALLDTLPQRIAALPARVAEHAPDHVALIEDG
FT                   RRLTYAQLARAVEAAAERLRGLGVRGGDRVMIVAENSIAQIVLLFAATRLDAWAIVSNA
FT                   RLSAAELDAIATHAQPRLIAFVTGTSPDARAHADRRNAHAAAPFELDIGAWSHTVEAGT
FT                   RAEPVEAHGARQCAALVYTTGTTGAPKGVMLSHRNLLFVAAVSSMQRRVAPTDVVYAVL
FT                   PISHVYGLASVCLGSLYAGATLRLAPRFSPETLRRALADEGVTIFQGVPAMHAKLLEHL
FT                   RAHGHAWRAPHLRFVYSGGSPLDADLKARVERAYGLPLHNGYGMTESSPTIAQTPIDAP
FT                   RADCSVGAPIPGVAVRFCSADGADVAPGEVGELWVRGPNVMLGYYRDPEGTRAAVTAHG
FT                   WLKTGDLARAGTDGAMTIVGRSKELIIRSGFNVYPSEVEQALNAHPDVVQSAVIGRAAE
FT                   AGNEDVIAFVELAPNAAATESDLKEWCVGRLAPYKRPVQIRALDALPAASTGKVLKHRL
FT                   RAML"
FT   gene            119201..119692
FT                   /locus_tag="BMA10247_0120"
FT   CDS_pept        119201..119692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0120"
FT                   /product="putative ebsC protein"
FT                   /note="identified by match to protein family HMM PF04073;
FT                   match to protein family HMM TIGR00011"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06317"
FT                   /protein_id="ABO06317.1"
FT                   /translation="MSKSKHVSETPATQFLRRHGVAFGEHVYEYVEHGGTSESARQLGV
FT                   DEHAVVKTLVMEDEHAKPLIILMHGDRTVSTKNLARQIGAKRVEPCKPEVANRHSGYLV
FT                   GGTSPFGTKKAMPVYVESTILDLPSIYLNGGRRGYLVSLAPAVLATLLQARPVQCASVD
FT                   "
FT   gene            119801..120412
FT                   /gene="plsY"
FT                   /locus_tag="BMA10247_0121"
FT   CDS_pept        119801..120412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsY"
FT                   /locus_tag="BMA10247_0121"
FT                   /product="acyl-phosphate glycerol 3-phosphate
FT                   acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF02660;
FT                   match to protein family HMM TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06832"
FT                   /protein_id="ABO06832.1"
FT                   /translation="MQILLATVAAYLIGSVSFAVVVSAAMGLADPRSYGSKNPGATNVL
FT                   RSGNKKAAILTLVGDAFKGWLAVWLVKRFGIGGEIGVALAAIAVFLGHLHPVFFRFQGG
FT                   KGVATAAGVLLAVHPVLGLATALTWLIVAFFFRYSSLAALVAAVFAPIFDVFLFGTHDN
FT                   PVAWAVLAMSVLLIWRHRSNISKLLAGEESRIGQKKKTGV"
FT   gene            complement(120642..121127)
FT                   /locus_tag="BMA10247_0122"
FT   CDS_pept        complement(120642..121127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04461"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04166"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHG5"
FT                   /protein_id="ABO04166.1"
FT                   /translation="MPSFDVVSEANMIEVKNAVEQSNKEISTRFDFKGSDARVEQKERE
FT                   LTLYADDDFKLGQVKDVLIGKMAKRNVDVRFLDYGKIEKIGGDKVKQVVTIKKGVSGDL
FT                   AKKVVRIVKDSKIKVQASIQGDAVRVSGAKRDDLQSTIALLRKEVTDTPLDFNNFRD"
FT   gene            121270..122313
FT                   /gene="murB"
FT                   /locus_tag="BMA10247_0123"
FT   CDS_pept        121270..122313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="BMA10247_0123"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02873; match to protein
FT                   family HMM TIGR00179"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06085"
FT                   /db_xref="GOA:A3MHG6"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHG6"
FT                   /protein_id="ABO06085.1"
FT                   /translation="MSRPDSAVSLLPDYSLRAHNTFGFDARARVAARIGSPGQFASLAR
FT                   DPRVAGLDRLVLGGGSNVVFTRDFDGLVLLDEIRGRALVREDDGAWYVEAGGGENWHAF
FT                   VEWTLAEGMPGLENLALIPGTVGAAPIQNIGAYGLEMKEHFASLRAVDLATGELVEFDA
FT                   ARCAFGYRDSFFKRDGRGRFAIVAVTFRLPKAWTPRIGYADVARELAARGIDARAARAR
FT                   DVFDAVVAIRRAKLPDPLALGNAGSFFKNPVIDAQAFAALRAREPDIVSYPQPDGRVKL
FT                   AAGWLIDRCGWKGRALGAAAVHERQALVLVNLGGASGADVLALAHAIRRDVLGRFGVEL
FT                   EMEPVCL"
FT   gene            complement(122506..123435)
FT                   /gene="argF"
FT                   /locus_tag="BMA10247_0124"
FT   CDS_pept        complement(122506..123435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="BMA10247_0124"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00658"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06856"
FT                   /protein_id="ABO06856.1"
FT                   /translation="MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHD
FT                   RTLAMIFEKSSTRTRLSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDII
FT                   MIRTFEQDIIQRFAENSRVPVINGLTNEYHPCQVLADIFTYYEHRGPIRGKTVAWVGDA
FT                   NNMLYTWIQAARILGFKLRLSTPPGYALDTKLVDAESAPFYQVFDDPNEACKGADLVTT
FT                   DVWTSMGFEAENEARKQAFADWCVDEEMMSHAHPDALFMHCLPAHRGEEVTAGVIDGPQ
FT                   SVVWDEAENRLHVQKALMEFLLLGRLNH"
FT   gene            123861..124184
FT                   /locus_tag="BMA10247_0125"
FT   CDS_pept        123861..124184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07201"
FT                   /protein_id="ABO07201.1"
FT                   /translation="MAETLPTEYFIQGITKDGKKFRPSDWSERLAGVMSCYGPGASGPN
FT                   ARLQYSRYVRPTLLGDLKCVIVDARLRDVEPMAFDFVMNFAKDNNLVVTEACELPDYGK
FT                   TQE"
FT   gene            complement(124413..124691)
FT                   /gene="rpsT"
FT                   /locus_tag="BMA10247_0126"
FT   CDS_pept        complement(124413..124691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="BMA10247_0126"
FT                   /product="30S ribosomal protein S20"
FT                   /note="identified by match to protein family HMM PF01649;
FT                   match to protein family HMM TIGR00029"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06713"
FT                   /db_xref="GOA:A3MHG9"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHG9"
FT                   /protein_id="ABO06713.1"
FT                   /translation="MANSAQARKRARQAAKANSHNSALRSKFRTAIKAVRKAIDAGDQA
FT                   KAAELFKAATKTIDTIADKKIVHKNKAARHKSRLSAAVKGLQAQAAQ"
FT   gene            124868..126646
FT                   /gene="mviN"
FT                   /locus_tag="BMA10247_0127"
FT   CDS_pept        124868..126646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="BMA10247_0127"
FT                   /product="integral membrane protein MviN"
FT                   /note="identified by match to protein family HMM PF03023;
FT                   match to protein family HMM TIGR01695"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05254"
FT                   /protein_id="ABO05254.1"
FT                   /translation="MRMTGSETGNYNNKIKRVASESRIGRMPAPARARGPAGSRQRLVS
FT                   GASRAGAPMPVRAFCSNVSVAAARGPYNKRPMNLFRALLTVSGFTLLSRVTGLARETLI
FT                   ARAFGASQFTDAFYVAFRIPNLLRRLSAEGAFSQAFVPILAEFKNQKGHDATKALVDAM
FT                   STVLAWALALLSLAGIAGASWVVFAVASGLRTDGQAFPLAVAMTRIMFPYIVFISLTTL
FT                   ASGVLNTYKRFSLPAFAPVLLNVAFIVAAVFVAPHLKVPVYALAWAVIAGGALQFAVQL
FT                   PGLKKIDMMPAIGVNPLRALAHPGVKRVLAKMVPATFAVSVAQLSLIINTNIASRLGQG
FT                   AVSWINYADRLMEFPTALLGVALGTILLPSLSKAHVDADSTEYSALLDWGLRVTFLLAA
FT                   PSALALFFFAEPLTATLFNYGKFDAHTVTMVARALATYGIGLVGIILIKILAPGFYAKQ
FT                   DIKTPVKIAIGVLVVTQLSNYVFVPIIGHAGLTLSIGVGACLNSLLLFIGLRRRGIYQP
FT                   SSGWLRFFAQLAGASLVLAGVMHWLAINFDWTAMRAAPLERIALMAACLVLFAALYFGM
FT                   LWLMGFKYAYFRRRAK"
FT   gene            126656..127498
FT                   /locus_tag="BMA10247_0128"
FT   CDS_pept        126656..127498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06426"
FT                   /protein_id="ABO06426.1"
FT                   /translation="MTRVLDYFSSLVAEDEGLPLTEAALSLAQDVYPDVDLQGVLAELD
FT                   ALAARLARRLPDGAGASGKLALLNDFFFRELGFACNYNDYYDPDNSYLNMVLKRRRGIP
FT                   ITLAVLYLELAEQVGVPARGVSFPGHFLLRIALPDGDSILDPTTGRSLSETELVEMLEP
FT                   YVAHAEGGTASVLRALLQPATEREVVARMLNNLKAVYLQTERWQRLLGVQERLVILLPG
FT                   QLDEVRDRGFAYARLDYLRPALEDLETYLGERPDAADATIVEAQVSELRQRMQRDDDD"
FT   gene            complement(127757..128515)
FT                   /locus_tag="BMA10247_0129"
FT   CDS_pept        complement(127757..128515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0129"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase type-2"
FT                   /EC_number="1.1.1.35"
FT                   /note="identified by similarity to SP:Q99714; match to
FT                   protein family HMM PF00106; match to protein family HMM
FT                   PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06950"
FT                   /protein_id="ABO06950.1"
FT                   /translation="MEIRDNVFLITGGASGLGAGTARLLTEAGGKVVLADLNQQAGEAL
FT                   ARELGGVFVKCDVAREEDAQAAVAAAAKLGTLRGLVNCAGIAPAAKTVGKDGPHPLELF
FT                   AKTITVNLIGTFNMIRVAAAAMAANEPAQTGERGVIVSTASVAAFDGQIGQAAYAASKA
FT                   GVAGMTLPIARDLSRNAIRVMTIAPGIFETPMLLGMPQDVQDALGAMVPFPPRLGKPAE
FT                   YAMLVKQIFENPMLNGEVIRLDGAIRMQPK"
FT   gene            complement(128727..130352)
FT                   /locus_tag="BMA10247_0130"
FT   CDS_pept        complement(128727..130352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0130"
FT                   /product="ISBma2, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04428"
FT                   /protein_id="ABO04428.1"
FT                   /translation="MKYAANALSHRAHTRFARRRSSARRAREKKPGWKPGQIADKPSPS
FT                   GGFLFFNGVMLKTPMPTQHELEMVTLEELVPKDHLLRQIDAAVDFEFIRAKVAHLYCAD
FT                   NGRPALDPVVMFKLLFIGYLFGVRSERQLMREVQVNVAYRWFARFRLTDKVPDASTFSQ
FT                   NRRRRFTDTTVYQEIFDEIVRQAIKRGLVDGRVLYTDSTHLKANANKGKFDVVKLEQTP
FT                   AAYTEALNAAVDADRAAHGRKPLDRDDDEPPSSKDTKLSRTDPDSGYMVRDDKPKGFFY
FT                   LDHRTVDAKHAIITDTHVTPASVHDSQPYLDRLDRQRERFEFKVEAVGLDAGYFTPAVC
FT                   QGLEERGIAGVMGYRTPNHKPGMFYKRQFKYDAYRNEYVCPQGQALPYSTTNRLGYREY
FT                   KSNAQICGRCPVRSQCTNSAIAVKVVTRHVWERAKERVDARRLTEWGQRIYARRKQTVE
FT                   RSFADAKQLHGHRYARMRGLRKVAEQCLLAAAAQNIKKIAMLLARKRKKGPAGPDWRFV
FT                   RMLLRLVSGLRCSFDYPLAANPQS"
FT   gene            complement(130349..131959)
FT                   /locus_tag="BMA10247_0131"
FT   CDS_pept        complement(130349..131959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0131"
FT                   /product="mulitcopper oxidase domain protein"
FT                   /note="identified by match to protein family HMM PF07731;
FT                   match to protein family HMM PF07732"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04797"
FT                   /protein_id="ABO04797.1"
FT                   /translation="MLRRHFLSSALAAAAASLFARGAFAAGQAMDGMQGMEGMDDMPDM
FT                   KPAPAHARHGKPAPTPASALAAADALPAGAPLAALRVLANESREPGVFRATLVAQPVAR
FT                   ALLPGAAPTTLWQFGAGTQGPAVGPLIDVREGDAVEIRFVNRLPQPSTIHWHGLPVPPD
FT                   QDGNPSDLVAPGATRVYRFTLPKGSAGTYWYHPHPHMATAEQVFRGLAGPIVVRAADDP
FT                   LAGWPERHLFVSDLKLARDGAIAPNDMMDWMNGRQGQFALVNGARRPRISLTGDERWRV
FT                   WNGCSARYLRITFDDGRPFAHVGTDGGLFDAPREVASLLLAPGERAELVVRAGDRASHA
FT                   VLTALEYDRGKMAMAMSEAAHGSLPPDPALPLADVAFEPAAPRALPARLRAVPALGEPV
FT                   ARKEVVFGEQMDMAAMMRAGAHGRPAGMRFMVNGVTFEPHRATLTSRRGEIESWTIRNE
FT                   TDMDHPFHLHGTQFQVVEREIDGETTPEPYRAWRDTVNVRKGERVRILTTQTERGERMF
FT                   HCHILEHEDLGMMGTLKVV"
FT   gene            131972..132154
FT                   /locus_tag="BMA10247_0133"
FT   CDS_pept        131972..132154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0133"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04758"
FT                   /protein_id="ABO04758.1"
FT                   /translation="MLSKRRFRQYTSRRARCTSRADNARTRGTKMKHPGGHAARRGVAR
FT                   HRLCRCAYSMFSIST"
FT   gene            complement(132127..133386)
FT                   /gene="icd"
FT                   /locus_tag="BMA10247_0132"
FT   CDS_pept        complement(132127..133386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icd"
FT                   /locus_tag="BMA10247_0132"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="identified by match to protein family HMM PF00180;
FT                   match to protein family HMM TIGR00183"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05966"
FT                   /protein_id="ABO05966.1"
FT                   /translation="MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITP
FT                   VMIKVVDAAVEKAYGGKKKIHWMEIYAGEKATKVYGPDVWLPEETLQVLKEYVVSIKGP
FT                   LTTPVGGGIRSLNVALRQELDLYVCLRPIQYFKGVPSPVREPEKTNMVIFRENSEDIYA
FT                   GIEWAAESEQAKKVIKFLQEEMGVKKIRFPQTSGIGIKPVSKEGTERLVRKAIQYAIDN
FT                   DRKSVTLVHKGNIMKFTEGAFRDAGYALAQKEFGAELIDGGPWMKFKNPKTGNEIVVKD
FT                   SIADAFLQQILLRPAEYDVIATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEAT
FT                   HGTAPKYAGKDYVNPGSEILSAEMMLRHLGWTEAADVIISAMEKSIKQKRVTYDFARLM
FT                   EGATQVSCSGFGQVLIENME"
FT   gene            133654..134232
FT                   /locus_tag="BMA10247_0134"
FT   CDS_pept        133654..134232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0134"
FT                   /product="RNA pseudouridine synthase family protein"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05388"
FT                   /protein_id="ABO05388.1"
FT                   /translation="MRLIALNKPFGTICQFSAHETRASLGDWVKTPGVYPAGRLDADSE
FT                   GLLLLTDDGALQAKIAEPRHKLVKRYWAQVEGAPDAAALAALERGVDLGDYVSRPCRAR
FT                   FITPPGALWPRNPPIRHRAAIPTAWIELEIAEGKNRQVRRMTAAVGFPTLRLVRVGIGA
FT                   LDVFALGLAPGETRELPPRAPWERAQRPG"
FT   gene            complement(134426..135259)
FT                   /locus_tag="BMA10247_0135"
FT   CDS_pept        complement(134426..135259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0135"
FT                   /product="A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04914"
FT                   /protein_id="ABO04914.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(135283..135546)
FT                   /locus_tag="BMA10247_0136"
FT   CDS_pept        complement(135283..135546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0136"
FT                   /product="transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04538"
FT                   /protein_id="ABO04538.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            complement(136410..136484)
FT                   /locus_tag="BMA10247_0137"
FT   tRNA            complement(136410..136484)
FT                   /locus_tag="BMA10247_0137"
FT                   /product="tRNA-Arg"
FT   gene            complement(136962..137795)
FT                   /locus_tag="BMA10247_0138"
FT   CDS_pept        complement(136962..137795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0138"
FT                   /product="A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07273"
FT                   /protein_id="ABO07273.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(137819..138082)
FT                   /locus_tag="BMA10247_0139"
FT   CDS_pept        complement(137819..138082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0139"
FT                   /product="transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06352"
FT                   /protein_id="ABO06352.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            138158..138355
FT                   /pseudo
FT                   /locus_tag="BMA10247_0140"
FT                   /note="exonuclease, DNA polymerase III, epsilon subunit
FT                   family/GIY-YIG catalytic domain protein, truncation;
FT                   comparison of this gene to its homologs suggests this gene
FT                   has been truncated"
FT   gene            138509..138667
FT                   /locus_tag="BMA10247_0142"
FT   CDS_pept        138509..138667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04264"
FT                   /protein_id="ABO04264.1"
FT                   /translation="MGGTRVCDRFTPALPSPLQSPRALPAFNAFLPSPRCGRKGRLARL
FT                   SSATSRR"
FT   gene            complement(138664..139233)
FT                   /locus_tag="BMA10247_0141"
FT   CDS_pept        complement(138664..139233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0141"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="identified by match to protein family HMM PF01817;
FT                   match to protein family HMM TIGR01806"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04918"
FT                   /protein_id="ABO04918.1"
FT                   /translation="MAAAVLGCIVLSAPRIAAADGDDTALTNLVALASQRLALAEPVAH
FT                   WKWLNGKPISDPPREAALLADVEQRATANGVDPAYARAFFDDQIAASKQVQNALFATWR
FT                   ATHGPEGPAPDLATSTRPQLDRLTQSLIAALARVAPLRDAPDCPSRLARSVSNWKTLTR
FT                   YDSGREDALGTALSHVCTAGSTSAVG"
FT   gene            complement(139518..139664)
FT                   /locus_tag="BMA10247_0143"
FT   CDS_pept        complement(139518..139664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06719"
FT                   /protein_id="ABO06719.1"
FT                   /translation="MDERPTRIPPPEKVMSPDPEPVAVEFLAELPEHVRAFFDEQHRLC
FT                   TPK"
FT   gene            139870..140259
FT                   /locus_tag="BMA10247_0144"
FT   CDS_pept        139870..140259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06786"
FT                   /protein_id="ABO06786.1"
FT                   /translation="MKRSTRWMSLVWLALVLNVLSPVVGYARAAANAADSPFALELCSA
FT                   AGAQRIVVDSGGEPRRGDASLAHVAHCVYCPGFAANLALGSSTPALPGFVRAFAYASRV
FT                   ERPAVFFRRGVRIAQPRAPPETVPV"
FT   gene            complement(140274..140414)
FT                   /locus_tag="BMA10247_0145"
FT   CDS_pept        complement(140274..140414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0145"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06013"
FT                   /protein_id="ABO06013.1"
FT                   /translation="MEHGKANPENVVGESPRTRACAAPSSRTRGHDAGRRAHDALMRGD
FT                   A"
FT   gene            140406..142742
FT                   /locus_tag="BMA10247_0146"
FT   CDS_pept        140406..142742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0146"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04430"
FT                   /protein_id="ABO04430.1"
FT                   /translation="MFHQLAAPGARRRLAAACAAALAWPAAHAASTAAAVPADSTPAAA
FT                   AEMTASGKTLDTVKVTAQRAAFAPDTPGVVEALTREQIDSHVNVTTEDALKYAPNLMVR
FT                   RRYIGDRNSVFAGRDFNELQSARGLVYADGILLSNLLGSSYSYPPRWSLIQPDDIARVD
FT                   VLYGPFSALYPGNAIGSTVQITTHKPQRLEASVSTQFFTQRYRDGYGFADSFGGNHQSA
FT                   RIADRVGRFWYALSLDRLENDSQPMQYASPNGAFDPRLGAPVPVTGAVSDIGPNGRPRT
FT                   IVGAQTIERTEQLNETLRFGYAFTDHVDATVTLGHWENHYRQHGDTFLRDAAGNPVYGG
FT                   NVSFGGRNYTVSPGAFAPQTGDQENWLYGLGLDARLASGWKLSAIASAYEVSRDVLRSA
FT                   SGAPPGAWDGGPGTVFHGDGTGWRTVDLRAESPDVRGHRFSFGYHFDTYFLRNATYNTA
FT                   DWQNAVPTTLVNRYRGNTRTQALYAQDAWRVAPDWLATLGLRYERWDAYGGELGGATAT
FT                   LGYAERGATAFSPKLSLEWQPASAWRLRLSFATGTRFPTVAELFQGTISNNAIVNNNPN
FT                   LQPEKAIDWDFTAERDVGFGVVRASVFQSDLRNSIYSQTTLAGASTYTNVSNVDRVRVR
FT                   GVELAFSGQDVALKGLDVDANVSATNAQTLADAANPNYVGARWPRIPRMRANLLASYRF
FT                   DEHWMTSVGVRYSGRQYNALDNSDVNPGVYGGTSSFMVVDLKARYRFDRHWLASFGIDN
FT                   VTDRRYYVFHPYPGRTFYGELKWSL"
FT   gene            142751..144001
FT                   /locus_tag="BMA10247_0147"
FT   CDS_pept        142751..144001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0147"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to GP:17431742; similarity
FT                   to RF:YP_368360.1"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05340"
FT                   /protein_id="ABO05340.1"
FT                   /translation="MAGVALAAFACGALAHDAQPAAGASSAHAAHMAMDAATAGAAQKT
FT                   PLATGAAFDARHRLWVAWVEGQHVVVAHSDDAGRTLAPPVTVNALPEPIYTSAENRPKL
FT                   AASPDGRAIYVTWSMPLDAPYTGMVRFSRSLDGGATWSVPVTVHRDRQAITHRFDMLTI
FT                   DPQGRIFVAWIDKRDLVAAQRAGRSYDGAAIYYAVSTDGGATFEPERKVSDHTCECCRI
FT                   AMTVDSDGRVQAAWRNVFPGQIRDHAVAVLHASADRAVEPVRATFSNWHVEACPDHGPA
FT                   LAITADGVRHLAWFGVVDGKADVFYSRLDARGAPLGAPFAFGDDPAAPDEQASHAALVA
FT                   RRDTLWLVWKAFDGDTMRIRLRRSDDGGAHWSAPRTLAWTSGASDNPQLLADRGRVYLS
FT                   WRTRNDGYRLIDVEGQR"
FT   gene            143998..144486
FT                   /locus_tag="BMA10247_0148"
FT   CDS_pept        143998..144486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06054"
FT                   /protein_id="ABO06054.1"
FT                   /translation="MKRVAFALAALAVLANAAPGAAQERRLPQPLRATDVASLYASGSG
FT                   APLVVEVWSLDCGYCRENAAHLVEWQRRHPQVRVALDSLDEHGQELAGALAQMKLPAAV
FT                   RQYANAEPMPERLRAALDPRWRGELPRTLWIGEDGTRRAKSGLLAPAVLDAWLQRREP"
FT   gene            complement(144773..145120)
FT                   /locus_tag="BMA10247_0149"
FT   CDS_pept        complement(144773..145120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04226"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06917"
FT                   /protein_id="ABO06917.1"
FT                   /translation="MCDAPGSACDPSRHRQRPTSVHSWELTKERTTMAHGLIMWLIIGA
FT                   IAGWLAGLLVKGGGFGLLVDIIVGIVGAVIGGWLAGILGIHIGGGFISSVIVAVIGAVI
FT                   LLFVIRLFKRA"
FT   gene            complement(145162..145395)
FT                   /locus_tag="BMA10247_0150"
FT   CDS_pept        complement(145162..145395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06662"
FT                   /protein_id="ABO06662.1"
FT                   /translation="MLAQMLGFRDAFGALVRCSSPSQPFASRTAGRALQHRMRAARHAA
FT                   NASFAHFAYAFISICTSKSVRQKIFGQSGWDA"
FT   gene            145724..145939
FT                   /locus_tag="BMA10247_0151"
FT   CDS_pept        145724..145939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0151"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07228"
FT                   /protein_id="ABO07228.1"
FT                   /translation="MGEYPVMRRSTVPICRRASSNAREHGVYRSPGGGVGRNVRGERIA
FT                   SGRSDHAICCGVFIGGHTKAGALDAL"
FT   gene            complement(145960..146106)
FT                   /locus_tag="BMA10247_0152"
FT   CDS_pept        complement(145960..146106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0152"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04686"
FT                   /protein_id="ABO04686.1"
FT                   /translation="MVVRGIGVDVAFALDDERRRRDAAAHECCEIETKGSDVRWLSRTV
FT                   AMT"
FT   gene            complement(146195..146671)
FT                   /locus_tag="BMA10247_0153"
FT   CDS_pept        complement(146195..146671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0153"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06232"
FT                   /protein_id="ABO06232.1"
FT                   /translation="MRARRAPNPSGPRTRRTIQQACAKPRRRTIRCARRVHTPWFVNHH
FT                   HDNPSRDDGFALVGSERHPALLVLPLMGVGYAVAEMIENGGVIIGGSAGIANDLAEGRL
FT                   APGFDDRDRIASTYEHRLVEHRLVWARPASHAPEIRPSIDSNLALGEQAPELER"
FT   gene            146885..147067
FT                   /locus_tag="BMA10247_0154"
FT   CDS_pept        146885..147067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0154"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06262"
FT                   /protein_id="ABO06262.1"
FT                   /translation="MPTAVGDSFGDRIRLRRLGAKSAWQGARRMRPWEFAARTWTDACR
FT                   RMLTANDAAADGVPR"
FT   gene            complement(147155..147232)
FT                   /locus_tag="BMA10247_0155"
FT   tRNA            complement(147155..147232)
FT                   /locus_tag="BMA10247_0155"
FT                   /product="tRNA-Thr"
FT   gene            complement(147296..148516)
FT                   /locus_tag="BMA10247_0156"
FT   CDS_pept        complement(147296..148516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0156"
FT                   /product="ISBma1, transposase"
FT                   /note="identified by match to protein family HMM PF01610"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07028"
FT                   /protein_id="ABO07028.1"
FT                   /translation="MLDRKALQALGCWTGYRLERVEWPQGDSRTLSLYLKPVSQIMYCE
FT                   QCGARCQQIHETTVRRVRDLPLFEYRVVLHVPRRRVWCERCGAARLEKLDWLGRYQRVT
FT                   QRFAKACEKLLQAASVQAVAAFYDLGWHTVKSIDKMRLRARVAEPDWSTIRYLAMDEFA
FT                   LHKGHRYATVVVDPIGRQVLWVGPGRSRETARAFFEQLPEGGAERIEAVAIDMTTAYEL
FT                   EIKEQCPQAEIVFDLYHVVAKYGREVIDRVRVDQANQLRHDKPARKVLKSSRWLLLRNR
FT                   HNLKPEQAVHLKELLAANQSLLCVYVLRDELKRLWFYRKPACAEKAWGQWFEQAQQSGI
FT                   AALQKFAQRLQGYWHGIVARCRHPLNTSVVEGINNTIKVIKRRAYGYRDEQYFFLKIRA
FT                   AFPGIPR"
FT   gene            complement(148864..149880)
FT                   /gene="fbp"
FT                   /locus_tag="BMA10247_0157"
FT   CDS_pept        complement(148864..149880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="BMA10247_0157"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="identified by match to protein family HMM PF00316"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04678"
FT                   /db_xref="GOA:A3MHJ7"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHJ7"
FT                   /protein_id="ABO04678.1"
FT                   /translation="MSITRRTTLSKYLIEQQRETHNLPADLRLLIEVVARACKAISYNV
FT                   SKGALGDALGTAGSENVQGEVQKKLDILSNEILLDANEWGGNLAAMASEEMETFFPIPA
FT                   NYPRGEYLLVFDPLDGSSNIDVNVSIGTIFSVLRCPDGQQATEQSFLQPGTEQVAAGYA
FT                   VYGPQTVFVLTTGNGVNCFTLDREVGSWVLTQSNLRIPEDTREYAINASNARHWYEPVK
FT                   RYIDELNAGAEGPRGENFNMRWIASMVADVHRILNRGGIFMYPADKRTPDRPGKLRLMY
FT                   EANPMSFIVEQAGGAATTGLKRILDVQPTGLHQRVPVILGSKNEVERVARYHEQAQS"
FT   gene            complement(150010..150942)
FT                   /gene="metR"
FT                   /locus_tag="BMA10247_0158"
FT   CDS_pept        complement(150010..150942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metR"
FT                   /locus_tag="BMA10247_0158"
FT                   /product="transcriptional activator MetR"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07162"
FT                   /protein_id="ABO07162.1"
FT                   /translation="MIRSPLEFRHLQTLVALRDTGNLSRAAQVLCLTQSALSHQLKALE
FT                   THFGLPLFVRKSAPLTFTAAGKRLLALAEQVVPAIEEAERDIARLALGTGGALRIAVEC
FT                   HTCFDWLMPAMDAFRQRWPEVELDIVSGFHADPIGLLHQDRADLAIVAEADADEAVDYH
FT                   PLFRFQIVGLVGNDHALAHQPSLTAADFADETLITYPVPDEMLDIVRQVLKPAGIEPKR
FT                   RTSELTIAILQLVASRRGVAALPLWAVATYLDKRYVSARPVLRADGSTLSGELYAATLP
FT                   AFSTRAYAADFVATMRETSAASLPEIELL"
FT   gene            151059..153353
FT                   /gene="metE"
FT                   /locus_tag="BMA10247_0159"
FT   CDS_pept        151059..153353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="BMA10247_0159"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="identified by match to protein family HMM PF01717;
FT                   match to protein family HMM PF08267; match to protein
FT                   family HMM TIGR01371"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05790"
FT                   /db_xref="GOA:A3MHJ9"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHJ9"
FT                   /protein_id="ABO05790.1"
FT                   /translation="MTTAHILGFPRIGAQRELKFALERYWRDGASADAERALVDTGRAL
FT                   RAEHWRIERDAGLDCVTVGDFAWYDHVLTTLAHVGGLPRRFGFDARALTLADYFAAARG
FT                   NAAQPAMEMTKWFDTNYHYLVPEYSPATTFGPGVEWLFDEVREARALGYRAKAALVGPL
FT                   TLLWLGKARDGLVERLALLPRLVPAYRALLARLREAGVDWVQIDEPIFSLDLPDAWRDA
FT                   ARPTYEALAPGAPKLLVATYFDDASEHAALLKALPVAGLHVDLVRADAQLDAFVADYPA
FT                   DKVLSCGIVDGRNVWRNDLDRSLARLAPVRDALGERLWVATSCSLLHVPVDLAHEPRLD
FT                   EELKTWLAFAAQKTREVAALRDALVKGRAAVAAEFDDAAVVAAARRTSARIHNPLVKRR
FT                   VAALTDADARRASAYSVRAAAQRARFGLPLLPTTTIGSFPQTPEIRRARAAFKQGVLDH
FT                   LGYLEAMREQVRIAIDKQLAYGLDVLVHGEAERNDMVEYFGELLWGFAITSNGWVQSYG
FT                   SRCVKPPLVYGDVYLPEPMTVGWASYAQSLSAKPVKGMLTGPVTMLQWSFVRDDQPRAT
FT                   TALQIALALRQETLDLEKAGIGMIQIDEPALREGLPLKARERAAYLDWAVRAFGIAASG
FT                   VADDTQIHTHMCYSEFGDILPSIAALDADVISIETTRSNMELLDAFETFDYPNEIGPGV
FT                   YDIHSPRVPDADEIERLILLALERIPAQRLWVNPDCGLKTREWRQVDAALAAMVDAAKR
FT                   VRQKVEEAAPA"
FT   gene            153454..153594
FT                   /locus_tag="BMA10247_0160"
FT   CDS_pept        153454..153594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05455"
FT                   /protein_id="ABO05455.1"
FT                   /translation="MRQAPVPIDACAVHERSAIRPVRERDRRSAVGRSGARRADEKAGI
FT                   A"
FT   gene            complement(153710..156412)
FT                   /gene="pepN"
FT                   /locus_tag="BMA10247_0161"
FT   CDS_pept        complement(153710..156412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="BMA10247_0161"
FT                   /product="aminopeptidase N"
FT                   /EC_number="3.4.11.2"
FT                   /note="identified by match to protein family HMM PF01433;
FT                   match to protein family HMM TIGR02414"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04033"
FT                   /protein_id="ABO04033.1"
FT                   /translation="MSDIAAPNAEIRRSDYTPPAFLIDTVSLEFDLEPARTIVTNTMRV
FT                   RRNPDAAPAPHFELMGEALVLIGARVDGKPHDAVRVHEHGLSVENVPDAFELTIENACA
FT                   PESNTTLSGLYVSSGNFFTQCEAEGFRRITYFVDRPDVMASYTVTLRADQAAYPVLLSN
FT                   GNLVDAGDLPNGRHFAKWEDPFKKPSYLFALVAGKLVKLEETIKSASGKDKLLQVWVEP
FT                   QDLGKTRHAMDSLIHSIRWDERRFGLELDLDRFMIVAVGDFNMGAMENKGLNIFNTKYV
FT                   LANPETATDVDFANVESVVGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSADMS
FT                   AGAEDDAAARAVKRIEDVRVLRQLQFAEDAGPMAHPVRPERYVEINNFYTMTVYEKGAE
FT                   VVRMYQTLFGRDGFRKGMDLYFRRHDGQAVTCDDFRHAMADANGRDLALFERWYSQAGT
FT                   PRVTVRTAYDAAAKRYAVTLRQGYGDAAPAARDTQKGPLLIPFAIGLIGADGRDLPLRL
FT                   EGEAAASGTTRVLELTKAEATFTFVDIDAAPLPSLLRNFSAPVIVEYDYRDDELAFLLA
FT                   HDSDPFNRWEAGQRLATRALLTLASRAAAQQPLTLDDAFAAAFKRVLTDDTLSPAFREL
FT                   ALTLPSEAYLADQMTQADPAAVHRARQFVRRQLATALRAEWLSVYERHQTPGAYAPTPG
FT                   DAGRRALKNLALAYLAELDEPADAIRLATAQYDAANNMTDRACALVALLSAAAASADAA
FT                   RAADRALDDFYRRFENEALVIDKWFSMQATRRGTPEHPTLDIVRKLLAHPAFNLKNPNR
FT                   ARSLIFGFCSANPAQFHAADGSGYAFWADQVLALDALNPQVAARLARALELWRRFTPSL
FT                   REKMRDALERVAANAQSRDVREIVEKALA"
FT   gene            156437..156574
FT                   /locus_tag="BMA10247_0162"
FT   CDS_pept        156437..156574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06744"
FT                   /protein_id="ABO06744.1"
FT                   /translation="MNTRRCGGAAAKGHCTKPLRKARATNFSAAPTVFSISARRLRDGV
FT                   "
FT   gene            156633..157346
FT                   /locus_tag="BMA10247_0163"
FT   CDS_pept        156633..157346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0163"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05347"
FT                   /protein_id="ABO05347.1"
FT                   /translation="MKRIPFIRGAALVAGALIVLLSGCTSYVTTQVTAFSNWSGNDATR
FT                   TYAFARTAEQQNSLEQSTYEQIVGNELSTYSFRRVPTKDARYLVRLAYGIKSDWVSVPQ
FT                   PVYYDPWFGPGPYWRGGPWGPFGPWGPFPAGYVNQSYQIFQRSLEIRIAERATGTEVYN
FT                   VAARNAGEGSSLLQAMPYLARSALADFPLGNGTVRTVRLPVDKNGAPAPMPANERAVPE
FT                   VPAMPASGAAAAPAR"
FT   gene            complement(157680..158252)
FT                   /locus_tag="BMA10247_0164"
FT   CDS_pept        complement(157680..158252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0164"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01169"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04396"
FT                   /protein_id="ABO04396.1"
FT                   /translation="MTEAFLISTGAVALAEIGDKTQLLSLVLAARYRKPLPIIAGVLAA
FT                   TLINHGFAGALGEWLGIYLTPAVMRWALALSFIGMGLWILVPDKLDADEANANRSRLGV
FT                   FGATFVAFFLAEMGDKTQIATVALAARFQDYVGVVAGTTLGMMLANVPAILLGDRFAHR
FT                   LPTKLVHGIAAVLFIVLGALAFLHGGA"
FT   gene            complement(158249..158659)
FT                   /locus_tag="BMA10247_0165"
FT   CDS_pept        complement(158249..158659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07287"
FT                   /protein_id="ABO07287.1"
FT                   /translation="MAASAASRARLRARPPPQPSPSPRFRRRARHRRPAHAARRRAARR
FT                   STRRRLATIVPFVPKRHARIRSSLGSSRSARADAARRARDGGVRQQTWPSRPWRTQPAG
FT                   PGETDGSPHAAEGPGARRIVARVQPGPGISVP"
FT   misc_feature    complement(158324..158465)
FT                   /locus_tag="BMA10247_0165"
FT                   /note="yybP-ykoY leader"
FT   gene            complement(158740..160050)
FT                   /gene="guaD"
FT                   /locus_tag="BMA10247_0166"
FT   CDS_pept        complement(158740..160050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaD"
FT                   /locus_tag="BMA10247_0166"
FT                   /product="guanine deaminase"
FT                   /EC_number="3.5.4.3"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM TIGR02967; match to protein
FT                   family HMM TIGR03179"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06493"
FT                   /protein_id="ABO06493.1"
FT                   /translation="MTQTAFRARLLRFDGDPAQSDDALAYDEDGLLIVENGRVVAAGAH
FT                   AALAARLAPGATLVEMRDKLIAPGFIDTHVHYPQTEMIASPAPGLLPWLDRYTFPTERR
FT                   FADPAHARDVAEFFLDTLLACGTTTALVYCTVHKQSADALFGASEARGLRMIAGKVLMD
FT                   RHCPEFLRDTAQSGYDDSAELIARWHGHGRQSYALTPRFAPTSTHAQLEACGALARLHP
FT                   DVFIQSHVAENLDELRWAAELFPERRSYLDVYDHYGLLRRRAVYGHCIHLDDDDRRRFA
FT                   ETGAIAAHCPTSNLFLGSGLFDFERANARHMAVTLATDVGGGTSFSMLQTMNEAHKIAR
FT                   MTGHHLSATRMFWLATAGAAHALDLADTIGTLAPHAEADFVVLDPAATPLLARRTARAE
FT                   SLEELLFALALLGDDRAVYRTYAAGRCVHRRDIADAG"
FT   gene            complement(160076..161452)
FT                   /locus_tag="BMA10247_0167"
FT   CDS_pept        complement(160076..161452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0167"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04838"
FT                   /protein_id="ABO04838.1"
FT                   /translation="MDLYQGTAAPAKRSALERHFGIRESGSRLRTEIVAGVTTFLTAMY
FT                   IIVVNPGILSQAGVPFAAALTATVIVSFLGSCAMGLYARNPVLVAPGMGMNALFTFVMV
FT                   HGGKMPWQTALGCVFWAGVLFATLAAFNARKLVVDAIPANLRHAVSCGIGLFISLIGLV
FT                   NAKFIVGDPVTIVHATSLNPVIVTFLAGLAVTTVLVVRRVTGALMLGIVATTLLAIPIG
FT                   RVWGDGSAYWPAAIATKTLVNWNGLVAAPDFSALGQLDLLGSLKVAYWPFIFVMLFTAF
FT                   FDALSTFMAISEAGNLRDRDGNPRNIRQSMIVDAFSAVVSAPLGTSPANAYIESAAGIS
FT                   AGGRTGLVAVVAGLCFVPFLFLSPLLSLVPAIATAPALVLVGVFMMESITKIEWHRFDE
FT                   AIPAFLAMILIPLTYSITEGIAYGFLAFVVLKLFTGRRGDVKPAMWVVAALSLLLVAQL
FT                   "
FT   gene            complement(161550..162575)
FT                   /gene="add"
FT                   /locus_tag="BMA10247_0168"
FT   CDS_pept        complement(161550..162575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="BMA10247_0168"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="identified by match to protein family HMM PF00962;
FT                   match to protein family HMM TIGR01430"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05288"
FT                   /protein_id="ABO05288.1"
FT                   /translation="MTPTFKDKIARAPKAELHIHIEGSLEPELIFELAQRNGVKLAYEW
FT                   IDALRAAYAFTDLQSFLDIYYAGASVLLTEQDFYDMTAAYVERALADHVVHAEIFFDPQ
FT                   THTERGVPIETVVAGIDRALADAEKRGFSSKLILCFLRHLSEESALATFDAALPLFDRY
FT                   ARRLIGVGLDSSERGNPPSKFARVFAKAREQGLKLVAHAGEEGPPEYVTQALDVLKIDR
FT                   VDHGVRSAEDAALVARLAGEKIALTVCPLSNLKLCVFDDLTKHTLKTLLDRGVAVTINS
FT                   DDPAYFGGYVNENYFATVDALQLGEADVYTVIRNGFEASFVSADERAALIAKLDAHWHA
FT                   A"
FT   gene            complement(162617..163762)
FT                   /gene="xdhC"
FT                   /locus_tag="BMA10247_0169"
FT   CDS_pept        complement(162617..163762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhC"
FT                   /locus_tag="BMA10247_0169"
FT                   /product="xanthine dehydrogenase accessory protein XdhC"
FT                   /note="identified by match to protein family HMM PF02625;
FT                   match to protein family HMM TIGR02964"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04342"
FT                   /protein_id="ABO04342.1"
FT                   /translation="MRRLVSRPSLRCRRPRVAREPRGGRRPPGRHGLIRDQEKRRMQTW
FT                   LTDLQHLLARGDAAVLVTVARVDGSAPRDAGTKMLVTRDAARHTIGGGHLEWKAIDIAR
FT                   QLLKEGAHTPHARRLERLALGPSLGQCCGGAVVLAFERLDIAELGWVTSLAKRVAAGAP
FT                   TVRSVSFGPDADTVMLSEPEPGATRPDCLLWDMGGAPLLTETIAPHAFPVVLFGAGHVG
FT                   AALVRVLGTLPCHVRWVDERDAQFPPPDALAGIRNLSLDANDAPDEAIDEAGPGAYFVV
FT                   MTHNHARDLELAHRILARGDYAYFGMIGSRTKRMQFEHRLAARGIDPLQIARMQCPIGV
FT                   PGIVDKAPEAIAIAVAAQILQTVDARRANGRPAASPGASAC"
FT   gene            complement(163855..163989)
FT                   /locus_tag="BMA10247_0170"
FT   CDS_pept        complement(163855..163989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0170"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06819"
FT                   /protein_id="ABO06819.1"
FT                   /translation="MHHDRRRIARIIARPYRRFFAVLSSFPDGDLRARGGSRPCVTRA"
FT   gene            complement(164148..164657)
FT                   /pseudo
FT                   /gene="dsbB"
FT                   /locus_tag="BMA10247_0171"
FT                   /note="disulfide bond formation protein DsbB; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF02600"
FT   gene            complement(164766..166616)
FT                   /locus_tag="BMA10247_0172"
FT   CDS_pept        complement(164766..166616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0172"
FT                   /product="amidase family protein"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05545"
FT                   /protein_id="ABO05545.1"
FT                   /translation="MGHRDATPRTIRYAKRGARRATAALSGGATARAARTASTPRHLDA
FT                   EPARDSVSMREAREWPRAKRQPHAISHANRGQTRSRRDRPPPAPLRCPPRRPLARPCAV
FT                   GAASHAKRPRAPPRLRGATLFYNARTGRRAPSRGFAKRRIVPIRFVNPIEPDTVMTTFA
FT                   PFPPLARLAADLAAGVTTSRALVEAALERIADPAGQGALAFTEVDAPRARAAADAHDRL
FT                   RAAGTVLSPLAGIPVSVKDLFDVAGQVTRAGSRVLADAPPAADDAVAVARLKRAGAVLV
FT                   GRTNMSEFAFSGLGLNPHYGTPRSPYRRDVPGDERIAGGSSSGAAASVADGMAAVALAT
FT                   DTGGSIRIPAALCGLTGFKPTASRIPKQGGVPLSTTLDSFGPIGVSVACCALVDRILAG
FT                   LEPHVCAARPLEGVRLGVLTNYVTDGMDAHVATSLDAALKHLEAAGAIVSDARFAPLDT
FT                   LPGINRIGFASIEAHAWHRPLVARHRDAYDPRVLARILKGEPASAADYLDLVAARAALI
FT                   DEAARTVWQRFDALVAPTVPIAPPRIAELERDDDAFARTNALVLRNPSAFNFLDACALS
FT                   LPCHPRDTAPVGLMLAAAPHHDDALLAIGQAVEAVLATIR"
FT   gene            166745..168079
FT                   /locus_tag="BMA10247_0173"
FT   CDS_pept        166745..168079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0173"
FT                   /product="peptidase C26"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF07722"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06779"
FT                   /protein_id="ABO06779.1"
FT                   /translation="MSENTSARADQSGSSSAATPPERTGQAPSSSSVTDKPPAGATVHV
FT                   GAFAAQIAAAQDIGDPGSAPSGAIAEPGAPGIAAGGPGVEPAAVSAGPGAHAAAPSGAT
FT                   GAGAGASAAGAAAAGASAKAGSPPPGFGAPPDFEASRPPPPGAATPAPPAYLKQSDTPW
FT                   SVFGRIIAARARRLFDRAGQRITQRTLRIGVSARIFHPEVGAPGLRGKTLQYLEESIAH
FT                   WVMSRDVLVFMIPTVGHQGMLHPSNIRLRDYAKHLDGLLLQGGADVSPQTYAASDARPE
FT                   WPGDRVRDMYELELLHEFVESGKPVLGVCRGCQLINVAFGGSLYQDIASDVPTAGAHVS
FT                   EHYDQHRHSIRFPDGSTLANMFPGRREAIVNSIHHQAIRDIGRDLNIEAVSAEDGIIEG
FT                   IRYRRAPFVVGVQWHPEFHRAGGPELLDCTPLLDTFLRAARETRL"
FT   gene            168133..168270
FT                   /locus_tag="BMA10247_0174"
FT   CDS_pept        168133..168270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0174"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06021"
FT                   /protein_id="ABO06021.1"
FT                   /translation="MRPVARSACTASARRARHLAISRRRAVRAARRKRAGEKEWAKKGA
FT                   "
FT   gene            168568..169863
FT                   /gene="citA"
FT                   /locus_tag="BMA10247_0175"
FT   CDS_pept        168568..169863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="BMA10247_0175"
FT                   /product="citrate-proton symporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05349"
FT                   /protein_id="ABO05349.1"
FT                   /translation="MSTASPAIQQESKARTVFRVVSGNFLEMYDFMVYGYYASAIAKTY
FT                   FPSGNAFASLMLSLSVFGAGFLMRPVGAIVLGAYIDHHGRRKGLILTLALMALGTLTVA
FT                   TIPGYATIGVLAPILVLLGRLLQGFSAGVELGGVSVYLSEIATKGNKGFYTSWQSGSQQ
FT                   VAVVFAAFVGVLLNRALPVEQMTSWGWRIPFLIGCLIVPFLFLIRRSLKETDEFLAKRR
FT                   RPSMGEIMKSMLENWGVVLAGMGMVIMTTVSFYMITAYTPTFGKEVLHLSAIDALVVTV
FT                   CVGLSNLVWLPLSGALSDRIGRRPVLIAFTALTILTAYPAMQWLVGSPSFLRLLGVELW
FT                   LSFLYGSYNGAMVVALTEVMPADVRTAGFSLAYSLATTIGGFTPAISTLLIHETGNKAA
FT                   PGLWLGLAAICGLIATLVLYRSPEARNQYRTT"
FT   gene            complement(170027..170239)
FT                   /locus_tag="BMA10247_0176"
FT   CDS_pept        complement(170027..170239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0176"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04453"
FT                   /protein_id="ABO04453.1"
FT                   /translation="MGACSVCADRLRAIDAPGARRATVGKPSDPHCARARRLLAVEPFR
FT                   PPAIERLSSQARIRTPHPAHKPQHH"
FT   gene            complement(170252..172096)
FT                   /locus_tag="BMA10247_0177"
FT   CDS_pept        complement(170252..172096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0177"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719; match to protein
FT                   family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07350"
FT                   /protein_id="ABO07350.1"
FT                   /translation="MESAFDRAFAAHRAGRLDDAEHGYRAVLAANPADADALHLFGVLR
FT                   HQQGRHEEAADLVGRAVGLRPNDAALQLNLGNALKALGRLDDAIERFRNALTLAPAFPL
FT                   AHYNLGNAYAAQERHDDAVDAFKRALALTPGDASIHNNLGNALNALGRHDDALEAFRRA
FT                   LELRPGHAGAHNNLGMALAALGDTDAAIAHFRAAIAAEPHFVAAHFNLGNALDAISQHA
FT                   QAQHAFEAALALQPRFALALFGLANTLAARGRHRDALPHYERAVGLDPSFVLAWLNLGT
FT                   AHHALGAHEMALRAFDQALRLDPSLTLAQMHRAVTLLTLRDFARGLPAYEARHALPGAA
FT                   PLGPLPRWQGEPIANRTLLVRAEQGFGDTLQFVRLVPLARARCARLILQVQPALLPLIA
FT                   PMAARWRVSVVSADAARTPAADLVCPLLSLPFALGLEYDAIPSRTPYLDVPDAARRRFR
FT                   GSLGGQAKRKFGIAWSGSAPVQDNRALPLDALAPLFALAGIDWIVLQPTLSDSERAALD
FT                   AHPDAARIHRLDGLTDFAATAALVDRLDGVVAIDTAVAHLAGALGKPLWLMLPVAADWR
FT                   WSTGDDSAWYPRARLVRQSEPGRWDDVVATVAGEIAHG"
FT   gene            172280..173896
FT                   /locus_tag="BMA10247_0178"
FT   CDS_pept        172280..173896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0178"
FT                   /product="putative pentachlorophenol 4-monooxygenase"
FT                   /note="identified by match to protein family HMM PF01494"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05275"
FT                   /protein_id="ABO05275.1"
FT                   /translation="MLIVGAGPTGLAAALCLARARVPVRIVDKAARPARYSRAIGIQAR
FT                   TLELLEQQRVVDRFVELGHRARLAILYSAGQRIAELDFDPLQTRYPYLLFLDQTVTERL
FT                   LTEHLATFDVHVERGVTLTHCAQPEGALDVRLRHGDGRDERLQPSYVVAADGARSTVRH
FT                   LLDVDFVGHAFEQTFMLADLELGADWSDDEIHLFTTGEGLAGLFPMGGGRYRLVADRPP
FT                   RNGALDDERGPSLELCREVVRARVTPDLKVGDLAWSSYFHLHSRMVARLRVGRVFFAGD
FT                   AAHVHSPAGAQGMNTGIQEAFNLGWKLARVLAGNAPERLLETYHAERHPIERDVLRQTS
FT                   FATQVVEADRGPLKLLRDHIVPILASFGPLRDAARRTVSELAIQYRKSPLTLERVLDGG
FT                   PRAGERAPDALVHVLDGPLGKAPGVARLFDLHDPAHFTLLVLEPREAIDDTLPSDPGED
FT                   GRALAGALERIMPGAVRCWCATDAEGEGAPLLADAYGRARPVFYLLRPDGYVAARGRPA
FT                   TDANALLRHCETWFSGMRLET"
FT   gene            173857..174087
FT                   /locus_tag="BMA10247_0179"
FT   CDS_pept        173857..174087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0179"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05355"
FT                   /protein_id="ABO05355.1"
FT                   /translation="MRDVVFGDAAGDLKAAALAGRGRLRVGRRHRGLRAASPRRMHRQA
FT                   MPRCVVGAGMRGAGGANGMRVDRCNATSIRM"
FT   gene            complement(174533..177487)
FT                   /locus_tag="BMA10247_0180"
FT   CDS_pept        complement(174533..177487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0180"
FT                   /product="putative sulfite reductase [NADPH] flavoprotein,
FT                   alpha-component"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00111; match to protein
FT                   family HMM PF00384; match to protein family HMM PF01568;
FT                   match to protein family HMM PF04879; match to protein
FT                   family HMM TIGR01591"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04392"
FT                   /protein_id="ABO04392.1"
FT                   /translation="MTSSAFDSSRQGCGSGQCACRRAAQMRRADPFDDTDYGTPTRHAD
FT                   TDVTLDIDGRAVTVPAGTSVMRAAIEAGINVPKLCATDSLEPFGSCRLCLVEIEGRRGY
FT                   PASCTTPVEAGMKVRTQSDRLQALRRNVMELYISDHPLDCLTCAANGDCELQDMAGAVG
FT                   LREVRYGFDGKNHLSDAKDESNPYFSYDPSKCIVCNRCVRACEETQGTFALTIASRGFE
FT                   SRVAASAGEAFMDSECVSCGACVAACPTATLIEKSVARLGQPEHEIVTTCAYCGVGCAL
FT                   KAEMKGEQVVRMTPHKNGLANEGHACVKGRFAWGYATHKDRITKPMIREKITDAWREVS
FT                   WDEAIGYAAARFRRIQDEHGRDSIGGITSSRCTNEETYLVQKLVRAAFGNNNVDTCARV
FT                   CHSPTGYGLKTTLGESAGTQTFASVGSADVIVVIGANPTDGHPVFGSRLKRRVREGAQL
FT                   IVVDPRRIDLVDGPHVKAVHHLQLRPGTNVALVNALAHVIVTEGLVDEAFVDERCEPQA
FT                   FDVWRAFAARPENSPEATADITGVPADAVRAAARLYATGGRAAIFYGLGVTEHAQGSTM
FT                   VMGIANLAMATGNLGIEGAGVNPLRGQNNVQGSCDMGSFPHELPGYRHIGDAAVRARFD
FT                   EAWSTTLQPEPGLRIPNMFDAALDGSFKGLYCQGEDIVQSDPNTQHVAAALASLDCLVV
FT                   QDIFLNETAKYAHVFLPGATFLEKDGTFTNAERRISRVRRAMRPLSGYADWEVTLMLSR
FT                   ALGYDMHYAHPSEIMDEIARLTPTFAGVSYALLDELGSVQWPCNDAAPQGTPTMHVDQF
FT                   VRGKGKFVITQYIASPEKVTPRYPLILTTGRILSQYNVGAQTRRTENVRWHGEDRLEIH
FT                   PHDANDRGIRTGDWVGVASRAGQTVLRALVTERMQPGVVYTTFHFPESGANVITTDSSD
FT                   WATNCPEYKVTAVQVAPVAQPSEWQRAYTRFRAEQLALLEQRTAERAPAIATGK"
FT   gene            complement(177502..179067)
FT                   /gene="fdsB"
FT                   /locus_tag="BMA10247_0181"
FT   CDS_pept        complement(177502..179067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdsB"
FT                   /locus_tag="BMA10247_0181"
FT                   /product="formate dehydrogenase, NAD-dependent, beta
FT                   subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="identified by similarity to GB:CAA11234.1; match to
FT                   protein family HMM PF01512"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06069"
FT                   /protein_id="ABO06069.1"
FT                   /translation="MSTRIHVPRDSAALAVGADALARAIEAQAAARGIAIELVRNGSRG
FT                   LLWLEPLVEVSTPAGRIGYANLTAADVPALFDAGWLDGAAHPACVGIVDEIPYLKRQQR
FT                   LTFARIGITDPLSIDDYVAHGGLEGLRNALALDGAAACETLVESGLRGRGGAAFPAGVK
FT                   WRTVREAAAAQKYVVCNADEGDSGTFSDRLVMESDPYCLIEGMIIAGIATGATVGHIYV
FT                   RSEYPHAIAALGEAIARARAAGWLGASVLGTAHAFELHVAKGAGAYVCGEETALLESLE
FT                   GKRGVVRAKPPLPALSGLFAKPTVINNVITLATVPIIFARGAAFYRDYGMGRSRGTLPF
FT                   QLAGNVKRGGLVELAFGVTLRELLFDFGGGTASGRPARAAQVGGPLGTYLPEGQWDIPL
FT                   DYEAYAAVGAVVGHGGIVLHDDTSNLAELAEYAMHFCALESCGKCTPCRIGSTRGVETI
FT                   ARIRAGDTSERQVRLLRDLCDTMTAGSLCAMGGMTPYPVLSALDHFPEDFGLAAHASHA
FT                   APAA"
FT   gene            complement(179064..179537)
FT                   /gene="fdsG"
FT                   /locus_tag="BMA10247_0182"
FT   CDS_pept        complement(179064..179537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdsG"
FT                   /locus_tag="BMA10247_0182"
FT                   /product="formate dehydrogenase, NAD-dependent, gamma
FT                   subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="identified by similarity to GB:CAA11233.1"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05066"
FT                   /protein_id="ABO05066.1"
FT                   /translation="MSPHSVAPDALVRAHAQPGRSLVAILHAIQDDAGYVPPACVEPLA
FT                   KALNLSRAEVHGVLTYYHHFRTAPPAHVTIRLCRAEACRSMGGEALVAHAQARAGCRID
FT                   GGHGDRVALESVYCLGLCAQSPSLTINDEPHAKMSPARFDALFDAAVRTKEPA"
FT   gene            complement(179569..179694)
FT                   /locus_tag="BMA10247_0183"
FT   CDS_pept        complement(179569..179694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0183"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07105"
FT                   /protein_id="ABO07105.1"
FT                   /translation="MRVAFDSNHLCNSVSYCDHHSIDLSLTHINISRSVCALYES"
FT   gene            179695..180774
FT                   /locus_tag="BMA10247_0184"
FT   CDS_pept        179695..180774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0184"
FT                   /product="molybdate transport repressor domain protein"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05894"
FT                   /protein_id="ABO05894.1"
FT                   /translation="MIVRDTDGRTASLTDVAPLLELVATTGSIAQAAHAKGLSYRHAWG
FT                   LLRALEACVGGALIETVRGKGSTLSELGQAIVDAQRLAGERLDGNLRALAAEVASGLNR
FT                   RLALHAGALRIHASHGYAVAALVSALVEAGSPVDIKYRESVEAVRALAGGECDLAGFHL
FT                   PRGAFRAACAQIYRPWLDDVDHVLIHLTRRRQGLFVPRGNPKRIAGLADLARGDIRFVN
FT                   RQPGSGTRMLLDLALREIGIDPERIDGYASAELTHSAIAAFVASGMADLGFGVEPAARH
FT                   FGLDFIAVVDEDYYFACERSRLGAVPLAGALALLRDGGYHATVARLDGYDPNACGTLVD
FT                   VAAGLAGTAGDARAGRHRR"
FT   gene            180876..181139
FT                   /locus_tag="BMA10247_0185"
FT   CDS_pept        180876..181139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05492"
FT                   /protein_id="ABO05492.1"
FT                   /translation="MKLLTQLAVASAVAGALAAAATAAFAQNSPGMPGGILNDQFRLNE
FT                   HPQMQFAASAPTKKYQSGKKSDLRRKGDMGDPNGCNLKCPMD"
FT   gene            complement(181320..181964)
FT                   /gene="pmtA"
FT                   /locus_tag="BMA10247_0186"
FT   CDS_pept        complement(181320..181964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmtA"
FT                   /locus_tag="BMA10247_0186"
FT                   /product="phospholipid N-methyltransferase PmtA"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04388"
FT                   /protein_id="ABO04388.1"
FT                   /translation="MRIHELALFLRAWLRNPRQVGALAPSGPALAALMTAQIPGESARV
FT                   IELGAGTGVFTRELLSRGVAADRLVLVEADPVFAATLRRRFPALRVMNVDAAELGITHG
FT                   LFGDARASTVVSGLPLVAMPVEQAIAIVHGAFAMHLGPGGAFYQFTYLPRCPIPVRRLA
FT                   AIGIRAERIGIAWANMPPAAVYRLQRCADFSGSPSSLGRPWPSARPPSTAA"
FT   gene            complement(182396..183229)
FT                   /locus_tag="BMA10247_0187"
FT   CDS_pept        complement(182396..183229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0187"
FT                   /product="A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06958"
FT                   /protein_id="ABO06958.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(183253..183516)
FT                   /locus_tag="BMA10247_0188"
FT   CDS_pept        complement(183253..183516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0188"
FT                   /product="transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06039"
FT                   /protein_id="ABO06039.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            complement(183760..184128)
FT                   /gene="ssrA"
FT                   /locus_tag="BMA10247_3555"
FT   tmRNA           complement(183760..184128)
FT                   /gene="ssrA"
FT                   /locus_tag="BMA10247_3555"
FT   gene            complement(184135..184860)
FT                   /gene="gph-1"
FT                   /locus_tag="BMA10247_0190"
FT   CDS_pept        complement(184135..184860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph-1"
FT                   /locus_tag="BMA10247_0190"
FT                   /product="phosphoglycolate phosphatase, bacterial"
FT                   /EC_number="3.1.3.18"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01449; match to protein
FT                   family HMM TIGR01509; match to protein family HMM
FT                   TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07401"
FT                   /protein_id="ABO07401.1"
FT                   /translation="MSPSSPSFAAPLSDAPRLDACEAVLFDLDGTLADTAPDLAAAVNK
FT                   MQRSRGIAQTPLDALRPLASAGARGLIGGAFGIAPADAEFDALRDEFLANYATDLCVHT
FT                   TLFPGIGVLLDDLDARGVRWGIVTNKAARFTDPLVALLGLAARAACVVSGDTASHPKPH
FT                   PAPLLYAADRLSLAPERIVYVGDDLRDIQAGSAAGMPTVAAAYGYCGDGAAPADWRAQH
FT                   LVETTDDLQRLLRVLRYNA"
FT   gene            complement(184886..185629)
FT                   /gene="ubiG"
FT                   /locus_tag="BMA10247_0191"
FT   CDS_pept        complement(184886..185629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="BMA10247_0191"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="identified by match to protein family HMM PF02353;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242; match to protein family HMM TIGR01983"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04512"
FT                   /protein_id="ABO04512.1"
FT                   /translation="MAGAPPPSFPHPLADMTNADPHELQKFSDLAHKWWDPNAEFKPLH
FT                   DLNPVRLSWIDAHAHLPGKRVVDIGCGGGILSESMASLGAQVKGIDLATEALGVADLHS
FT                   LESGVSVDYEAIAAEALAAREPGAYDVVTCMEMLEHVPSPANIVAACATLVKPGGWVFF
FT                   STLNRNLKSYLLAVIGAEYIAQMLPKGTHDYARFIRPSELARFVREAGLQMVEIKGIAY
FT                   HPLAKRFALSNDTDVNYLVACRRGA"
FT   gene            complement(185753..186427)
FT                   /locus_tag="BMA10247_0192"
FT   CDS_pept        complement(185753..186427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0192"
FT                   /product="OmpA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04145"
FT                   /protein_id="ABO04145.2"
FT                   /translation="MNKLSKLAFIAATAVMAASASAQSVPASRQAVNDNWVNGTGEWVW
FT                   MNGTNELCWRDAFWTPATANAKCDGALVAQAPAPAPVAPVAPAITSQKITYQADTLFDF
FT                   DKAVLKPAGKQKLDELAAKIQGMNVEVVVATGYTDRIGSDKYNDRLSLRRAQAVKSYLV
FT                   SKGVPANKVYTEGKGKRNPVTGNTCKQKNRKQLIACLAPDRRVEVEVVGTQEVQKTTVP
FT                   AQ"
FT   gene            186679..186825
FT                   /locus_tag="BMA10247_0194"
FT   CDS_pept        186679..186825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0194"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06017"
FT                   /protein_id="ABO06017.1"
FT                   /translation="MFRKLSSPLAGNCRFFEVRTFHRPFCVFLCARRSAGVRRMRARFA
FT                   ILI"
FT   gene            complement(186818..186946)
FT                   /locus_tag="BMA10247_0193"
FT   CDS_pept        complement(186818..186946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0193"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04842"
FT                   /protein_id="ABO04842.1"
FT                   /translation="MIHVSVSFRSEDGAAFRVGAARATQRAILTCAPTRPNAGPSI"
FT   gene            186938..189538
FT                   /gene="gyrA"
FT                   /locus_tag="BMA10247_0195"
FT   CDS_pept        186938..189538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BMA10247_0195"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06828"
FT                   /protein_id="ABO06828.1"
FT                   /translation="MDQFAKETLPTSLEEEMRKSYLDYAMSVIVGRALPDVRDGLKPVH
FT                   RRVLFAMHELNNDWNRPYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQDFSLRYMLVD
FT                   GQGNFGSVDGDNAAAMRYTEIRMAKIGHELLADIDKETVDFGPNYDGSEMQPLILPSRI
FT                   PNLLINGSSGIAVGMATNIPPHNLNEVVDACLYLLNNPQASVDELIEIIPAPDFPTAGI
FT                   IYGVAGVRDGYRTGRGRVVMRAATHFEEIDRGQRMAIIVDELPYQVNKRSLLERIAELV
FT                   NEKKLEGISDIRDESDKSGMRVVIELKRGEVPEVVLNNLYKATQLQDTFGMNMVALVDN
FT                   QPKLLNLREILQCFLSHRREVLTRRTVYELRKARERGHVLEGLAVALANIDEFIAIIKA
FT                   APTPPIAKQELMAKSWDSSLVRDMLTRAETENAAAGGRDAYRPEGLSPAFGMQGDGLYR
FT                   LSDTQAQEILQMRLQRLTGLEQDKIIGEYRDVMAQIADLLDILARPERITTLIGDELTQ
FT                   VKAEFGDARRSKIELNATELNTEDLITPQDMVVTMSHAGYVKSQPLSEYRAQKRGGRGK
FT                   QATQMKEDDWIETLFIANTHDYILCFSNRGRVYWVKVYEVPQGSRNSRGRPIVNMFPLQ
FT                   DGEKINVVLPVREFSADKYVFMTTALGTVKKTPLEAFSRPMKKGIIAVGLDDGDYLIGA
FT                   AITDGAHDVMLFSDAGKAVRFDENDVRPMGREARGVRGMQLDDAQQVIAMLVAGSEEQS
FT                   VLTATENGYGKRTPITEYTRHGRGTKGMIAIQTSERNGRVVAATLVDPEDQIMLITTAG
FT                   VLIRTRVSEIREMGRATQGVTLISLDEGTKLSGLQQIAEADADADDDAVEGGDA"
FT   gene            189637..190233
FT                   /locus_tag="BMA10247_0196"
FT   CDS_pept        189637..190233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05960"
FT                   /protein_id="ABO05960.1"
FT                   /translation="MQKRFKQLVLLAAMVPAFAMAQSLSNQTSAPAAAAPIDADKKAAI
FT                   KDLLDAIDAPKLVSAIANSAEMQSKQLVPAILSDALSENKTLNDKQKQAAVPTLQKNAV
FT                   PKLVDGAGKVFGTQQFTNDAMQAQYDAYAKYYSTSEIKDLTTFYKSPTGRKFIQVQDQV
FT                   GRDVVNGLMQKYMPQAIKATRDQADKEVAAVKPGK"
FT   gene            190407..191489
FT                   /gene="serC-1"
FT                   /locus_tag="BMA10247_0197"
FT   CDS_pept        190407..191489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC-1"
FT                   /locus_tag="BMA10247_0197"
FT                   /product="phosphoserine transaminase"
FT                   /EC_number="2.6.1.52"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM TIGR01364"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06759"
FT                   /protein_id="ABO06759.1"
FT                   /translation="MRVFNFSAGPAAMPEEVLRQAAAEMLDWNGSGMSVMEMSHRGKEF
FT                   MSIHEAALADLRELLGVPANYRILFLQGGGIAENAIVPMNLLGSRTTADFVITGSWSQK
FT                   SFNEAKKYCVPHLAATGKTDAGFTRVPAFSEWRMSDDPAYVHLCTNETIDGVETFDIPD
FT                   LGNVPLVADVSSHILSRPIEIEKYGAIFGGAQKNIGMAGVTLVIVREDLLDRALSICPS
FT                   AFEWKTVALNNSLYNTPPTYAIYIAGLVFKWLKAQGGLAAIEARNIEKSKLLYDAIDAS
FT                   GFYLNKVEKPARSRMNVPFFLADESRNEDFLAGAKERGLLQLKGHKSVGGMRASIYNAV
FT                   PLAGVQALVEYMKDFERRCA"
FT   gene            191524..192606
FT                   /gene="pheA"
FT                   /locus_tag="BMA10247_0198"
FT   CDS_pept        191524..192606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="BMA10247_0198"
FT                   /product="chorismate mutase/prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /EC_number="5.4.99.5"
FT                   /note="identified by match to protein family HMM PF00800;
FT                   match to protein family HMM PF01817; match to protein
FT                   family HMM PF01842; match to protein family HMM TIGR01807"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04698"
FT                   /protein_id="ABO04698.1"
FT                   /translation="MDDELNSRLKPLRERIDAIDTQLIALLNQRAAVALEVGEVKKHFN
FT                   APVFRPEREQQVIARLQDMSAGPLASEHISAIWREIMAASRDLEQTIHVAFLGPVGTYS
FT                   EQAMFDYFGQSIEGLPCPSIDEVFRSVEAGAATFGVVPVENSSEGAVSRTLDLLLHTQL
FT                   LIGGELSLPIHHNLLTQTGKLDGVKRVCAHAQALAQCQQWLASNAPHLERQAVASNAEA
FT                   ARLAADDATVAAIAGDRAATHYGLQIAYALIQDDPHNRTRFAVIGQEPAGPSGHDQTSL
FT                   IVSVKNEPGAVFKLLEPLARHGVSMTRFESRPARVGTWEYYFYIDIEGHRDDAAVQGAL
FT                   AELGRKAAFLKILGSYPRAR"
FT   gene            192783..195032
FT                   /locus_tag="BMA10247_0199"
FT   CDS_pept        192783..195032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0199"
FT                   /product="prephenate dehydrogenase/3-phosphoshikimate
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="1.3.1.12"
FT                   /EC_number="2.5.1.19"
FT                   /note="identified by match to protein family HMM PF00275;
FT                   match to protein family HMM PF02153; match to protein
FT                   family HMM TIGR01356"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07042"
FT                   /protein_id="ABO07042.1"
FT                   /translation="MSGFYFDKLVIFGVGLIGGSLALALREGASGGRREVVGVGRSSAS
FT                   IGRALALRVIDRAAALDDDAQLRDALAGADLVLLAAPVAQTGPLLARIAPFLDASTIVT
FT                   DAGSTKSDVVAAARAALGARIGQFVPGHPIAGRESSGVDAALADLYVGRNVVLCALPEN
FT                   APDALARVEAMWRAARADVRAMSAEQHDRVFAAVSHLPHVLSFALVEQILGESDAELKF
FT                   SYAAGGFRDFTRIAASSPEMWCDVCLANRAALLDELDAYTAVLARLRAAIDAGDGAALE
FT                   AVFARSRAARAAWRERGAKPAPAVRSDTSGTGSHMEHLDLGPFSHAQGTVRLPGSKSIS
FT                   NRVLLLAALAEGETTVTNLLDSDDTRVMLDALTKLGVKLSRDGGTCVVGGTRGAFTAKT
FT                   ADLFLGNAGTAVRPLTAALAVNGGEYRIHGVPRMHERPIGDLVDGLRQIGARIDYEGNE
FT                   GFPPLRIRPATISVDAPIRVRGDVSSQFLTALLMTLPLVKAKDGASVVEIDGELISKPY
FT                   IEITIKLMARFGVTVERDGWQRFTVPAGVRYRSPGTIMVEGDASSASYFLAAGALGGGP
FT                   LRVEGVGRASIQGDVGFANALMQMGANVTMGDDWIEVRGIGHDHGRLAPIDMDFNLIPD
FT                   AAMTIAVAALFADGPSTLRNIGSWRVKETDRIAAMATELRKVGATVEEGADYLVVTPPA
FT                   QLTPNASIDTYDDHRMAMCFSLVSLGGVPVRINDPKCVGKTFPDYFDRFLALANA"
FT   gene            195053..195739
FT                   /gene="cmk"
FT                   /locus_tag="BMA10247_0200"
FT   CDS_pept        195053..195739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="BMA10247_0200"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="identified by match to protein family HMM PF02224;
FT                   match to protein family HMM TIGR00017"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04174"
FT                   /db_xref="GOA:A3MHN9"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHN9"
FT                   /protein_id="ABO04174.1"
FT                   /translation="MKSTRPFHPTPVITIDGPTASGKGTVAALVAAHLGFHLLDSGALY
FT                   RLAALASIRYQVEPDDADALASLVDGLHITFREGCAQLDGVDVSDEIRAEAVGNRASAI
FT                   AVHASVRAALVARQRAFRKTPGLVADGRDMGTLIFPDAVLKVFLTASVEARAARRHKQL
FT                   MQKGFSANIDNLLQDLRERDARDSNRAAAPLKPAADAKPLDTSALTIEQSVEQVLAWYR
FT                   ELGQPA"
FT   gene            195884..197596
FT                   /gene="rpsA"
FT                   /locus_tag="BMA10247_0201"
FT   CDS_pept        195884..197596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="BMA10247_0201"
FT                   /product="30S ribosomal protein S1"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM TIGR00717"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06714"
FT                   /protein_id="ABO06714.1"
FT                   /translation="MSDLQTSNPNTESFAALFEESLTRQDMRAGEVISAEVVRVDHNFV
FT                   VVNAGLKSEAYIPIEEFLNDQGEVEVQAGDFVSVAIDALENGYGDTILSRDKAKRLASW
FT                   LSLEKALDNNELVTGTITGKVKGGMTVMVNGIRAFLPGSLVDTRPVKDTTPYEGKTLEF
FT                   RVIKLDRKRNNVVLSRRAVIEATQGEERAKLLETLKEGAIVNGVVKNITDYGAFVDLGG
FT                   IDGLLHITDIAWRRVRHPSEVLSVGQEVTAKILKFDQEKNRVSLGIKQLGDDPWEGISR
FT                   RYPSGTRLFGKVTNITDYGAFVEVESGIEGLVHVSEMDWTNKNVAPSKVVQLGDEVEVM
FT                   VLEIDEDRRRISLGMKQCKPNPWDDFSRNFKKGDKITGAIKSITDFGVFIGLPGGIDGL
FT                   VHLSDLSWSEAGEEAVRKYKKGDEVEAIVLGIDVEKERISLGIKQLEGDPFSNYVAMND
FT                   KGSIVDGVVKSVDAKGAVITLTPDVEGYLRASEISQDRVEDARNVLKEGEKVNAMVINI
FT                   DRKSRGINLSIKAKDSAEQQEAMRGLQADSSAAATGTTNLGALLKAKLDGQNQ"
FT   gene            197619..197942
FT                   /gene="ihfB"
FT                   /locus_tag="BMA10247_0202"
FT   CDS_pept        197619..197942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /locus_tag="BMA10247_0202"
FT                   /product="integration host factor, beta subunit"
FT                   /note="identified by match to protein family HMM PF00216;
FT                   match to protein family HMM TIGR00988"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07345"
FT                   /db_xref="GOA:A3MHP1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHP1"
FT                   /protein_id="ABO07345.1"
FT                   /translation="MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEI
FT                   RGFGSFGLNRRPARVGRNPKSGEKVQVPEKHVPHFKPGKELRERVDGRAGEPLKNDEPE
FT                   DAQ"
FT   gene            197974..199524
FT                   /locus_tag="BMA10247_0203"
FT   CDS_pept        197974..199524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0203"
FT                   /product="ISBma2, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06360"
FT                   /protein_id="ABO06360.1"
FT                   /translation="MAERRRPARGAQIADKPSPSGGFLFFNGVMLKTPMPTQHELEMVT
FT                   LEELVPKDHLLRQIDAAVDFEFIRAKVAHLYCADNGRPALDPVVMFKLLFIGYLFGVRS
FT                   ERQLMREVQVNVAYRWFARFRLTDKVPDASTFSQNRRRRFTDTTVYQEIFDEIVRQAIK
FT                   RGLVDGRVLYTDSTHLKANANKGKFDVVKLEQTPAAYTEALNAAVDADRAAHGRKPLDR
FT                   DDDEPPSSKDTKLSRTDPDSGYMVRDDKPKGFFYLDHRTVDAKHAIITDTHVTPASVHD
FT                   SQPYLDRLDRQRERFEFKVEAVGLDAGYFTPAVCQGLEERGIAGVMGYRTPNHKPGMFY
FT                   KRQFKYDAYRNEYVCPQGQALPYSTTNRLGYREYKSNAQICGRCPVRSQCTNSAIAVKV
FT                   VTRHVWERAKERVDARRLTEWGQRIYARRKQTVERSFADAKQLHGHRYARMRGLRKVAE
FT                   QCLLAAAAQNIKKIAMLLVRKRKKGPAGPDWRFVRMLLRLVSGLRCSFDYPLAANPQS"
FT   gene            199760..200053
FT                   /pseudo
FT                   /locus_tag="BMA10247_0204"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            200106..201275
FT                   /locus_tag="BMA10247_0205"
FT   CDS_pept        200106..201275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0205"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04411"
FT                   /protein_id="ABO04411.1"
FT                   /translation="MDLDFWWLLAIPVAFALGWMASRYDLNKLLSESANLPRSYFRGLN
FT                   FLLNEQPDKAIDAFIEVAKLDPETVELHFALGNLFRRRGETDRAIRVHQNLLSRNDLPV
FT                   SERDHALFELGQDFLKAGLLDRAEETFHMLAEGDYALDAQRALLTIYEIEKDWTKSIDT
FT                   AARIEAMGAPRLTTEISQFHCELAQDALQRKSAELAAEHLRDALAVNPQNARAAILSGD
FT                   TAAAAGDHRAAIEHWRRIETQNPAYLPLVADKLMKSYAALDRAAEGAELLTGYAQRYPS
FT                   NDLLDVVYQYVAQLRGNDVAHALARSQMEKAPNLSGMLHLLDAQIAAADEPRRSELEMM
FT                   RALVKQRTKNLPRYTCQNCGFRARLFYWQCPGCSGWETYAPRRVEPAVA"
FT   gene            201396..202796
FT                   /gene="ugd"
FT                   /locus_tag="BMA10247_0206"
FT   CDS_pept        201396..202796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="BMA10247_0206"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03720; match to protein
FT                   family HMM PF03721; match to protein family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06925"
FT                   /protein_id="ABO06925.1"
FT                   /translation="MKITIIGTGYVGLVTGACLAEIGHDVFCLDVDPRKIDILNNGGMP
FT                   IHEPGLQEIIARTRAAGRIAFSTDIEASVAHGEIQFIAVGTPPDEDGSADLQYVLEAAR
FT                   NIGRHMTGYKVIVDKSTVPVRTAQRVRAVIDEALAARGLAGSAEHRFSVVSNPEFLKEG
FT                   AAVDDFMRPDRIIIGVDDDAAGAIAREKMKKLYAPFNRNHERTIYMDVRSAEFSKYAAN
FT                   AMLATRISFMNEMSNLADRVGADIEAVRRGIGSDPRIGYHFLYAGVGYGGSCFPKDVQA
FT                   LIRTGSENGQPLRILEAVEDVNHAQKNVLLDKIEKRYGADLAGRTFAVWGLAFKPNTDD
FT                   MREAPSRRLIASLLARGATVRAYDPVALDEARRVFALDLHDGADALARLAFVDSADDAL
FT                   AGADALVIVTEWKEFKSPDFAHLKSVLKAPVIFDGRNLYEPDAMAELGIDYHAIGRPYV
FT                   EPFSSERG"
FT   gene            202753..203751
FT                   /gene="rfaE_1"
FT                   /locus_tag="BMA10247_0207"
FT   CDS_pept        202753..203751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE_1"
FT                   /locus_tag="BMA10247_0207"
FT                   /product="bifunctional protein RfaE, domain I"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by similarity to SP:P76658; match to
FT                   protein family HMM PF00294; match to protein family HMM
FT                   TIGR02198"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05949"
FT                   /protein_id="ABO05949.1"
FT                   /translation="MDAPMSSPSLPSADKRASLAATARAVSREQIAKSRVLVVGDVMLD
FT                   RYWFGNVNRISPEAPVPVVHVQRQEERLGGAANVARNAVTLGGQAGLLCVVGRDEPGER
FT                   IVELLGESGVTPYLERDPSLPTTIKLRVLAQQQQLLRVDFEASPTHEVLLAGLARFDAL
FT                   LPSYDVVLMSDYAKGGLTHVTTMIAKARAAGKPVLVDPKGADWARYRGASLITPNRAEL
FT                   REVVGRWTSEDDLRARVTKLREALAFDALLLTRSEEGMTLFSHEGELHVSALAREVYDV
FT                   SGAGDTVIATVATMFGAGLPLVEAVVLANRAAGIVIGKLGTATVEYDELFH"
FT   gene            203810..204802
FT                   /gene="rfaD"
FT                   /locus_tag="BMA10247_0208"
FT   CDS_pept        203810..204802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /locus_tag="BMA10247_0208"
FT                   /product="ADP-L-glycero-D-mannoheptose-6-epimerase"
FT                   /EC_number="5.1.3.20"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF04321; match to protein family HMM PF07993;
FT                   match to protein family HMM TIGR02197"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06908"
FT                   /db_xref="GOA:A3MHP7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHP7"
FT                   /protein_id="ABO06908.1"
FT                   /translation="MTLIVTGAAGFIGANIVKALNERGETRIIAVDNLTRADKFKNLVD
FT                   CEIDDYLDKTEFVERFARGDFGKVRAVFHEGACSDTMETDGRYMMDNNFRYSRAVLDAC
FT                   LAQGTQFLYASSAAIYGGSSRFVEAREFEAPLNVYGYSKFLFDQVIRRVMPSAKSQIAG
FT                   FRYFNVYGPRESHKGRMASVAFHNFNQFRAEGKVKLFGEYNGYGPGEQTRDFVSVEDVA
FT                   KVNLHFFDHPQKSGIFNLGTGRAQPFNDIATTVVNTLRALEGQPALTLAEQVEQGLVEY
FT                   VPFPDALRGKYQCFTQADQTKLRAAGYDAPFLTVQEGVDRYVRWLFGQL"
FT   gene            204874..205191
FT                   /gene="comE"
FT                   /locus_tag="BMA10247_0209"
FT   CDS_pept        204874..205191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comE"
FT                   /locus_tag="BMA10247_0209"
FT                   /product="competence protein ComE"
FT                   /note="identified by similarity to GP:10505056"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04978"
FT                   /protein_id="ABO04978.1"
FT                   /translation="MLKKLLATAALCAAAAHGWAAVDVNAANDDALRGIRGIGPAKAKA
FT                   IVDERSAHGPFKDAADLARRVKGMGGKTVERLQAEGLAIGAARAPAAAGAPQKAAAAGK
FT                   K"
FT   gene            205204..205503
FT                   /pseudo
FT                   /locus_tag="BMA10247_0210"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            205506..206417
FT                   /gene="cysM"
FT                   /locus_tag="BMA10247_0211"
FT   CDS_pept        205506..206417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysM"
FT                   /locus_tag="BMA10247_0211"
FT                   /product="cysteine synthase B"
FT                   /EC_number="2.5.1.47"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01136; match to protein
FT                   family HMM TIGR01138"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06334"
FT                   /protein_id="ABO06334.1"
FT                   /translation="MTFMAYKTIEDTIGNTPLVQLVRLPDDEIRARNNVILAKLEGNNP
FT                   AGSVKDRPALSMIRKAEERGTIKPGDTLIEATSGNTGIALAMAAAIRGYKMVLIMPEDL
FT                   SIERRQSMAAYGAEIVLTPVKGGMEFARDLADQMQREGKGVILDQFANPDNPLAHYEGT
FT                   GPEIWRETEGRVTHFVSAMGTTGTIMGTSQYLKERNPTVEIVGAQPEEGSRIPGIRKWP
FT                   EAYLPKIFDRSRIDRVENVSQAASEAMARKLAAVEGIFCGISSGGACEVALRVARQVEN
FT                   ATIVFVVCDRGDRYLSTGVFPA"
FT   gene            complement(206643..207944)
FT                   /locus_tag="BMA10247_0212"
FT   CDS_pept        complement(206643..207944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0212"
FT                   /product="murein transglycosylase domain protein"
FT                   /note="identified by match to protein family HMM TIGR02282"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07303"
FT                   /protein_id="ABO07303.1"
FT                   /translation="MIFHQPAAPASLAFRLRFPLAALSLAATLFASAAVAQTQPAAAVV
FT                   AQEPAQSQSQLQLQPQPQPQPQPQPQPQPSVQQGQTFEEEIIPQRYANNAKIDAFIADM
FT                   VARHDFDANALHALFARVSYSATAAKLVMPAPSPAVKNWRVYQSRFLDAVRVNAGVKFW
FT                   RANQGTLQRASTEFGVPPEVIVGIIGVETIYGRYMGNFRTLDALTTLAFDYPNTPNRDA
FT                   RQATFRKNLEDFLVWTRDSQLDPTGVLGSYTGAVGIPQFLPSSIRDYAVDYDGNGHIDL
FT                   RASQADAIGSVANYLKQHGWETGRPVVWNIAPDTGSQGVAQAAADGRPEPHWVLSQLLR
FT                   AGLVLDEPSVNIASEASTPVTVVDLPTPGRATEYKLGLQNFYVLTRYNRSFFYALAVYQ
FT                   LGERVKAQMEASGALTPSPADAATGSPAAQPPSE"
FT   gene            208123..209046
FT                   /locus_tag="BMA10247_0213"
FT   CDS_pept        208123..209046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0213"
FT                   /product="histone deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06517"
FT                   /protein_id="ABO06517.1"
FT                   /translation="MPTAFYTHPDCLLHEMGEWHPESPARLSAIQDQLIASRIDDLIVH
FT                   ETAPFASETALARVHTQAHIDYIRSRIPKDGYVEIDPDTSLNRYTWRAALRAAGAAVEA
FT                   TDAVLEGRYDNAFCSVRPPGHHAEPARAMGFCFFNNVAIAARHALEIHGLERVAIIDFD
FT                   VHHGNGTEAAFANDERVLMCSFFQHPLYPFSGVDHQAPNMVNLPMAARTNGMAVREAVD
FT                   LMWLPRLDAFRPQMLFVSAGFDAHREDDIGGMGLVEADYEWLTQQICEVARRHAQGRIV
FT                   SCLEGGYNLSALGRSVVAHLRVLAGV"
FT   gene            complement(209389..210231)
FT                   /locus_tag="BMA10247_0214"
FT   CDS_pept        complement(209389..210231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0214"
FT                   /product="alpha/beta hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05304"
FT                   /protein_id="ABO05304.1"
FT                   /translation="MRTADRLELACYRWPSTAPSCAAPRATVALVHGLAEHAGRYQAFA
FT                   ERLNAAGIEVVAIDLRGHGRSPGERAWAERFDRYLDDADALVASAARENTPLFLMGHSM
FT                   GGAIAALYAIERAAARHANLAGLILSSPALAPGRDVPQWMLAMSRFISRVWPRFPALKI
FT                   DAALLSRDPAVVAANRADPLVHHGSVPARTGAEILDAMRRIAAGRAALRIPVLVYHGTA
FT                   DKLTEPDGSRDFGAHVGSPDRTLTLYEGNYHETMNDLERERVIGALIDWIAARVPARG"
FT   gene            210540..211574
FT                   /gene="metN"
FT                   /locus_tag="BMA10247_0215"
FT   CDS_pept        210540..211574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="BMA10247_0215"
FT                   /product="D-methionine ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF09383"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04525"
FT                   /protein_id="ABO04525.1"
FT                   /translation="MIEIRNLSQRFEGPRGWIEALHNVNLTIPQGEVFGIIGRSGAGKS
FT                   TLVRTINLLTRPSEGSVFVGGRDLTQLSAAELRGARRDIGMIFQHFNLLSSRTVFDNVA
FT                   LPLELAGVKRAQIEATVLPLLDLVGLAAQKDRYPAQISGGQKQRVGIARALASKPKVLL
FT                   SDEATSALDPETTRAILDLLRRINRELGLTIVLITHQMEVIKDVCDRVAVLDAGRVVEE
FT                   GNVIDVFMRPHHEVTRALIGDVIAQELPPAMKARVAERLKTGSGHLLRLAFTGSGVDQP
FT                   ILSETIRRYELDFNILHGQIDEIQGRAFGSLAVLATGEPGKVGQAFAYLREQGVVVEEL
FT                   SYVE"
FT   gene            211564..212217
FT                   /gene="metI"
FT                   /locus_tag="BMA10247_0216"
FT   CDS_pept        211564..212217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="BMA10247_0216"
FT                   /product="D-methionine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06558"
FT                   /protein_id="ABO06558.1"
FT                   /translation="MLSEMFDMFVQSFWETLIMVGISGAVGALVGLPLGVLLYLTDRQG
FT                   VLQNLAVNRVLGGVVNAVRSTPFIILLVAVIPFTRLAVGSSIGTAAAVVPLTIAAAPFV
FT                   ARLVETALREVDRGLIEAAQAMGATTGQIVFKVLLPESLPGIVAGLTITFVSLVGYSAM
FT                   AGAIGGGGLGDLGIRYGYQRYLPEVMWTVVAILIVFVQIVQSFGDWLVRRLSHK"
FT   gene            212291..213085
FT                   /gene="metQ-1"
FT                   /locus_tag="BMA10247_0217"
FT   CDS_pept        212291..213085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ-1"
FT                   /locus_tag="BMA10247_0217"
FT                   /product="D-methionine ABC transporter, periplasmic
FT                   D-methionine-binding protein"
FT                   /note="identified by match to protein family HMM PF03180;
FT                   match to protein family HMM TIGR00363"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06052"
FT                   /protein_id="ABO06052.1"
FT                   /translation="MQRRTMLKLAAALGAAVCVAGAQAQTQTIKVGVTGGPHAQVMEEV
FT                   KKVAAKHGLDIRIVEFSDYVQPNAALAAGDLDANSYQHAPYLDAQVKDRGYRIVKVADT
FT                   VTFPMGVYSKRVNSLAALRAGARIAIPNDPTNGGRALLLLQKQGLLKLRDGAGLKATRF
FT                   DVVDNPKQLKLVELDAAQIPHSLADVDAAAINTNYAMEAGLKPKQDAIAIEGPNGPYAN
FT                   VFAVRAEDKDKPWVAKLVAAYRSADVKRFIERQFGGAVIAAW"
FT   gene            213312..214061
FT                   /gene="etfB"
FT                   /locus_tag="BMA10247_0218"
FT   CDS_pept        213312..214061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfB"
FT                   /locus_tag="BMA10247_0218"
FT                   /product="electron transfer flavoprotein, beta subunit"
FT                   /note="identified by similarity to SP:P38975; match to
FT                   protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04588"
FT                   /protein_id="ABO04588.1"
FT                   /translation="MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEE
FT                   AVRLKEAGVATEVIAVSVGVAQAQETLRTALAIGADRAILVESNDEVQPLSVAKILKAL
FT                   VDKEQPQLVILGKQAIDDDSNQTGQMLAALANLPQATFASKVTVADGKATVAREVDGGA
FT                   ETLSLTLPAVVTTDLRLNEPRYVTLPNIMKAKKKPLETVKPEDLGVDVAPRLKTLKVVE
FT                   PPKRAAGVKVADVKTLVEKLKTEAKVL"
FT   gene            214077..215012
FT                   /gene="etfA"
FT                   /locus_tag="BMA10247_0219"
FT   CDS_pept        214077..215012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfA"
FT                   /locus_tag="BMA10247_0219"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="identified by similarity to SP:P38974; match to
FT                   protein family HMM PF00766; match to protein family HMM
FT                   PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07404"
FT                   /protein_id="ABO07404.1"
FT                   /translation="MTILVIAEHDNASIKAATLNTVAAATKIGGDIHVLVAGHNAQGAA
FT                   DAAAKIAGVSKVLLADAPQLADGLAENVEATALNVAKDYSHILAPATAYGKNIAPRIAA
FT                   KLDVAQISDITAVDSADTFERPIYAGNAIATVQSSDPIKVITVRATGFDPVAAQGGSAS
FT                   VEKIDAAADAGVSQFVSREVTKLDRPELTSASIIVSGGRGLGSGENYTKVLEPLADKLQ
FT                   AALGASRAAVDAGYVPNDYQVGQTGKIVAPQLYIAVGISGAIQHLAGMKDSKVIVAINK
FT                   DPEAPIFSVADYGLVGDLFTLVPELVNELG"
FT   gene            215125..216228
FT                   /pseudo
FT                   /locus_tag="BMA10247_0220"
FT                   /note="acyl-CoA dehydrogenase; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF02770"
FT   gene            216260..216913
FT                   /pseudo
FT                   /locus_tag="BMA10247_0221"
FT                   /note="acyl-CoA dehydrogenase; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(217028..218314)
FT                   /locus_tag="BMA10247_0222"
FT   CDS_pept        complement(217028..218314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0222"
FT                   /product="putative D-amino acid dehydrogenase 1, small
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05709"
FT                   /db_xref="GOA:A3MHR1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHR1"
FT                   /protein_id="ABO05709.1"
FT                   /translation="MRVVILGSGVVGVASAYYLARAGHEVTVIDREAGPALDTSFANAG
FT                   QISPGYAAPWAAPGVPLKAVKWMFEKHAPLAIRLDGTRFQLQWMWQMLRNCTTERYALN
FT                   KGRMVRLAEYSRDCLQALRAETAIQYEGRTGGTLQVFRTQQQLDGAAKDIAVLREANVP
FT                   FELLSSDELKKAEPALAAVSHKLTGGLRLPGDETGDCQLFTTRLAALAEQLGVKFRFNT
FT                   RIDALAVAGGKIAGVQCGGEMVRADAYVVALGSYSTNLVASLVKIPVYPLKGYSITAPI
FT                   VDAAKAPVSTVLDETYKIAITRFDDRIRVGGMAEIVGFDKRLRDARRGTLEMCVNDLFP
FT                   GGGDTAKATFWTGLRPMTPDGTPIVGRTPVPNLFLNTGHGTLGWTMSCGSGQLLADLMS
FT                   GKKPAIRADDLSVHRYLSETDGEHRPAYA"
FT   gene            218462..218950
FT                   /locus_tag="BMA10247_0223"
FT   CDS_pept        218462..218950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0223"
FT                   /product="leucine-responsive regulatory protein"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06894"
FT                   /protein_id="ABO06894.1"
FT                   /translation="MRTQRQPVRALDKLDRRILKLLQEDGRMAMKDLAERVGLTVTPCI
FT                   ERVRRMERDGVITGYHARVDPSQLGASLLVFVEITLDHKNGNMFEQFRREVMKIDEVLE
FT                   CHLVSGDSDYLIKARIGEMADYRKLLGDILLQLPGAVQSKSYVVMEEIKETLMIAVDE"
FT   gene            219059..220216
FT                   /locus_tag="BMA10247_0224"
FT   CDS_pept        219059..220216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0224"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05557"
FT                   /protein_id="ABO05557.1"
FT                   /translation="MSERYDVEYPVMPPAPRKGRGAVGNLQGRYETVEREAVDDGWTRD
FT                   DDGEPRAPLRTQVFEERARTILTRNASPDIPFNVSLNPYRGCEHGCIYCFARPTHSYLG
FT                   LSPGLDFESRIYAKVNAAELLARELAKPRYVPEPIALGVNTDAYQPVERERRITRQVIQ
FT                   VMHDHGQPFAAITKSSLIERDLDLLAPMAERRQVMAAVTITTLDPELARALEPRAATPS
FT                   RRLRTIRALRDAGVPVGVSIAPMIPFVTEPDLERVLEACADAGATHASYIVLRLPWEVA
FT                   PLFTEWLAAHFPDRAERVMARVRDMRGGKDYDADFSRRMKGEGMWAELFKQRFRMAVKR
FT                   CGLNERARGILDFSQFCAPRRSKPPSPVRPRAAAQTGDQPQLSLF"
FT   gene            complement(220251..220718)
FT                   /locus_tag="BMA10247_0225"
FT   CDS_pept        complement(220251..220718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06124"
FT                   /protein_id="ABO06124.1"
FT                   /translation="MSSSTSTPPRFRSKTLTALLAFLFGSLGAHRFYLYGWKDLAGWAH
FT                   LLATIVGVPGFMLLAASGRAAALGWWLAVPGAISLLAAFLAALVYGLRPDDKWDAQFNA
FT                   STGRHSRSGWGVVFVVIFSLLIGAFLLMTGLALAFQTYFESQVEAAKQISQ"
FT   gene            complement(220825..221013)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0226"
FT                   /note="L-sorbosone dehydrogenase; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            complement(221044..221943)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0227"
FT                   /note="L-sorbosone dehydrogenase; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            222159..222413
FT                   /gene="rpsP"
FT                   /locus_tag="BMA10247_0228"
FT   CDS_pept        222159..222413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="BMA10247_0228"
FT                   /product="30S ribosomal protein S16"
FT                   /note="identified by match to protein family HMM PF00886;
FT                   match to protein family HMM TIGR00002"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05123"
FT                   /db_xref="GOA:A3MHR7"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHR7"
FT                   /protein_id="ABO05123.1"
FT                   /translation="MVIIRLARGGSKKRPFYNIVATDSRNRRDGRFIERVGFYNPVATK
FT                   GEALRIAQDRLTYWQGVGAQLSPTVERLVKQAQKAQPAA"
FT   gene            222458..223147
FT                   /gene="rimM"
FT                   /locus_tag="BMA10247_0229"
FT   CDS_pept        222458..223147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="BMA10247_0229"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="identified by match to protein family HMM PF01782;
FT                   match to protein family HMM PF05239; match to protein
FT                   family HMM TIGR02273"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05150"
FT                   /db_xref="GOA:A3MHR8"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHR8"
FT                   /protein_id="ABO05150.1"
FT                   /translation="MAGHDSGNAKRGRSPSFGVFVRKPVERAPAKGASDGAVDSQAIRI
FT                   DAAQSWPDDAVEVGAVVDAYGLKGWVKLAAHAGAGRGGDALLKARDWWLQKGAERKFAR
FT                   VTQAKLHGDTVVAHPDGSVDRDTALALRGARVFVRRGDFPALAADEFYWVDLIGLDVVN
FT                   EAGVALGKIADMIDNGVHSIMRVEYPATGKDGRPKTGERLIPFVGVYVKAVEQAAGRVV
FT                   VDWEADY"
FT   gene            223149..223943
FT                   /gene="trmD"
FT                   /locus_tag="BMA10247_0230"
FT   CDS_pept        223149..223943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="BMA10247_0230"
FT                   /product="tRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01746;
FT                   match to protein family HMM TIGR00088"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07305"
FT                   /db_xref="GOA:A3MHR9"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHR9"
FT                   /protein_id="ABO07305.1"
FT                   /translation="MDEATQSAIQFDVVTLFPEMFRALTDWGITSRAVKQGRFGLRTWN
FT                   PRDFTTDNYRTVDDRPYGGGPGMVMLAKPLEAAIGAAKAAQAAQGVATSRVVMMSPQGA
FT                   PLTHERVARMAAEPGVVLLCGRYEAIDQRLIDRCVDEELSLGDFVLSGGELPAMALMDA
FT                   VVRLLPGVLNDAQSAVQDSFADGLLDCPHYTRPEEYEGVRVPDVLLGGHHAEIERWRRQ
FT                   EALRNTIAKRPDLIARARREKLLSRADEAWLASLAKEAKQAS"
FT   gene            224081..224470
FT                   /gene="rplS"
FT                   /locus_tag="BMA10247_0231"
FT   CDS_pept        224081..224470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="BMA10247_0231"
FT                   /product="50S ribosomal protein L19"
FT                   /note="identified by match to protein family HMM PF01245;
FT                   match to protein family HMM TIGR01024"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04477"
FT                   /db_xref="GOA:A3MHS0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHS0"
FT                   /protein_id="ABO04477.1"
FT                   /translation="MNLIAKLEQEEIERALAGKTIPEFAPGDTVIVNVNVVEGNRKRVQ
FT                   AYEGVVIAKRNRGLNSSFIVRKISSGEGVERTFQTYSPLLASIVVKRRGDVRRAKLYYL
FT                   RERSGKSARIKEKLVSKDRAAAAQQ"
FT   gene            complement(224791..225381)
FT                   /locus_tag="BMA10247_0232"
FT   CDS_pept        complement(224791..225381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0232"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04748"
FT                   /protein_id="ABO04748.1"
FT                   /translation="MNAYTLQSIRYNDAPDALRRRFALLHQRVDPDDAFAPDGPPPVIH
FT                   DPRLDAMSFYASTRSNGEVVSYAAVVRKTIAHAGKRFSIGGLSWVATDPAHRRAGLGAR
FT                   TVSAATQWMAASGLDIGVFTCDPPLARFYARAGDWPIAAHVTLIGSRAAGALRSDTLNK
FT                   VVLMRLFTAKARAAEAELSRATIDLDLPPGQFL"
FT   gene            complement(225826..226032)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0233"
FT                   /note="ribosomal protein S3; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            226335..226988
FT                   /locus_tag="BMA10247_0234"
FT   CDS_pept        226335..226988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0234"
FT                   /product="pyrophosphatase, MutT/NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05885"
FT                   /protein_id="ABO05885.1"
FT                   /translation="MLPIETTGADLPVVRPSSMTPDGLRERFAEPPEWTQEPAEAQLAH
FT                   GVDPRSAAVLVPLVVRERGLTVLLTQRADHLNDHAGQISFPGGRREPDDRDANATALRE
FT                   AREEIALAHERVELLGALPDYLTGTGFCVTPVVGLVHPPFTVQPDTLEVAEIFEVPLDF
FT                   LMNPAHHQIRVLRWEGGERRFFAMPYPRGPVGGQYFIWGATAGMLRNLYRFLSA"
FT   gene            227089..228027
FT                   /locus_tag="BMA10247_0235"
FT   CDS_pept        227089..228027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0235"
FT                   /product="putative CobD/CbiB family protein"
FT                   /note="identified by match to protein family HMM PF03186"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06638"
FT                   /protein_id="ABO06638.1"
FT                   /translation="MTFFSVLLALIIEQVRALSPSNPVFALFQSHAESAAHGFDAGKKK
FT                   HGVLAWLVVVLPWVLAVGLVYFLLYKVSFVLAFLWNVVVVYFTLGFRQFSHYFTDIHLA
FT                   LNNDDVPRARDILREWTGIDTVDMPVGEIVRHTLIHAVVASHRHVFGVFFWFVLPVGPA
FT                   GAVLYRIAEYLSRSWSVPADDRTAAFSTFAQRAFFVIDWVPARLTALGFAIVGNFEDAI
FT                   YAWRNHTRQWPDPNDGVLLAAGSGALGARLAGPLAEPSSVDALASGDSGPLTVGDDCTP
FT                   RTLQSAVGLVWRAVILWMLLLLMLTIAVWVS"
FT   gene            complement(228194..228511)
FT                   /locus_tag="BMA10247_0236"
FT   CDS_pept        complement(228194..228511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0236"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06219"
FT                   /protein_id="ABO06219.1"
FT                   /translation="MRLKAPDLATAQHWANVLGVAGVGCELHNCYAPGALGGLPIDACQ
FT                   PEIWLDDERDEALARRLIEAASAGPAAGAAPWRCARCGETLDAQFTACWHCGASRDPRD
FT                   G"
FT   gene            complement(228580..229524)
FT                   /gene="rsgA"
FT                   /locus_tag="BMA10247_0237"
FT   CDS_pept        complement(228580..229524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsgA"
FT                   /locus_tag="BMA10247_0237"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="identified by match to protein family HMM PF03193;
FT                   match to protein family HMM TIGR00157"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07036"
FT                   /db_xref="GOA:A3MHS6"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHS6"
FT                   /protein_id="ABO07036.1"
FT                   /translation="MKRAPTKQPAKPAARGGERAQGRVIAAHGRHYIVAPADGGPMLQC
FT                   FPRRKKSEVAVGDRVAYERTSADQGVIVEIGERRNLLYRSDQFKSKLFAANLDQLLIVL
FT                   ATEPYFSEDLLGRALIAAEANELKPIVVLNKIDVEAALPVARERLAPYRALGYDVLELS
FT                   VKSAPDDARTQLAPRLAGHSTILLGQSGMGKSTLVNLLVPNAEAATREISAALNSGRHT
FT                   TTFTRLYPLQDGGALIDSPGFQEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEP
FT                   GCAILEALADGRIAPTRHALYAQLVHEASQIVR"
FT   gene            complement(229521..230786)
FT                   /locus_tag="BMA10247_0238"
FT   CDS_pept        complement(229521..230786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0238"
FT                   /product="peptidase, M48 family"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04476"
FT                   /protein_id="ABO04476.1"
FT                   /translation="MSAYTFTLLFAVAIVAMTGTKLWLASRQVRFVAAHRARVPAQFRE
FT                   TIPLAAHQRAADYTIERTRLTMFEIVVASAVLVGLTLLGGVGALDSLLAGWLGHGYGYG
FT                   QQVALVAAVLVISSAADLPFEYYRQFGIEERFGFNRMTKRLFFTDLAKNALLGAALGLP
FT                   LLFVVLWLMNQAGALWWLWTWIVWVGFQMLVLVLYPTFIAPIFNKFEPLSDDALRARIE
FT                   GLMKRCGFAAKGLFVMDGSRRSAHGNAYFTGFGASKRIVFFDTLLARLTGGEIEAVLAH
FT                   ELGHFKRRHVMKRMLWTFALSLALLALLGWLAQRAWFYTGLGVMPSLSGSNAGIALVLF
FT                   FLSMPVFLFFVTPLGSLSSRKHEFEADAFAASQTDARDLVNALVKLYEDNASTLTPDPV
FT                   YTAFYYSHPPASQRIDRLLQHS"
FT   gene            230905..231510
FT                   /gene="orn"
FT                   /locus_tag="BMA10247_0239"
FT   CDS_pept        230905..231510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="BMA10247_0239"
FT                   /product="oligoribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06088"
FT                   /db_xref="GOA:A3MHS8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHS8"
FT                   /protein_id="ABO06088.1"
FT                   /translation="MTDISAVAGQPALVRNELNLVWLDMEMTGLDPDTDRIIEIAVVVT
FT                   NSTLDIAVEGPVLAIHQSDETLAKMDDWNKNTHGRSGLIDRVRASSVTEADAAAQIAAF
FT                   LAEHVPPGKSPMCGNSICQDRRFMARWMPELERFFHYRNLDVSTLKELCRRWQPAIYKG
FT                   FQKRAMHTALADIHESIDELKYYRERFLIPAAPAGETA"
FT   gene            complement(231758..232378)
FT                   /gene="mog"
FT                   /locus_tag="BMA10247_0240"
FT   CDS_pept        complement(231758..232378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="BMA10247_0240"
FT                   /product="molybdopterin biosynthesis mog protein"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04895"
FT                   /protein_id="ABO04895.1"
FT                   /translation="MTTTKRNHPDELVIGLVSISDRASGGVYEDKGIPALAEWLAAALV
FT                   SPWRAETRLVQDDAPTISATLVELVDTLGCDLVLTTGGTGPARRDVTPEATLAVATKEM
FT                   PGFGEQMRQISLNFVPTAILSRQVAVIRETADHAALIVNLPGQPKSIKETLEGLRGADG
FT                   KVEVPGIFAAVPYCIDLIGGPYAQTNPAVCAAFRPKSAVRAPK"
FT   gene            complement(232359..232967)
FT                   /locus_tag="BMA10247_0241"
FT   CDS_pept        complement(232359..232967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:17427956; match to
FT                   protein family HMM PF04751"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03949"
FT                   /protein_id="ABO03949.2"
FT                   /translation="MPPMTRKTRIQPIEHPGEDADHGCDRPSKSQLKRDMHALQELGAA
FT                   LVELPKDAFKRMPMPEDLADAVREARRITDHEGKRRQLQYVGRVMRSLSADETAALRAA
FT                   LDAQRGVNKAETARLHWIERTREQLLANDDALTAFVREHPSADVQEGRTLIRNARKEAQ
FT                   QGKPPRYFRELFQWIKTASGSASDAPDLSADADDDDDEA"
FT   gene            233113..234483
FT                   /gene="pmbA"
FT                   /locus_tag="BMA10247_0242"
FT   CDS_pept        233113..234483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="BMA10247_0242"
FT                   /product="pmbA protein"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07316"
FT                   /protein_id="ABO07316.1"
FT                   /translation="MAANLDAQAHYFPHTQDELKAIATDILRHAKALGATDAATEISEG
FT                   DGLSVSVRRGEVETIEHNRDKTVGVTVFIGKKRGNASTSDFSPTALKDTVAAAYNIARF
FT                   TAEDDAAGLAEAELLETEPRDLDLYHPWRLSADEAVDLARRSEDAAFAVSPQIRNSEGA
FT                   SVSAQHSQFVLATTRGFLAGYPYSRHYIACAPIAGSGRHMQRDDWYTSKRRADELASPE
FT                   SVGRYAAQRALARMGARRLDTRKVPVLFEAPLAAGLLGAFVQAVSGGALYRKTSFLVDS
FT                   LGKEVFAPHVQIVEDPHVPRAMGSAPFDEEGVRTRARNVVRDGVVEGYFLSTYSARKLG
FT                   TQTTGNAGGSHNIALRSALTAPGDDFDAMLKKLGTGLLLTELMGQGVNYVTGDYSRGAA
FT                   GFWVENGEIQYPVEEITVASTLQEMFRHIVAIGADSIVRGTKETGSVLIEQMTIAGQ"
FT   gene            234602..236083
FT                   /locus_tag="BMA10247_0243"
FT   CDS_pept        234602..236083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0243"
FT                   /product="ISBma2, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05561"
FT                   /protein_id="ABO05561.1"
FT                   /translation="MFFNGVMLKTPMPTQHELEMVTLEELVPKDHLLRQIDAAVDFEFI
FT                   RAKVAHLYCADNGRPALDPVVMFKLLFIGYLFGVRSERQLMREVQVNVAYRWFARFRLT
FT                   DKVPDASTFSQNRRRRFTDTTVYQEIFDEIVRQAIKRGLVDGRVLYTDSTHLKANANKG
FT                   KFDVVKLEQTPAAYTEALNAAVDADRAAHGRKPLDRDDDEPPSSKDTKLSRTDPDSGYM
FT                   VRDDKPKGFFYLDHRTVDAKHAIITDTHVTPASVHDSQPYLDRLDRQRERFEFKVEAVG
FT                   LDAGYFTPAVCQGLEERGIAGVMGYRTPNHKPGMFYKRQFKYDAYRNEYVCPQGQALPY
FT                   STTNRLGYREYKSNAQICGRCPVRSQCTNSAIAVKVVTRHVWERAKERVDARRLTEWGQ
FT                   RIYARRKQTVERSFADAKQLHGHRYARMRGLRKVAEQCLLAAAAQNIKKIAMLLARKRK
FT                   KGPAGPDWRFVRMLLRLVSGLRCSFDYPLAANPQS"
FT   gene            complement(236212..236715)
FT                   /gene="folA"
FT                   /locus_tag="BMA10247_0244"
FT   CDS_pept        complement(236212..236715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="BMA10247_0244"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="identified by match to protein family HMM PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04738"
FT                   /protein_id="ABO04738.1"
FT                   /translation="MTTLTLIVARARNGVIGRDNRLPWKLPEDLAFFKRTTMGAPIVMG
FT                   RKTHESIGRPLPGRRNIVVTRDAARRFDGCDTVTSLDDALALAARDGAAEAFLIGGAQL
FT                   YEEGLRHADKLIVTEIDQDFEGDASFPAPDPAQWEAVSRDAHRAAQPNDFTYAFVVYRR
FT                   RRAG"
FT   gene            complement(236923..238746)
FT                   /locus_tag="BMA10247_0245"
FT   CDS_pept        complement(236923..238746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0245"
FT                   /product="sigma-54 dependent DNA-binding transcriptional
FT                   regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07041"
FT                   /protein_id="ABO07041.1"
FT                   /translation="MFPVRRAMRAACIVARTSVPRTIAHASPRRRRGSLAERLPRRPVA
FT                   SDASVASVASVASVASVASVASVASVASIASVASVASPPSRPTRIGRTLRASAPTSNSA
FT                   RRARPDTFRTTSQLRCIVPDFRPPSDCAPPGHAAQRSASPADAAARQLVYLSRTPDTTL
FT                   IAHLRARRWNVHVARSANEAARRVKPNQPQAGIADLDGFAPRELPTLEAVLRQQQVGWI
FT                   ALAGDTRINDPDVRRLIRQYCFDYMQGLPPHETIDYLVGHAYGMVALCDLDVTAGAAAT
FT                   GDEMVGACDAMQQLFRTIRKVAATDATVFISGESGTGKELTALAIHERSERRKAPFVAI
FT                   NCGAIPNHLLQSELFGYERGAFTGASQRKVGRVEAADGGTLFLDEIGDMPLESQASMLR
FT                   FLQEGKIERLGGHESIPVDVRIISATHVDLDAAMREGRFRDDLYHRLCVLKLDEPPLRA
FT                   RGKDIEILAHHILHQFRSDGARRIHGFTSCAIEAMYNYHWPGNVRELINRIRRAIVMSD
FT                   SRQLSAADLDLAPFAARQATTLAEARERAERRTIEASLLRHRNHLTEAAAELGVSRATL
FT                   YRLMVSHGLRELSWGAQRAGASDADNEAGPA"
FT   gene            complement(238987..240264)
FT                   /locus_tag="BMA10247_0246"
FT   CDS_pept        complement(238987..240264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0246"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06921"
FT                   /protein_id="ABO06921.1"
FT                   /translation="MTHPANAPLLHANATRRGDEMTALPDASHPSSRVAWPAVEPGFAA
FT                   ASVRAMPIDAAARGIARLCRAVARAVRQCVARIGRARDDCEDCEDSDAHDDRHDRGSLD
FT                   ARSEPAPMPRMTTRAATRASASRPTESKRSRLAIRRDRRHASQAAASIDRIASANPSGS
FT                   SPAPRRAGNTDLQRRSVTILALRAEAGAASDSELSEAAPKHGSLGQPAGGHDMRRALRH
FT                   GDALAHLIGIVQVVQIAGAVRATANVLVLRPPAGTLFESGIHACPGALQRPLAEAVKLA
FT                   PAICSTFAAARRRVAGGATHARWRTAAPRVPVRADRADDATAGVDARRMPATPGRAYCP
FT                   SGRCGSRRAACASAIAKASASASGRRGSGDARDVGGPAASRIAANLLHARPASAGRVTA
FT                   GAIGIIETKAAGNAGSRQDNHSPSPR"
FT   gene            complement(240261..240410)
FT                   /locus_tag="BMA10247_0247"
FT   CDS_pept        complement(240261..240410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0247"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06941"
FT                   /protein_id="ABO06941.1"
FT                   /translation="MPVPVATPRPLVDGTAVTLWDEIGPPAPMPVPTDARHTVRGDGAN
FT                   YTRQ"
FT   gene            240417..240653
FT                   /locus_tag="BMA10247_0248"
FT   CDS_pept        240417..240653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0248"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05926"
FT                   /protein_id="ABO05926.1"
FT                   /translation="MIALPRERTVIDARATFGPAACGNVLGPRIDDPIRFVFVRGRDIG
FT                   ACDGKRRSERCGNGMPSTGKAGCDSHDVSPVCR"
FT   gene            complement(240894..241190)
FT                   /locus_tag="BMA10247_0249"
FT   CDS_pept        complement(240894..241190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06893"
FT                   /protein_id="ABO06893.1"
FT                   /translation="MGIIDEMPCRNIHDATQSIDWRRAAWHRRATEPSRGLREGLGSSF
FT                   FTTTGTAFPVDRRLARKRRWSLRPFTNLCCLSVLTSMRQSKWIKSTFFQYRLQ"
FT   gene            241152..242537
FT                   /locus_tag="BMA10247_0250"
FT   CDS_pept        241152..242537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0250"
FT                   /product="sigma-54 dependent transcriptional regulator, Fis
FT                   family"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03956"
FT                   /protein_id="ABO03956.1"
FT                   /translation="MDVAARHLIYYSHRPDADLQRCFDQHGWQVDVVDSPREMRRSAAR
FT                   DVIAGGLLDFSCGIGAAELRELEASLKTPNVGWIATTRRGQMEDDAVRRLVRDYCFDYV
FT                   TVPYECDRIVESVGHAYGMVTLSEGLAPAAATVRNEGEMVGTCEAMLALFKMIRKVAST
FT                   DAPVFISGESGTGKELTAVAIHERSSRAGAPFVAINCGAIPPTLLQAELFGYERGAFTG
FT                   ANQRKIGRIEAANGGTLFLDEIGDLPFESQASLLRFLQEHKVERVGGHQSIPVDVRIIS
FT                   ATHVDMQIALRNGRFREDLYHRLCVLKLEEPPLRERGKDIEILARHMLERFKGDAHRRL
FT                   RGFTPDAIAALHNYAWPGNVRELINRVRRAIVMSEGRMISAADLELSGYAEVAPMSLEE
FT                   ARESAERHAIEVALLRHRGRLADAARELGVSRVTLYRLLCAYGMRDDDGARAKRDEGLR
FT                   RAC"
FT   gene            242594..243565
FT                   /gene="thyA"
FT                   /locus_tag="BMA10247_0251"
FT   CDS_pept        242594..243565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="BMA10247_0251"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="identified by match to protein family HMM PF00303;
FT                   match to protein family HMM TIGR03284"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06353"
FT                   /protein_id="ABO06353.1"
FT                   /translation="MKQYLDLVRTILDTGTWQSNRTGIRTIGIPGAMLRFDLQQGFPAV
FT                   TTKKLAFKSAIGELVGFLRATRSAADFRALGCKVWDANANENAQWLANPYRRGVDDLGD
FT                   VYGVQWRRWPGYKVLDAHADAQIADATSRGFRAVARFDEDGAQKVLLHKAIDQLRDCLD
FT                   TIVRDPSSRRILFHGWNPAVLDEIALPACHLLYQFLPNVERREISLCLYIRSNDVGLGT
FT                   PFNLAEGAALLTLVGRLTGYTPRWFTYFIGDAHIYENQLGMLKQQLEREPFDSPRLEIA
FT                   ERVPEYAKTGQYEPQWLERIEPSDFTLVGYRHHEPLSAPMAV"
FT   gene            243679..245160
FT                   /locus_tag="BMA10247_0252"
FT   CDS_pept        243679..245160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0252"
FT                   /product="ISBma2, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05840"
FT                   /protein_id="ABO05840.1"
FT                   /translation="MFFNGVMLKTPMPTQHELEMVTLEELVPKDHLLRQIDAAVDFEFI
FT                   RAKVAHLYCADNGRPALDPVVMFKLLFIGYLFGVRSERQLMREVQVNVAYRWFARFRLT
FT                   DKVPDASTFSQNRRRRFTDTTVYQEIFDEIVRQAIKRGLVDGRVLYTDSTHLKANANKG
FT                   KFDVVKLEQTPAAYTEALNAAVDADRAAHGRKPLDRDDDEPPSSKDTKLSRTDPDSGYM
FT                   VRDDKPKGFFYLDHRTVDAKHAIITDTHVTPASVHDSQPYLDRLDRQRERFEFKVEAVG
FT                   LDAGYFTPAVCQGLEERGIAGVMGYRTPNHKPGMFYKRQFKYDAYRNEYVCPQGQALPY
FT                   STTNRLGYREYKSNAQICGRCPVRSQCTNSAIAVKVVTRHVWERAKERVDARRLTEWGQ
FT                   RIYARRKQTVERSFADAKQLHGHRYARMRGLRKVAEQCLLAAAAQNIKKIAMLLARKRK
FT                   KGPAGPDWRFVRMLLRLVSGLRCSFDYPLAANPQS"
FT   gene            complement(245270..246664)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0253"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            complement(246734..247837)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0254"
FT                   /note="putative prolin-rich exported protein; this gene
FT                   contains a premature stop which may be the result of a
FT                   sequencing error"
FT   gene            complement(247999..248709)
FT                   /locus_tag="BMA10247_0255"
FT   CDS_pept        complement(247999..248709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0255"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05076"
FT                   /protein_id="ABO05076.1"
FT                   /translation="MPASDRHDHFPGLSHLGALLADPGRAAMLWALMDGSARPAGELTM
FT                   IAGLSPSAASAHLARLTDGGLLALDVRGRHRYYRIATPDIAAAIEALANVAQAAAPQRP
FT                   IPQPARTVPPDMRYARTCYDHMAGELAVQVYERLMSRGWLTASGGTLDATAAGAAQFAQ
FT                   WGIDIGGQRAKRRRFACTCPDWSERRPHLGGSLGAALLDSFCRRGWLEHAAKPRVLRVT
FT                   PAGQREFDALLTGG"
FT   gene            249140..249259
FT                   /locus_tag="BMA10247_0256"
FT   CDS_pept        249140..249259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0256"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06296"
FT                   /protein_id="ABO06296.1"
FT                   /translation="MVDGRWSMVDGRKVERSRGRMAERQFTATGLLRVRRRRA"
FT   gene            249273..249467
FT                   /locus_tag="BMA10247_0257"
FT   CDS_pept        249273..249467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05920"
FT                   /protein_id="ABO05920.1"
FT                   /translation="MIDRRATATRRCSTKFVPMKILVATLLAVFVCAGCASGGAGGSGA
FT                   GTGRIEMYGTIDQGVTIRN"
FT   gene            249655..250161
FT                   /locus_tag="BMA10247_0258"
FT   CDS_pept        249655..250161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0258"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06886"
FT                   /protein_id="ABO06886.1"
FT                   /translation="MPATPPAPLDRTETVFRFLAEPTSVNFGGKVHGGALMKWIDETAY
FT                   ACAAIWSSRYCVTVSVGNIRFQRPILVGNLVELKARVVATGRTSMHIHVSVHAGDPKGG
FT                   VLRQTTDCLVVFVAVDENGNPVPVPPFVPVNDEQKRLAQYAMDVRAALDKIVELKPEEV
FT                   AKGEV"
FT   gene            complement(250640..252034)
FT                   /gene="fumC"
FT                   /locus_tag="BMA10247_0259"
FT   CDS_pept        complement(250640..252034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="BMA10247_0259"
FT                   /product="fumarate hydratase, class II"
FT                   /EC_number="4.2.1.2"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00979"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05902"
FT                   /protein_id="ABO05902.1"
FT                   /translation="MSEAVRMERDTFGEIAVPAARLWGAQTQRSLQNFKISTEKQSPEL
FT                   IHALALIKRAAAAVNLELGVLAQDKANAIVAAADEIIAGRHADEFPLAVWQTGSGTQTN
FT                   MNLNEVIANRASELLGGERGESRAVHPNDDVNRGQSSNDVFPTAMHIAAARAIVDHLLP
FT                   ALRTLRATLDAKAAAFADIVKIGRTHLQDATPLTLGQEFSGYVAQLDQGIRHVEAALPH
FT                   LYELAQGGTAVGTGLNAHPKFAAGVAAEIGRLTGLPFVSAPNKFEVMAAADALVFAHGA
FT                   LKTVAASLMKIANDIRWLASGPRCGLGELSIPENEPGSSIMPGKVNPTQSEAVTMLCCQ
FT                   VFGNDVAVNFGGASGNFELNVFRPMIAHNVLQSVRLLADGAQGFNDHCAVGIEPNRARI
FT                   DALLNESLMLVTALNPHIGYDKAAQIAKKAHKEGTTLKAAALALGYVTDAQFDEWVRPE
FT                   HMVGNR"
FT   gene            252049..252222
FT                   /locus_tag="BMA10247_0260"
FT   CDS_pept        252049..252222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06561"
FT                   /protein_id="ABO06561.1"
FT                   /translation="MTGDAARARRDAHAGTEPFSRRHPLMGKHSAARDFVSCRVRWAAR
FT                   GRGNRRARGAHA"
FT   gene            complement(252418..253251)
FT                   /locus_tag="BMA10247_0261"
FT   CDS_pept        complement(252418..253251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0261"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07202"
FT                   /protein_id="ABO07202.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(253275..253538)
FT                   /locus_tag="BMA10247_0262"
FT   CDS_pept        complement(253275..253538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0262"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05098"
FT                   /protein_id="ABO05098.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            253633..253923
FT                   /locus_tag="BMA10247_0263"
FT   CDS_pept        253633..253923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0263"
FT                   /product="abc transporter, hydrophobic amino acid uptake
FT                   transporter (haat) family, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05424"
FT                   /protein_id="ABO05424.1"
FT                   /translation="MMIASEYGNVHFYMGFIPGMKAFTAAVLGGIGNLGGAMVGGVLLG
FT                   LIEQLGAGYISNLTGGVFGSNYQDVFAFVVLIIVLVFRPSGLLGERVADRA"
FT   gene            253934..255103
FT                   /locus_tag="BMA10247_0264"
FT   CDS_pept        253934..255103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0264"
FT                   /product="ABC transporter, hydrophobic amino acid uptake
FT                   transporter (HAAT) family, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06173"
FT                   /protein_id="ABO06173.1"
FT                   /translation="MTSIQPIETSASLVEERHPAKTATVGILIAAFVIAAPLVIGAAGG
FT                   NYWVRVLDFAMLYVMLALGLNVVVGFAGLLDLGYIAFYAVGAYTAALLSSPHLTSHFDW
FT                   IAQMVPGGLHVPFLLIVPIAMALAAIFGILLGAPTLRLRGDYLAIVTLGFGEIVRIFMN
FT                   NLDRPVNVTNGPQGITGIDPVQVAGFNLSQTHEIFGFSLPSVYMYYYLFVLCALLVIWA
FT                   CTRLQHSRIGRAWAAIREDEIAAKAMGINTRNVKLLAFAMGASFGGLSGAMFGAFQGFV
FT                   SPESFTFWESVVVLACVVLGGMGHIPGVILGAVLLAVFPEFLRSTMSPLQHMLFGHDIV
FT                   DTEVIRQALYGLAMVVIMLYRSEGLWPAPKHEDRIAKLAKRGGKKPVRA"
FT   gene            255166..255939
FT                   /locus_tag="BMA10247_0265"
FT   CDS_pept        255166..255939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0265"
FT                   /product="ABC transporter, hydrophobic amino acid uptake
FT                   transporter (HAAT) family, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06545"
FT                   /protein_id="ABO06545.1"
FT                   /translation="MSEQIRLSVKGVNKRFGGLQALSDVGLEIREGQIYGLIGPNGAGK
FT                   TTFFNVITGLYTPDSGEFKLDGTEYTPTAVHQVAKAGIARTFQNIRLFGGMTALENVMV
FT                   GRHVRTKHGLLGAVFQTPAERREEREIKERAIELLDYVGVLQYADYTARNLSYGHQRRL
FT                   EIARALATDPKLLALDEPAAGMNATEKVELTRLLDKIRSDGRTILLIEHDVKLVMGLCN
FT                   RMTVLDYGKVIAEGLPQDVQKNPKVIEAYLGAGVH"
FT   gene            255939..256655
FT                   /locus_tag="BMA10247_0266"
FT   CDS_pept        255939..256655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0266"
FT                   /product="ABC transporter, hydrophobic amino acid uptake
FT                   transporter (HAAT) family, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04045"
FT                   /protein_id="ABO04045.2"
FT                   /translation="MAAAMLKIKGLQVNYGGIQAVKGVDMEVRQGELVTLIGANGAGKT
FT                   TTMKAITGLKPYSAGDIEYDGQSIKGVPPHELLKRGLAMVPEGRGIFARMSIIENMQMG
FT                   AYLRNDNEQIKKDVERMFGFFPRLKERATQLAGTLSGGEQQMLAMSRAILSKPKLLLLD
FT                   EPSMGLSPIMVEKIFEVVREISKEGITVLLVEQNARLALQAADRGYVMDSGTVTMEGDA
FT                   KQMLDDPKVRAAYLGE"
FT   gene            256700..257620
FT                   /locus_tag="BMA10247_0267"
FT   CDS_pept        256700..257620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0267"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05166"
FT                   /protein_id="ABO05166.1"
FT                   /translation="MKPSRWFAVAAFSFLTGGVARFSGEGGGAKAAAVATAAGRAARLS
FT                   PTLGGARGDVRQTAFADRPIENRHAARAQCARHPRTETHMSLDYGFVKAKIKAVAGLKA
FT                   AARANETQYHVHLTLALPNGDWDVAINVGTNDADDLLKYKLVYDFHHPVTQALAAAAEG
FT                   YTDLTGGDALPALDYVRSDVLNETGGWRMSDVMDGTEHPEPIPSVLRLVDAAHQQNLDL
FT                   YVFGRTYVEGNGIHDTHMNQGSSGPHFLHRPGVDTNDHNDVWQDGALLVDLGGPQWAAY
FT                   FAAFEQQAVPTDGLGNPLPGAGPIS"
FT   gene            complement(257793..258263)
FT                   /locus_tag="BMA10247_0268"
FT   CDS_pept        complement(257793..258263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0268"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05791"
FT                   /protein_id="ABO05791.1"
FT                   /translation="MSAGMSTAIVSDDIAIRPFARADTDAALAVWRDAFPSYSDASTPH
FT                   RDPRRAIELKLATQPELFFVATAGGRVVGTVMAGYDGHRGWLYSLAVERGARRLGIGRA
FT                   LLAHAEAALAERGCPKVNLQVLPGNDDACRFYEALGYREEARISFGKRLATD"
FT   gene            complement(258268..259452)
FT                   /gene="argD"
FT                   /locus_tag="BMA10247_0269"
FT   CDS_pept        complement(258268..259452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="BMA10247_0269"
FT                   /product="acetylornithine transaminase"
FT                   /EC_number="2.6.1.11"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00707"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06541"
FT                   /protein_id="ABO06541.1"
FT                   /translation="MPLNDYPIDSLMYITNRPDIVFTHGKGSWLYDHTGKRYLDFIQGW
FT                   AVNCLGHCNEGLVQALQAQAEKLLNPSPAFYNEPMAKLAGVLTQHSVFDKVFFANSGAE
FT                   ANEGAIKLARKWGRKFRNGAYEIITFDHSFHGRTLATMSASGKAGWDTIYAPQVPGFPK
FT                   AEINDINSVERLINDKTVAVMLEPIQGEGGVIPATREFMQQLRALTKQHDLLLIVDEVQ
FT                   SGCGRAGTLFAYELAGVEPDIMTLGKGIGGGVPLAALLSKADVAVFEAGDQGGTYNGNP
FT                   LMSAAGHAVISQLVAPGFLEGVRARGEYLKHKLLELSEERGFEGERGEGLLRALLLGKD
FT                   IGPQIVEKARDMQPDGLLLNAARPNLLRFMPALNVTNDEIDQMMAMLRSVLDSL"
FT   gene            complement(259729..260760)
FT                   /locus_tag="BMA10247_0270"
FT   CDS_pept        complement(259729..260760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0270"
FT                   /product="putative CDP-6-deoxy-delta-3,4-glucoseen
FT                   reductase"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF00175; match to protein
FT                   family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05777"
FT                   /protein_id="ABO05777.1"
FT                   /translation="MAFNVTLKQSGRQFQVEADETVLAAALRQNVHLPYGCKNGACGSC
FT                   KGTIVQGQFEQGPHSASALSNDERTRGLALLCCSKPQSDLEVDVREIAGVDGVQVKKLP
FT                   CRVAALERRADDVIVLKLQLPANERLQYLAGQYIEFILKDGARRSYSMATAPHEEGPIE
FT                   LHIRHMPGGKFTDHVFGPMKERDILRFEGPLGTFFLREDSDKPIVLLASGTGFAPIKAI
FT                   IEHAHHVKLERPMTLYWGARRKKDLYLLDAAEQWAKEIPNFKFVPVLSEPDASDAWTGR
FT                   TGFVHRAVIEDLPDLSGHQVYACGAPVMVESAQRDFTQHHRLPADEFYADSFTSAADLA
FT                   HTV"
FT   gene            260789..261868
FT                   /locus_tag="BMA10247_0272"
FT   CDS_pept        260789..261868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07368"
FT                   /protein_id="ABO07368.1"
FT                   /translation="MQCAHGGYNAFLRINRYIMIATRILRRPRVLIVGCGDVGMRCAAQ
FT                   LRARRENLRILALTSRRSRCVELRAAGVVPVVGDLDARATLKRIARVAPVVLHLAPPQA
FT                   TGDVDRRTQALVAALASPRRPSRQLAPAYGRLRAWRTAARSARPPFQASAIVPDALPRP
FT                   VVVYASTSGVYGDCGGARVDETRAVRPANPRARRRVSAERQLRRATARGALSARIVRIP
FT                   GIYAANRLPLARLEKGTPALVEADDVYTNHIHADDLASILLRAAVRGKPARVVHASDDT
FT                   ELKMGDYFERVARAFGLRRPPRIARAEAERQLEPMLLSFMRESRRLANARMKRELRIAL
FT                   RYPSVDDFLRTVSAPRPLK"
FT   gene            complement(261861..262049)
FT                   /locus_tag="BMA10247_0271"
FT   CDS_pept        complement(261861..262049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04631"
FT                   /protein_id="ABO04631.1"
FT                   /translation="MTIDNPIEISSVMLAFAALGAIIIGGLLTAMHLKRKYHPNLIGAL
FT                   IGALLCFLLIEALPAIT"
FT   gene            complement(262166..262888)
FT                   /locus_tag="BMA10247_0273"
FT   CDS_pept        complement(262166..262888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0273"
FT                   /product="RNA pseudouridine synthase family protein"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06134"
FT                   /protein_id="ABO06134.1"
FT                   /translation="MDLESILFTQGFGSRRQCRALVEAGHVAVGGATCADAHASFDTTQ
FT                   LVFEVDGVAWPYRARAYVALNKPAGYECSREPQHHSSVFALLPPQFAERGVQCVGRLDQ
FT                   DTTGLLLLSDDGQFVHAYTSPKRKVPKTYVATVRHPLDDAQLDALRAGVLLHGEPKPVA
FT                   ALAAVARGERLLEMTIAEGKYHQVKRMVAAASNRVEALHRSRIGGFALPEDLAEGAWRW
FT                   LDERDLAALRDTAETLSG"
FT   gene            263036..263401
FT                   /locus_tag="BMA10247_0274"
FT   CDS_pept        263036..263401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0274"
FT                   /product="putative copper resistance protein"
FT                   /note="identified by match to protein family HMM PF04234"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05168"
FT                   /protein_id="ABO05168.1"
FT                   /translation="MTITSRARRGLAAALALALSSAAFAHAKPEKSDPPANAAVAAPQA
FT                   VSIDFTETLEPAFSSIVVVDAAGAPAQAAKAVVDASDRKRMSVALKPLQAGVYTVKWVA
FT                   LATDGHRTQGRYTFTVK"
FT   gene            complement(263413..264375)
FT                   /locus_tag="BMA10247_0275"
FT   CDS_pept        complement(263413..264375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0275"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04272"
FT                   /protein_id="ABO04272.1"
FT                   /translation="MREVNRFSEMAVFVQVIESCGFSAAGRRLDMTPSAISKFVQRLET
FT                   RLGVRLLNRTTRKLQLTPEGAAFYERCVRILEDIADAEREATHGATPQGRVRINSHVPF
FT                   GKHHLMPLLPEFQRRYPDITLDIVLSDSLVDPLDERSDIAIRSGALDDSRLVMRKLGGS
FT                   RMVVVGAPAYLERNGVPATPDDLDRHNCIGLSGNAKAWPFVAEEGQRLLPSAGNLLLGD
FT                   NESIREAAVSGLGLARLARFHVDADLDAGRLVPVLEAFNPGDEEEINAVFVGPSEHLPM
FT                   RVHALLDFLKERIRIGPRVAGERGEASALGARAFVTRLR"
FT   gene            complement(264577..265473)
FT                   /locus_tag="BMA10247_0276"
FT   CDS_pept        complement(264577..265473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0276"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06533"
FT                   /protein_id="ABO06533.1"
FT                   /translation="MNAAPDSAAMSLDIVLLRTFLEVADRRGFAPAAERLALTPSAVSG
FT                   HIKRLEQATGAVLLARTTRRVELTQAGETLYAYARNIVEMEREARARLRGSPLHGRLRI
FT                   GASEDFAGAWLPQVLHTFGRLHPRATIELKVGITAELLRQQASGRLDVVFGKHCSRLDD
FT                   EAGELLWEEPLVWAFASDAVLDANDALPLALFPQPCVYREAALAALNGALRPFRIAFES
FT                   GSMAGCISAALAGFALTVVARSQLRHGLRECGPDDALPALPAARFYAFPHRPTPAGTAL
FT                   IDAVRETGRRRGFAPKP"
FT   gene            265595..266491
FT                   /locus_tag="BMA10247_0277"
FT   CDS_pept        265595..266491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0277"
FT                   /product="alpha/beta hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05826"
FT                   /protein_id="ABO05826.1"
FT                   /translation="MPDYLFATTPLLDVAYLEWNPEGARTAVLLHGWPDSPACWSAVAP
FT                   ALADAGYRVLAPALRGFAPTRFRCAATPRSGQLAALGRDLLDFVDALRLESPVLVGHDW
FT                   GARAAANACGLRERAASHLAMLSVGYGTNDPNQPLSLLQARNYWYHWFMATPRGERAVR
FT                   DDRRAFARTMWDTWAPAGWYAPQDFDEAANAFDGPDWADVVLHSYRHRWGFASGDASYA
FT                   DDEARLNPAPVLSVPTLVLHGGADTCNHPDSSASRERFFAGRYERVVLDGVGHFPQREA
FT                   AARVAGAIVAFCSDADA"
FT   gene            complement(266694..267383)
FT                   /locus_tag="BMA10247_0278"
FT   CDS_pept        complement(266694..267383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0278"
FT                   /product="MOSC domain protein"
FT                   /note="identified by match to protein family HMM PF03473"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04595"
FT                   /protein_id="ABO04595.1"
FT                   /translation="MHPTTAKLDALLTGAIRPLAGTARTSAIDKQPVRERSWLARTGFA
FT                   GDEQADRKHHGGPDKAVHHYAFDHYPQWIAEIGPRDVLARPGAFGENLSTRGITERDVC
FT                   VGDVFTLGGATLQVSQSRQPCWKLNARFGLPKMSARVQQSGRTGWYYRVLDEGWVEPDA
FT                   ELALRERPYPQWPLSNVLDVLYRRTLDVGALEALSRIDALPPSWRQLFERRLKAGAVED
FT                   WTKRLDG"
FT   gene            complement(267398..268294)
FT                   /locus_tag="BMA10247_0279"
FT   CDS_pept        complement(267398..268294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0279"
FT                   /product="putative dihydrodipicolinate synthase"
FT                   /note="identified by match to protein family HMM PF00701"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04611"
FT                   /protein_id="ABO04611.1"
FT                   /translation="MSNLLQGIIAYPVTPFSPDGRLDTAALGALIERLIASGVHGIAPL
FT                   GSTGESAYLSDAEWEAAASASIRAVERRVPTVVGISDLTTANAVRRAKFAEQAGADAVM
FT                   VLPVSYWRLDDEAIVGHYRAIGDAIGIPIMLYNNPATSGIDMSPELIARIFRTVDNVTM
FT                   VKESTGDIKRMHRLAQLGDGAIPFYNGSNPMALAALAAGAAGWCTAAPNLNARLPLALY
FT                   DAMRASDLDTARAVFHRQLPLLQFIVSGGLPVTVKAGLRLAGFDAGEPRKPLRPLDEAR
FT                   TRELAAILDALRDTAHA"
FT   gene            complement(268376..269158)
FT                   /locus_tag="BMA10247_0280"
FT   CDS_pept        complement(268376..269158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0280"
FT                   /product="class II aldolase/adducin domain protein"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07275"
FT                   /protein_id="ABO07275.1"
FT                   /translation="MVDTLKMGKAELVALAQRRLDNEIKDSGWSAREKLALTCRILFDD
FT                   GHDSGLAGQITCRADAPHTYYTQRLGLGFDEIAESNLLQVDQDLEVIGGQGIPNPANRF
FT                   HTWIYRARPDVNCIIHTHPTHVAALSMLETPLVVSHMDTCPLHGDCAFLKDWPGVPVGN
FT                   EEGEIISNALGDKRAILLSHHGQLVVGKTIEEACMLAILIERAARLQLLAIAAGAIAPI
FT                   PPALAADAHDWISTPKRDAVTFAYYARRALRRHPDCLD"
FT   gene            269290..269853
FT                   /locus_tag="BMA10247_0281"
FT   CDS_pept        269290..269853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0281"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06464"
FT                   /protein_id="ABO06464.1"
FT                   /translation="MTIRLKLLRKQKEWTLDVLAEATGLTKSYLSKVERGLSVPSIAVA
FT                   LKLSKALQVDVEQLFSEGRDRELITVTRASERTSMGRASSERVRTYESIAAGVAPKKLL
FT                   PFIVHPPRDYVSSAFREHEGEEMLFVHRGSVEIEFPNETIKLKTGDSVYFNALIPHRMR
FT                   SVGATPAEVLVVVSNDEGVQEDAQ"
FT   gene            269952..270152
FT                   /locus_tag="BMA10247_0282"
FT   CDS_pept        269952..270152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05376"
FT                   /protein_id="ABO05376.1"
FT                   /translation="MARAARRAGSRMSRAGRRACEWSVGVADLHEEEIKRIGYARPSIA
FT                   TRPPNPMPPDPGSARFGERAF"
FT   gene            complement(270681..271514)
FT                   /locus_tag="BMA10247_0283"
FT   CDS_pept        complement(270681..271514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0283"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06836"
FT                   /protein_id="ABO06836.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(271538..271801)
FT                   /locus_tag="BMA10247_0284"
FT   CDS_pept        complement(271538..271801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0284"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05979"
FT                   /protein_id="ABO05979.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            complement(271870..273051)
FT                   /locus_tag="BMA10247_0285"
FT   CDS_pept        complement(271870..273051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0285"
FT                   /product="aminotransferase family protein"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04807"
FT                   /protein_id="ABO04807.1"
FT                   /translation="MNPSDLKPPHWALSERARKLTSSAIREILKVTERPEVISFAGGLP
FT                   SPATFPAERMREAAERVLRDSPAAALQYSATEGFLPLREWIAERYRVRTTQVLVTTGSQ
FT                   QALDLLGKVLIDPASRVLVETPTYLGALQSFSLYEPIYAQVPTDDAGLLPEALTPELTK
FT                   DARLLYAQPNFQNPTGRRLSVERRRALAAFARTSPFPVLEDDPYGALNYAGEPLPTMLS
FT                   MAPDHIVHLGTFSKVLAPGLRIGYIIAPEELHFKLVQAKQATDLHTPSLTQRIAHEVIQ
FT                   DGFLDAHIPTIRKLYGAQCEAMLASLARHMPQGVSWNRPEGGMFIWVTLPAQIDSMQLL
FT                   ETAVANNVAFVPGAPFFANDAQKNTLRLSFVTVPPEKIEEGVARLGKLLRERL"
FT   gene            complement(273112..274020)
FT                   /locus_tag="BMA10247_0286"
FT   CDS_pept        complement(273112..274020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0286"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04077"
FT                   /protein_id="ABO04077.1"
FT                   /translation="MDSRETRGMLLGLIGVVIFSLTLPMTRVVVTELHPLLNGLGRALA
FT                   ASVPAGLLLWLRRERLPTRAQLKSLAVVSAGVIVAFPVFSAWAMKTVPAAHGAVVNGLQ
FT                   PLLVALYAAWLARERPSRAFWASAVLGSALVIAFALRDGGGALQPGDLLMLVAVGIGAL
FT                   GYAQGARLAREIGGWQVICWALVVSAPFLVLPVGWLAWAHHAAHPGPVSPRVWLAFGYV
FT                   TLFSQFIGFFAWYAGLAVGGIARVGQVQLLQIFFTIAFSALFFGETVAPSTWLFAAAVI
FT                   ATVVLGRRAAVGAAPQPARAA"
FT   gene            complement(274121..274804)
FT                   /locus_tag="BMA10247_0287"
FT   CDS_pept        complement(274121..274804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07280"
FT                   /protein_id="ABO07280.1"
FT                   /translation="MAAHSLTLDHLVVAARTLEEGVAYVADTLGIEPAGGGAHPSMRTH
FT                   NRLFGLWGRAYLEVIAADPDAPAPADGRPRPRLFGLDDPATHARLEQGPYLAHWVARVD
FT                   RPRELGLWQRQYPARIARVVPMTRGDFGWRLTVPDDGALPAWQGAGDGVLPSLIQWSDA
FT                   RHPCDALPHGDVALTALKAAHPRADTVREQLVWLNAAHLLELDAGETPALVAEFDTPRG
FT                   ARTLR"
FT   gene            274955..276409
FT                   /locus_tag="BMA10247_0288"
FT   CDS_pept        274955..276409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0288"
FT                   /product="transcriptional regulator, GntR
FT                   family/aminotransferase"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06243"
FT                   /protein_id="ABO06243.1"
FT                   /translation="MSTVPLAQIPAPHDTATLTLVDQLVQWARRRIDERVFRPGMRMPS
FT                   IRKLALDKSVSRFTVVEAYERLVAQGYLDSRRGSGFYVRERAPGQQPVGASGGARAQPV
FT                   HNTIDVVWLLRNMLHTVSPEKGPGLGYLPSRWLDGELITSALRALGRQSGAQMLGFGSA
FT                   QGFLPLRQQLQTRLAEFEIGATPDQLVLVSGITQAIDLIARHCVRPGDAVIVGDPAWFQ
FT                   MFGRFASQGAQLVGMPYTPDGPDLDALENLVQMWRPKMLVINSVLHNPTGTSLSAAQAF
FT                   RILKLAEAYDFLVVEDDVYGDLCPPSYPATRLASLDQLRRVIFLGSFSKTLAANLRVGY
FT                   IACAPELAKALTDQKMLVGMTTPELNERVLYKVLTEGHYRRHVERLRARLDGVRDKTAR
FT                   MLERTGMRLFTMPAAGMFLWADTGVDSDALAAAAHEEGFLLTPGSLFSPQQSPSTWTRF
FT                   NVANCGDPALPAFLGRYLDSVNRRAS"
FT   gene            276545..278443
FT                   /gene="htpG"
FT                   /locus_tag="BMA10247_0289"
FT   CDS_pept        276545..278443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="BMA10247_0289"
FT                   /product="heat shock protein HtpG"
FT                   /note="identified by match to protein family HMM PF00183;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05662"
FT                   /db_xref="GOA:A3MHX8"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHX8"
FT                   /protein_id="ABO05662.1"
FT                   /translation="MTQQTMSFQAEVKQLLHLMIHSLYSNKEIFLRELVSNASDAADKL
FT                   RFEALENNALYESDPNLRIRLSFDKAARTITIDDNGIGMSRDEAIANLGTIARSGTKEF
FT                   FSKLSGDQQKDAALIGQFGVGFYSGFIVADRITVETRRAGLPASEGVRWESAGEGDFQV
FT                   DTIERAARGTTITLHLREGEDELLSSYRLKSIVQKYSDHVALPILMKKEEWDQEKGEMV
FT                   EKDEDETINQASALWTRAKSEVTDEQYKQFYQHVAHDHQDPLAWTHNRVEGRSEYTQLL
FT                   FVPSHAPFDLWNRDYRGGLKLYVKRVFIMDDAEQLLPQYLRFIKGVVDSSDLPLNVSRE
FT                   ILQESRDVKAIREGVTKRALSMLEELANAEDDAGKEKYKTFWSAFGQVLKEGVGEDHAN
FT                   RERVAKLLRFASTHGDTDAQDVALADYVARMKPEQTKIYYVTADTWQAAKNSPHLEVFR
FT                   KKGVEVLLLTDRVDEWMLSFLHEFDGKPLASVARGDLDLGALNDDEKKAQEETGEAMKP
FT                   VVDKMKETLGEKVKDVRVTFRLTDSPSCLVADDNDMSGYLQRMLKAAGQSAPSFQPILE
FT                   INPEHPLVKALKADGADFGDWCHLLFDQALLAEGGALEDPASFVKRTNALLLSRAA"
FT   gene            278443..279045
FT                   /locus_tag="BMA10247_0290"
FT   CDS_pept        278443..279045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0290"
FT                   /product="chorismate lyase family protein"
FT                   /note="identified by match to protein family HMM PF04345"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06889"
FT                   /protein_id="ABO06889.1"
FT                   /translation="MARMRFDAADAHWRETPRPGASSAQKDWLTRGGSLTAHLARLGRV
FT                   TVRVTRETVAAPWADEHRALSCASRAPVWVREVVLAVDGAPFVAAHSIAPLAASKGVWQ
FT                   AMRRLRTRPLAELLYSDPEVTRSALVSRRVLAGHPLFSLASLALARAYATEHAFAARRS
FT                   VFERRGTPLMVTECMLPALWRHLDAHGERRARGLEQT"
FT   gene            279045..279521
FT                   /locus_tag="BMA10247_0291"
FT   CDS_pept        279045..279521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04568"
FT                   /protein_id="ABO04568.1"
FT                   /translation="MLRGFPPVASPGTHTLILGSFPGEASLAAAQYYAHPRNQFWRLLG
FT                   AVLGEPQLHALPYDARLARVLAHGFGIWDVLAACHREGSLDAAIRHAQPNDFASLREVA
FT                   PKLTKVCFNGKTAGRFEPTIRAAGFDTLVLPSSSPANAMLSFEQKLVFWQRIVG"
FT   gene            279772..280701
FT                   /locus_tag="BMA10247_0292"
FT   CDS_pept        279772..280701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05290"
FT                   /protein_id="ABO05290.1"
FT                   /translation="MTRLIKRASAEARAFRRAKPSPFNGSEKLKPPRAKRARAQFDDDF
FT                   DLGGVAVLDEPRKPRFAPVTFSEERGVRYLHFGTEWVQGAMRLSKPYHIELEYAQQMMA
FT                   WLLFLETPKRVVQLGLGTGALTKFAHRFLPRAHVEAVELNPAVIVAARSMFELPPDDAR
FT                   LSIHEADAWDFVNDPKNRGAIGALQIDLYDATARGPVLDSVAFYRAVRACLADAGIATI
FT                   NLFGDHPSFVRNMKHLNAAFDQRVIALPEVHDGNRIALAFSGPPLSISFAQLTERAKLI
FT                   EAKLSLPARSWVKGLKASFGERAGVFTI"
FT   gene            280893..281132
FT                   /locus_tag="BMA10247_0293"
FT   CDS_pept        280893..281132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0293"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06468"
FT                   /protein_id="ABO06468.1"
FT                   /translation="MAHDADANRAAKRWLWLLVLPLVAMVWVPSYNRTEPQWFGFPFFY
FT                   WYQLLWVFVSAVITAFVYQKTKHCWKGVPRGDGK"
FT   gene            281129..282679
FT                   /locus_tag="BMA10247_0294"
FT   CDS_pept        281129..282679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0294"
FT                   /product="transporter, solute:sodium symporter (SSS)
FT                   family"
FT                   /note="identified by match to protein family HMM PF00474"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05866"
FT                   /protein_id="ABO05866.1"
FT                   /translation="MNLTATFVFVLFFVGVTIMGFLAANWRRGNLAHLDEWGLGGRRFG
FT                   TVVTWFLLGGDLYTAYTFVAVPALVFGAGAMGFFALPYTILIYPFAFVVFPKLWSIAKR
FT                   HGYVTAADFVSARYGSRSLALAVAVTGIVATMPYIALQLVGIEVVIGGLGFDTKGFIGD
FT                   LPLIIAFAILAAYTYTSGLRAPAMIAIVKDILIYITIAAAVIVIPAKLGGFGHIFGAVP
FT                   PAKLLLKAPDAASLNGFSAYTTLAIGSALALFLYPHSVTAILSSSSGNTIRRNMAMLPA
FT                   YSFVLGLLALLGYMALASGVKDMPEYAPYFKAFGPNFAVPALFLHFFPSWFVGVAFAAI
FT                   GIGALVPAAIMSIAAANLYTRNIHREFVNRNMTHDQETHVAKLVSLIVKVGAVAFILGL
FT                   PLTYAIQLQLLGGIWIIQTLPAIVLGLYTRVLDYRGLLAGWAAGLVCGTWMAISLKLAS
FT                   SIFTIHLFGHAIPGYAAVWALAVNLVVSIVVSVLVRAFGIAHAEDRTRPEDYLDVVES"
FT   gene            complement(282805..283239)
FT                   /locus_tag="BMA10247_0295"
FT   CDS_pept        complement(282805..283239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0295"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903;
FT                   match to protein family HMM PF06983"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06655"
FT                   /protein_id="ABO06655.1"
FT                   /translation="MQVQPYLFFGGRCDEALKFYGNALGARVNFLARYRDAPPNPERPT
FT                   PPEMADKVMHANFQIGNSVLMCSDGDCASGRQQAHDGYSLSLDPKTVEDGKRMFDALLA
FT                   DGGAVTMPFEKTFWALGFGMLRDKFGVHWMINVEDPDMKK"
FT   gene            complement(283605..284558)
FT                   /gene="tal"
FT                   /locus_tag="BMA10247_0296"
FT   CDS_pept        complement(283605..284558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="BMA10247_0296"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="identified by match to protein family HMM PF00923;
FT                   match to protein family HMM TIGR00874"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03953"
FT                   /db_xref="GOA:A3MHY5"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MHY5"
FT                   /protein_id="ABO03953.1"
FT                   /translation="MTTALDQLKQYTTVVADTGDFQQLAQYKPQDATTNPSLILKAVQK
FT                   DAYRPILEKTVRDHAGESVGFIIDRLLIAFGTEILKLIPGRVSTEVDARLSFDTQRSID
FT                   KGREIIKLYEAAGVGRERVLIKLASTWEGIRAAEVLQREGIRCNMTLLFSLVQAAACAE
FT                   AGAQLISPFVGRIYDWYRKQKGADWDEAQDGGANDPGVQSVRRIYTYYKHFGYRTEVMG
FT                   ASFRTTSQITELAGCDLLTISPELLQKLHDSTEAVARKLSPDEARDARLERVAIDESSF
FT                   RFQLNDDAMATEKLAEGIRLFSADAVKLEKMIEALR"
FT   gene            complement(284960..286177)
FT                   /locus_tag="BMA10247_0297"
FT   CDS_pept        complement(284960..286177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0297"
FT                   /product="benzoate transporter"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF03594; match to protein
FT                   family HMM TIGR00843"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05107"
FT                   /protein_id="ABO05107.1"
FT                   /translation="MSSQPPASNLPRAAARANFFTDTSPSALVAGFVAMMTGYTSSLVL
FT                   MFQAGRAAHLSDAQISSWIWALSIGMAVTTIGLSLRYRAPIVVAWSTPGAALLVASLPG
FT                   VAYSDAIGAFVVCALLLAAVGASGLFDTLMRRIPSGIAAALLAGILFEIGIEIFRAAQF
FT                   QTALVLAMFFTYLIVKRAAPRYAIVATLAAGVAAAGALGLLDFGRFHVALARPVFTAPS
FT                   FSIPAIVSIGIPLFVVAMASQNVPGIAVLRADGYATPSSPLIATTGIASVVLAPFGSHG
FT                   INLAAITAAICTGPEAHDDRAKRYTAAVWCGTFYLVAGVFGATIAALFGALPKALVVSV
FT                   AALALFGSIMSGLTNAMQDARQREAALVTFMVTASGLTLLSIGSAFWGLVAGVLTQAIL
FT                   NARRTA"
FT   gene            complement(286261..287436)
FT                   /locus_tag="BMA10247_0298"
FT   CDS_pept        complement(286261..287436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06278"
FT                   /protein_id="ABO06278.1"
FT                   /translation="MLIDFFYSLRAAKLPVSVKEYLTLLEALKAQVIEPSLDAFYFLAR
FT                   LTLVKDEQYFDKFDKAFGAYFHGVSALPADAFDIPLDWLEKRLQRELTPEEKAQIQALG
FT                   GPDKLMERLKQLLDEQKARHEGGNKWIGTGGTSPFGHGGYNPEGVRIGGPSNGNRTAVK
FT                   VWEARAYRDYDDSVEIGTRNIKVALRRLRRFAREGAAEELDLPGTIRSTAANAGWLDLR
FT                   MVPERHNNVKVLMLLDVGGSMDDHIKRTEELFSAAKAEFKHLEFYYFHNCVYDHLWKNN
FT                   RRRHAERTPTWDVLHKFTPDYKLIFVGDATMSPYEVLQPGGSVEYNNPEAGAVWLRRLA
FT                   DQFPHYAWLNPEPERLWEYRQSIAIIRDVLGDRMYPLTLAGLESAMRTLSK"
FT   gene            complement(287649..288491)
FT                   /locus_tag="BMA10247_0299"
FT   CDS_pept        complement(287649..288491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0299"
FT                   /product="ATPase, AAA family protein"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05515"
FT                   /protein_id="ABO05515.1"
FT                   /translation="MRFEGSSHYVATDDLKLAVNAALTLERPLLIKGEPGTGKTMLAEE
FT                   VAAALGMPLLQWHIKSTTKAQQGLYEYDAVSRLRDSQLGDERVKDIANYIVKGVLWQAF
FT                   EAQHPSVLLIDEIDKADIEFPNDLLRELDRMEFHVYETRETVRARHRPLVIITSNNEKE
FT                   LPDAFLRRCFFHYIRFPDPSTMQKIVEVHYPGIKQDLLRAALESFFELRGVSGLKKKPS
FT                   TSELLDWLKLLLAEDIPPDALRSKDQKQIVPPLAGALLKNEQDVSLFERLVYMNRHNR"
FT   gene            288725..289084
FT                   /locus_tag="BMA10247_0300"
FT   CDS_pept        288725..289084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0300"
FT                   /product="cytochrome c, class I"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06066"
FT                   /protein_id="ABO06066.1"
FT                   /translation="MNKFGKHVVVAAALAALAAGAQAAGVVGNPKDGASKAAMCIGCHG
FT                   IDGYRVAYPEVYRVPLLGGQNQVYLENALKAYRKKDRHFPSMNAIAESLTDQDIADLAS
FT                   YYAAQKPDSKNNPYK"
FT   gene            289125..289493
FT                   /locus_tag="BMA10247_0301"
FT   CDS_pept        289125..289493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0301"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06631"
FT                   /protein_id="ABO06631.1"
FT                   /translation="MKKPQTALKTAAALALAAGFAIGTAHAANVAKGKELVESHNCAAC
FT                   HGAKLDNPINAEYPRLAGQHADYLVWAMRQYQMGLTNPLLGRNNAIMQAQVQSLSIADM
FT                   KDIAAYLESLQGSLVFKK"
FT   gene            complement(289575..290795)
FT                   /locus_tag="BMA10247_0302"
FT   CDS_pept        complement(289575..290795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0302"
FT                   /product="ISBma1, transposase"
FT                   /note="identified by match to protein family HMM PF01610"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07204"
FT                   /protein_id="ABO07204.1"
FT                   /translation="MLDRKALQALGCWTGYRLERVEWPQGDSRTLSLYLKPVSQIMYCE
FT                   QCGARCQQIHETTVRRVRDLPLFEYRVVLHVPRRRVWCERCGAARLEKLDWLGRYQRVT
FT                   QRFAKACEKLLQAASVQAVAAFYELGWHTVKSIDKMRLRARVAEPDWSTIRYLAMDEFA
FT                   LHKGHRYATVVVDPIGRQVLWVGPGRSRETARAFFEQLPEGVAERIEAVAIDMTTAYEL
FT                   EIKEQCPQAEIVFDLYHVVAKYGREVIDRVRVDQANQLRHDKPARKVLKSSRWLLLRNR
FT                   HNLKPEQAVHLKELLAANQSLLCVYVLRDELKRLWFYRKPACAEKAWGQWFEQAQQSGI
FT                   AALQKFAQRLQGYWHGIVARCRHPLNTSVVEGINNTIKVIKRRAYGYRDEQYFFLKIRA
FT                   AFPGIPR"
FT   gene            complement(291299..291850)
FT                   /locus_tag="BMA10247_0303"
FT   CDS_pept        complement(291299..291850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08897"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05005"
FT                   /protein_id="ABO05005.1"
FT                   /translation="MPRRFVARSLRRAFGSPAAGGVKYALAGRCGPSHALRYIMFNPSR
FT                   DDVRRFFIDTWRKQRSGEILTPLEAMAADWIVEHPEYHAELEDAGRSAAHDYTPDEGRT
FT                   NPFLHLSMHLAISEQLSIDQPPGIRAAHEKLAARCDSAHDAQHAIMECLGETIWEAQRT
FT                   HTPPDSDAYLQRILRRASRG"
FT   gene            292296..293366
FT                   /locus_tag="BMA10247_0304"
FT   CDS_pept        292296..293366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0304"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892;
FT                   match to protein family HMM PF03151"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05556"
FT                   /protein_id="ABO05556.1"
FT                   /translation="MPFIADSSRAALRGVLYVALSAVAFGAMAIFGRYAYAGGADVLGL
FT                   LIVRFSIAGALLVAVARRRRVRWPRGRALAAIVGMGALGYVGQSLCYFSALQHAQASLV
FT                   ALLLYLYPAFVTLLAAWWLGERLTRAKAVALALCVAGSALMVGGGRGEPLGIALALGAA
FT                   VVYSLYIVVGAKAARGVDPLATVAVICCAAAAMLAMLALARAAAFDAPPHWPRAAAGWA
FT                   ALVAIALVSTVAAMLAFFAGLARLGAARTSMLSTLEPVVTVALAAELFGETLTPLQWAG
FT                   GVAILAAVLWLVRAGDAADSRGAGDDRERRRLGRRDDEPSAPGGSGAGGGLAGFVDPNE
FT                   CGIRRVRSADENARPM"
FT   gene            complement(293499..294143)
FT                   /gene="nth"
FT                   /locus_tag="BMA10247_0305"
FT   CDS_pept        complement(293499..294143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="BMA10247_0305"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01083"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06093"
FT                   /protein_id="ABO06093.1"
FT                   /translation="MNATKRRAIFETLQSLNPHPTTELEYTTPFELLIAVMLSAQATDV
FT                   SVNKAMRKMFPVANTPKKIVALGEEGVADYIKTIGLYRTKAKNVVAASRILLEQYGGEV
FT                   PAEREALESLPGVGRKTANVVLNTAFGQPTIAVDTHIFRVANRTGLAPGKDVRAVEAAL
FT                   EKLTPKEFLHDAHHWLILHGRYVCKARKPECWHCAIEPLCEYRPKTPAPMQ"
FT   gene            complement(294148..295020)
FT                   /locus_tag="BMA10247_0306"
FT   CDS_pept        complement(294148..295020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0306"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF04060; match to protein
FT                   family HMM TIGR01944"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07240"
FT                   /protein_id="ABO07240.1"
FT                   /translation="MTDSKTLADRIEDLLPQTQCTKCGYDGCRPYAEAIAAGTAGYDQC
FT                   PPGGAEGVARLAKLLGKPVIPLNQAHGVERARPVAFIDEQLCIGCTLCMQACPVDAIVG
FT                   APKQMHTIVAELCTGCDLCVPPCPVDCIAMIPVTGERTGWDAWSQQQADAARARHDARA
FT                   ARLKREREAAEARAAARRAASAAAAHAPASSAAAPAAPAADDADAKKRAIIAAALERAR
FT                   KKKEALAAQGAGPKNTEGVSAAVQAQIDAAEARRRRLAEQRDAAGEPGRPDDANAAGDD
FT                   ASPPSKTKQ"
FT   gene            295278..295910
FT                   /locus_tag="BMA10247_0307"
FT   CDS_pept        295278..295910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0307"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04050"
FT                   /protein_id="ABO04050.1"
FT                   /translation="MNQPKIKRDPEGTRRRILLAAAEEFATGGLFGARVDQIARRAETN
FT                   ERMLYYYFGSKEQLFTAVLEYAFSALMEAERAIDLEGVAPVEAITRLAHFVWDYYRDHP
FT                   DLLRLLNNENLHEARYLQKSTRIREMISPIVKTLDGVLERGQKAGLFRTDIDSLRFYVT
FT                   LSGLGYYMVSNRFTLAAIFGRDFSAQHERAEMVKMNTELLLAFLLRR"
FT   gene            complement(296053..297519)
FT                   /gene="phaZ"
FT                   /locus_tag="BMA10247_0308"
FT   CDS_pept        complement(296053..297519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaZ"
FT                   /locus_tag="BMA10247_0308"
FT                   /product="intracellular poly[D(-)-3-hydroxybutyrate]
FT                   depolymerase"
FT                   /EC_number="3.1.1.-"
FT                   /note="identified by similarity to GP:3641686; match to
FT                   protein family HMM PF06850; match to protein family HMM
FT                   TIGR01849"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04819"
FT                   /protein_id="ABO04819.1"
FT                   /translation="MLYQFHEFQRAMLSPLTAWAQAASKSFANPSSPLSLVPGATRLAA
FT                   GYELLYRLGKDYEKPEFGIHQIVKDGHNIPIVEQTIIEKPFCRLLRFKRYADDSGAVGQ
FT                   LKDEPIVLVCAPLSGHHATLLRDTVRTLLQDHKVYITDWIDARMVPAEVGSFHLDDYVG
FT                   YIQEFIRHIGARNLHVISVCQPTVPVLAAISLMASRGEDTPLTMTMMGGPIDARKSPTS
FT                   VNSLATNRSHSWFENNVIHTVPANYPGEGRKVYPGFLQHTGFVAMNPERHAQSHWDFYQ
FT                   SLLRGDEEDAEAHRRFYDEYNAVLDMAAEYYLDTIRIVFQEFRLAEGTWDIHGERVKPA
FT                   DIHSTALMTIEGELDDISGSGQTHVAHELCTGIEQAHRRSLTAEKCGHYGIFSGRRWRT
FT                   IIYPQLRDFIREHASQPKKPTPQAGSTPNSPSTPSRSASGSETASAAPAKAAALKLSAK
FT                   RTAAKTRAAKPPAAKRGAIKLAAPRTRKAA"
FT   gene            297457..297582
FT                   /locus_tag="BMA10247_0309"
FT   CDS_pept        297457..297582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0309"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04529"
FT                   /protein_id="ABO04529.1"
FT                   /translation="MCPGGQRAQHRPLEFVKLVKHASSRWENGARRRRGASRRAV"
FT   gene            complement(297584..297697)
FT                   /locus_tag="BMA10247_0310"
FT   CDS_pept        complement(297584..297697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0310"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04019"
FT                   /protein_id="ABO04019.1"
FT                   /translation="MSMRRPEMRVCCIATPRNVRYDRSRLIRFHPPNRPNC"
FT   gene            complement(297739..299571)
FT                   /locus_tag="BMA10247_0311"
FT   CDS_pept        complement(297739..299571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0311"
FT                   /product="glycosyl hydrolase, family 15"
FT                   /note="identified by match to protein family HMM PF00723"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06928"
FT                   /protein_id="ABO06928.1"
FT                   /translation="MPALIEDYALVGDGHTAALISRDGSVDWLCWPRFDSGACFAALVG
FT                   TPEHGRWLVAPADDVRVSATSRRYRGDTLILETDYECDEGAVTVIDFMPPGSGWSELVR
FT                   IVVGRRGEMRMQMQLVLRFDYGFSVPWVTRLPREAGVKAIAGPDTVVLRTPVPLSGENL
FT                   HTVAEFTVKAEERVPFSLSYAPSHLRLPPAREPLSMLARTENYWLEWSARCPLRGRYAS
FT                   AVRRSLITLKALAYEPTGGIVAAPTTSLPEQLGGTRNWDYRYCWLRDATITLLALMRGG
FT                   YYDEARAWRTWLGRVMAGSPEQIQIMYGIAGERRLPEMELDWLPGYQDSRPVRIGNNAA
FT                   NQLQLDVFGEVMSALHIARVGGLQADDTVWSVQTTLLAHLEKIWREPDEGIWETRGGRR
FT                   HFTFSKVMAWVAFDRAIKSAEMFRLSAPLERWRAIRDEIHADVCANGWNPRVRAFTQSY
FT                   GSDALDASVLMLPLVGFLPPDDPRIADTVEAIERGLMRDGLVLRYHTTEYDDGLPPGEG
FT                   TFLACSFWLVDNLALLGRIDDAHALFRRLLSLTNDLGLLAEEYDPVTRRQVGNFPQAFS
FT                   HVGLVHTAFNLMHHEEEMLRAAGQPAAADAVAGR"
FT   gene            299527..299751
FT                   /locus_tag="BMA10247_0312"
FT   CDS_pept        299527..299751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0312"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05541"
FT                   /protein_id="ABO05541.1"
FT                   /translation="MAVADESVVFDEGGHGRRSSSNPCRSRSGHVRAALYGGKHGPVYS
FT                   ADGVTRAVEAARAFTTSQHLRRIDARRFR"
FT   gene            299808..300983
FT                   /locus_tag="BMA10247_0313"
FT   CDS_pept        299808..300983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04905"
FT                   /protein_id="ABO04905.1"
FT                   /translation="MKGFALALPLFGNPAFAQDASAGPAGGVYNLLVGTYTGSGSDGIY
FT                   VYRFDTDSGQVSPVSSAKAENPSYLVASRDGRHVYAVNELPGDAGPASVRGGVSAFDFD
FT                   AKTGALKFVNRVSAQGNDPCYLSLSPDGRYLVVANYSVASDPGGSFSVFPVEATGALGA
FT                   AVLNVHHEGTGPVKGRQDGAHVHSTVFSPDGKYLFVQDLGADKLYSYRYTPDGSRGLIG
FT                   PTESRYTLAKAGSGPRHLVFGANGRFAYVTNELNASVDVYRYDDGRLAHIETVPMTAPG
FT                   FAGKVGGGALHLSPDGRFLYATNRGDANDIVIYAVNAADGKLTLVGRQSSLGKTPREFA
FT                   IDPSGKWLIVGNQDSDSVFVFRRDIASGRLEPNPARIRIDKPVDFKFVPVQ"
FT   gene            301006..301182
FT                   /locus_tag="BMA10247_0314"
FT   CDS_pept        301006..301182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0314"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04375"
FT                   /protein_id="ABO04375.1"
FT                   /translation="MSNDARPARPIGAGKDEGEGEGEGEGAGEGEGAGEDEDEDEDEDE
FT                   VPGNAGAAPASSG"
FT   gene            complement(301328..306505)
FT                   /locus_tag="BMA10247_0315"
FT   CDS_pept        complement(301328..306505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0315"
FT                   /product="putative cell division protein FtsK"
FT                   /note="identified by match to protein family HMM PF01580;
FT                   match to protein family HMM PF09397"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07286"
FT                   /protein_id="ABO07286.1"
FT                   /translation="MQTVVLGWFGFSAVWFIPLFWRLVKAALPGGGGLAGPGSIRLWLG
FT                   FVGVLTASCTLATALTGDATTNALGHALARGFEHVFGHVGTPFAMIALFVVGLPWLVGV
FT                   RWRQVNAWLDASFGIRFARERGDEEPRGVADLPRAALHRDDDRRVRRAADVQPTTAHTV
FT                   NSMAPRQNGRYARPTLWKPNDAQRGERRSASAGGAARAAAEPTAPAGWLKPGAQPRGAQ
FT                   PAAAMATGAAAAGASTAGFAKAAGAAAAVTSPAAFAPAAIGIAKPIGSTAAVAALGKRA
FT                   QARPTAPDPRFAPRRPATQAAVSAARNRPMTFTPSRQTTGATPPQPAPPAQTAAPTAET
FT                   ARKRAPANPARAPLYAWHEKPAERIAPAASVHETLRSIEASAAQWTALAGATSTAATPV
FT                   TARESIAAPAAPSGGAAASAARDGRAPTSAETAAPDGHAPTSAETVAPDGHVPTSAETA
FT                   APDGHVPTSAETAAPNDHASTSAETVAPDSHAPTSAETAAPDGHASTITEATAPNGHVS
FT                   ATVETSAVAAPAGITQAAPPIAADICPAGEHVIAAVEPACTSDSAAIGAGAIAHAEAGA
FT                   AASTAETASPIGADTHIAPSREADRTAQTAPTAPSPAEATPHVDAPHALDVAARALVGN
FT                   TAATAHGAAAVNGSAQRADTASPAASTSGPPAPVAASAASSDRAAPQPVATAAPASIAT
FT                   SGALGTMKASGTAGPQPSTIAAQRASAIDDTGQPPSTGHSTHAAVSNELGRRPHAAPDA
FT                   VTPVLPPAAAAVPTNASAVQRQALASESAEAAQGVARAAAAGDSRETTQVSPAGARPDG
FT                   AAPSAAVANPIAPLPDASAITAHEDAPTSAAPDAATPVIAAMDSAMPNAVAPASAIASN
FT                   AGMSPASASAAAPRMASAPASAAVPDAHPPLPRAAAAVPGVASIGMAAPGVIVTNAATA
FT                   LPAAPGRIASPAGASAVAPGAITPNAASTDVAPAAAPASDVSPNVVPAPAVGANASVPP
FT                   AGASSAARHVNAPMVASTGAAAPAPSIPSSLPPSTVTSNAERRATTTAPTAAPAGLAPN
FT                   PVAASSFVAPTTSAAPGQFAPAATAPADNAPAAAEAPPGRVPNPPAGAGFVTPTSPTPG
FT                   PLPPAAETPAATATPTAPPPGLAPNPPAGAGFAATPEAVAHPFGNPSAPAPGAIPESPA
FT                   TAPSVALTANGTEAPGAPQAFAPSPVPAMPAAPAAADPASAAPAAEPVRPSRPPAPNAF
FT                   EFHAPAASNVELPTLDLLEPASDTIEAISDEHLAQTGQIIEQRLQEFKVPVTVVGASAG
FT                   PVITRFEIEPALGVRGSQIVGLMKDLSRGLGLTSIRVVETIPGKTCMGLELPNAKRQMI
FT                   RLSEILASRQYQHSASQLTIAMGKDITGNPVVTDLAKAPHMLVAGTTGSGKSVAINAMI
FT                   LSLLYKATPEDVRLIMIDPKMLELSVYEGIPHLLAPVVTDMKLAANALNWCVGEMEKRY
FT                   RLMSALGVRNLASFNQKIRDAAAKEKKLGNPFSLTPEDPEPLSTLPLIVVVIDELADLM
FT                   MVAGKKIEELIARLAQKARAAGIHLILATQRPSVDVITGLIKANIPTRVAFQVSSKIDS
FT                   RTILDQMGAESLLGQGDMLFLPPGTGYPQRVHGAFVADEEVHRIVEYLKQFGEPQYEEG
FT                   ILDGPSAEGGTQDLFGEAPDAEADPLYDEAVAFVVRTRRASISSVQRQLRIGYNRAARL
FT                   VEQMEAAGLVSPMGINGSREVLAPPLPE"
FT   gene            complement(306677..307225)
FT                   /locus_tag="BMA10247_0316"
FT   CDS_pept        complement(306677..307225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03724"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05879"
FT                   /protein_id="ABO05879.1"
FT                   /translation="MFNSSAAARMRLRIARSLRAPLGALTVAALLAACTMPTHPDSGAP
FT                   APDPFNPATIQLIDDTSWELVGWRNADGSARDIPHGDNGEPIKLALSTQTGVRRAAGFS
FT                   GCNRYMGTYDVKNGVLAFGPLAGTRMACVSPARAALERDYLAALGHISKAGVQMRAPQQ
FT                   LVIITDADATLTFARRDGK"
FT   gene            307328..307702
FT                   /locus_tag="BMA10247_0317"
FT   CDS_pept        307328..307702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0317"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05239"
FT                   /protein_id="ABO05239.1"
FT                   /translation="MRFAAATHGVSCMIRRQCGAPRTIDAGGLRDAVRDGRDGSRFAAF
FT                   AAFDEIVEIVEIVASDAFAADADMTLVAGIVDMPGSRLARRDGRLRGRRAARCAAGGAP
FT                   ADGSRRVRSRPWRSRRPSAS"
FT   gene            307967..309181
FT                   /gene="purT"
FT                   /locus_tag="BMA10247_0318"
FT   CDS_pept        307967..309181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="BMA10247_0318"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /EC_number="2.1.2.-"
FT                   /note="identified by match to protein family HMM PF02222;
FT                   match to protein family HMM TIGR01142"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04876"
FT                   /db_xref="GOA:A3MI07"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MI07"
FT                   /protein_id="ABO04876.1"
FT                   /translation="MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVIAVD
FT                   RYPNAPGHQVAHRAHVIDMTDPDALRALVDAERPHLVVPEIEAIATDALAAIEAAGVCE
FT                   VIPTARATQLTMNREGIRRLAAEELGLPTSPYAFAQSFDEFAAAVARIGFPCVVKPVMS
FT                   SSGKGQSVLRSEADIEPAWRYAMAGGRVNHGRVIVEGFIRFDYEITQLTVRAIDPASGQ
FT                   TRTSFCAPIGHLQVAGDYVESWQPQPMSAKALERSRDIAHRVTSALGGRGIFGVELFVR
FT                   GDDVWFSEVSPRPHDTGLVTLASQRQSEFELHARAILGLPVEPALATPAASAVIYGGLD
FT                   EAGIAFEGVRDALAVPGADLRLFGKPESFAKRRMGVALATGANVDEARERAKRAAAAVR
FT                   PVSAR"
FT   gene            309331..309495
FT                   /locus_tag="BMA10247_0319"
FT   CDS_pept        309331..309495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0319"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05856"
FT                   /protein_id="ABO05856.1"
FT                   /translation="MKWMLIVALCASTAGCGLAAAPCRVASAGLKIVPLVGHVAAAPTD
FT                   ACAGVIDPD"
FT   gene            309512..309940
FT                   /locus_tag="BMA10247_0320"
FT   CDS_pept        309512..309940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03968"
FT                   /protein_id="ABO03968.1"
FT                   /translation="MRAARRHCLTRKKNMNRKTRAAIGVAALCAAAGAAHAARLTVEEI
FT                   DADARETVAYRCANAPKPVRVSYWRAGNGQSFALVPVNGVRLLFVDTVSASGARYQAGR
FT                   YVWWTKGRDANLYDEIAGERAPPVLADCSEVRKPRGKG"
FT   gene            309960..310121
FT                   /locus_tag="BMA10247_0321"
FT   CDS_pept        309960..310121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07374"
FT                   /protein_id="ABO07374.1"
FT                   /translation="MKRRRAFSGADRGRLRRRTAESGRAAHWRRIDAGVRGPKRHGAKH
FT                   RDGGEALR"
FT   gene            310235..310552
FT                   /pseudo
FT                   /locus_tag="BMA10247_0322"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            310566..312014
FT                   /locus_tag="BMA10247_0323"
FT   CDS_pept        310566..312014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0323"
FT                   /product="DEAD/DEAH box helicase"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05380"
FT                   /protein_id="ABO05380.1"
FT                   /translation="MSDSVAKPVDATFDQFGLAAEILKAIAEQGYTTPTPIQAKAIPVV
FT                   LSGRDVMGAAQTGTGKTASFSLPIIQRLLPQANTSASPARHPVRALILTPTRELADQVA
FT                   ANVHAYAKHTPLRSAVVFGGVDMNPQMAELRRGVEILIATPGRLLDHVQQKTANLGQVQ
FT                   ILVLDEADRMLDMGFLPDLQRILNLLPKERQTLLFSATFSPEIKKLASTYLRNPQTIEV
FT                   ARSNAAASTVTQIVYDVAEGDKQAAVVKLIRDRSLKQVIVFCNSKIGASRLARQIERDG
FT                   IIAAAIHGDRSQSERMQALDAFKRGEIEALVATDVAARGLDIAELPAVINFDLPFNAED
FT                   YVHRIGRTGRAGASGDALSLCSPNERKQLADIEKLIKRTLSLETLALDLPRHRHDDRGG
FT                   RRERDRDERRGAPAGRRSAGGERTHHPRREAPIDDFFLKPYVPSPSANQPDEAKPVQPE
FT                   KKAPKQPLAALLGGFGMPRKTSSS"
FT   gene            complement(312544..313437)
FT                   /gene="gluQ"
FT                   /locus_tag="BMA10247_0324"
FT   CDS_pept        complement(312544..313437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluQ"
FT                   /locus_tag="BMA10247_0324"
FT                   /product="glutamyl-queuosine tRNA(Asp) synthetase"
FT                   /EC_number="6.1.1.-"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR03838"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04358"
FT                   /protein_id="ABO04358.1"
FT                   /translation="MTRYRGRFAPSPTGPLHFGSLVGALASWLDARAWGGAWLVRIEDI
FT                   DGPRTVPGAAEDMLATLRGFGFIADEPPVWQSARVAHYEAALARLTAAGLVYPCGCSRK
FT                   EIADSLRAAHERHTTLAYPGTCRTGLHGKPARAWRLRVPDGAAAVVAFDDRWQRAQTQN
FT                   LATEVGDFVLKRADGQWAYQLAVVVDDGDANITHVVRGADLLDSTARQIYLQRCLGLPT
FT                   PRYLHVPVVLDANGEKLSKQTGAAALDPAAPLPALAAAARHLGLALDGAACASLDAFQA
FT                   AAIAAWDARFGPNARG"
FT   gene            complement(313481..314380)
FT                   /locus_tag="BMA10247_0325"
FT   CDS_pept        complement(313481..314380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0325"
FT                   /product="rhodanese-like domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06168"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MI14"
FT                   /protein_id="ABO06168.1"
FT                   /translation="MTTVNLAAYRFVSLDSIEQWRPLVAARCNTLGLRGTILLAPEGIN
FT                   LFIAGPREATDAFVDYIRHDPLFEGKFADLPFKESLSDSQPFRRMLVRLKREIITMKKP
FT                   AIKPELGRAPSVDARTLKAWLDQGHDDAGRPVVMLDTRNAFEVDVGTFDRALDYRIDKF
FT                   SEFPAVIEANRADLEGKTIVSFCTGGIRCEKAAIHMKDVGIENVYQLEGGILKYFEEVG
FT                   GAHYHGDCFVFDYRTALNPQLAPTADVTCFACRAVVPADAQQSPLYVPGKCCPACHPGD
FT                   SGTPGRRAEPGAEPARAV"
FT   gene            complement(314501..314731)
FT                   /locus_tag="BMA10247_0326"
FT   CDS_pept        complement(314501..314731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0326"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05774"
FT                   /protein_id="ABO05774.1"
FT                   /translation="MAGGRERIGHAANDTSVGSPFDTPTTAPSQPRGARLPGSGPGRDT
FT                   PARRRACDGAAARAEHVGRSADCEKAARFAG"
FT   gene            315002..318526
FT                   /gene="dnaE_1"
FT                   /locus_tag="BMA10247_0327"
FT   CDS_pept        315002..318526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE_1"
FT                   /locus_tag="BMA10247_0327"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P10443; match to
FT                   protein family HMM PF01336; match to protein family HMM
FT                   PF02811; match to protein family HMM PF07733; match to
FT                   protein family HMM TIGR00594"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05017"
FT                   /protein_id="ABO05017.1"
FT                   /translation="MSDPRFVHLRVHSEFSIADGIVRLDDIVKSAAEDGQGALALTDLG
FT                   NAFGLVRFYKEARDAGIKPIAGCDVWITNHDDRDKPSRLLLLVKDKRGYLNLCELLSKA
FT                   WLTNQYRGRAELDASWLEGELAEGLLALSGAQQGDIGLALAAGNEAAARRHAQRWARVF
FT                   PGGFYIELQRYGQPGAEAYIQQAVTIAAELKLPVVATHPLQYMTADDFTAHEARVCISE
FT                   GDILANPRRQKRFTTEQFFRTQGDMAALFADLPSALANTVEIAKRCNLTLELGKPKLPR
FT                   FPTPDGMSLDDYLVQLSQEGLDKRLVQLYPDEAEREAQRGKYNQRLDFECGTIKKMGFP
FT                   GYFLIVADFINWAKNNGVPVGPGRGSGAGSLVAYSLGITDLDPLRYNLLFERFLNPERV
FT                   SMPDFDIDFCQHGRDRVIQYVKEKYGADAVSQIATFGTMAAKAAVRDIGRVLDLGYMFT
FT                   DGVAKLIPFKPGKHVTIADAMKEEPLLQERYDNEDEVHQLLDLAQRVEGLTRNVGMHAG
FT                   GVLIAPGKLTDFCPLYTQGDEGGVVSQYDKDDVEAVGLVKFDFLGLTTLTILDWAERYI
FT                   RRLDPSKENWSLAQVPLDDPTSFQILKKANTVAVFQLESRGMQGMLKDAQPDRFEDIIA
FT                   LVSLYRPGPMDLIPSFCARKHGREKVDYPDPRVEPVLKETYGIMVYQEQVMQMAQIIGG
FT                   YSLGGADLLRRAMGKKKPEEMAKHREIFAEGAAKNGLTREKSDEIFDLMEKFAGYGFNK
FT                   SHAAAYALLAYYTAWLKAHHPAEFMAANMTLAMDDTDKVKILFDDCLVNGLAVLPPDIN
FT                   RSNDRFEPVAEADGKRSRTIRYGLGAIKGSGQNAIEEILRAREEKPFADLFDFCERIDR
FT                   RVVNRRTIEAMIRAGAFDSLHENRAQLLASVPLAMEAAEQAAANALQAGLFDIGGVPAH
FT                   QHALVDEPAWDDKRRLQEEKGALGFYLSGHLFDAYRDEVRRFVRQKLGELKEGRDKVVA
FT                   GVIASLRTQMTQRGKMVIALLDDGTGQCEVTVFNEQFDANRALFKEDELLIVQGQARND
FT                   AFTGGIRFTAESVMDLERARSRYAQAVRMTMNGNADAAALRRVLEAHVAKPDETPPAAA
FT                   PAPRGGRDGGRRAQAAIPNGLAVRIAYSNARAQGEMRLGDAWRVKPSDALLADLRAAFG
FT                   GSVVEIVY"
FT   gene            318629..320356
FT                   /locus_tag="BMA10247_0328"
FT   CDS_pept        318629..320356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0328"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM TIGR02203"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07343"
FT                   /protein_id="ABO07343.1"
FT                   /translation="MMRRLWPYVKPLVWVLVAGVLAMAAVAATEAGIPALLKPLLDHGF
FT                   GSKGDMTTKLYVPAAVVGLALARAIAQYASGYLLQYVSNRILLDLRIQMFERMIHTGVS
FT                   FFQRETASTVINAVVFEVNQVLSVLMGVTITLVRDSLTVVFLLGYLFYLNWRLTLIVAI
FT                   LLPCIGWLVGKINRRLRRLNREHQTLTNQLAYIVEETVGGYKVVKVHNGEPYEIGRFNE
FT                   LSRKLRGYSMRMTVSGGLAQPLTQFLASIALAVVLTIAVVQSANDQTTVGGFVAFVTAM
FT                   LLIISPLKHLMDVNQPLQRGMTAAELIFGLIDEPREPEGGGKPLARASGAIEFSHVSFS
FT                   YGMSRDGRQTLDDVSFTVAPGEMVALAGPSGSGKTTLVNLLPRFFDPSSGSVRVDGVAL
FT                   PEYSLRDLRNQIAMVSQDVVLFNDTIAANVAYGQAPERDRVEAALRAANLWETVTAMPD
FT                   GIDTLVGDNGMRLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERHVQAALETLM
FT                   KGRTTLVIAHRLSTIERADRILVLEGGKIVESGSHRELLEQGGLYAHLHRIQFQQDAG"
FT   gene            320410..321492
FT                   /gene="lgtG"
FT                   /locus_tag="BMA10247_0329"
FT   CDS_pept        320410..321492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgtG"
FT                   /locus_tag="BMA10247_0329"
FT                   /product="lipooligosaccharide glycosyltransferase G"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04594"
FT                   /protein_id="ABO04594.1"
FT                   /translation="MKIGLSCNALKYGGGLERYAIDLARGLADAGIRPSVFARSFDSSV
FT                   PEYRRVESHRINVSFLPGKCRDAWFSWRLRAARRASPVDVLIGCNRVDSSEIAICGGTH
FT                   LGFLDAIGRVPTFADRRQIALERRQYAHARFVIAHSMLMRDELLHFYGLGDDKVRVLFP
FT                   PVDAARFTPVHAVRRAELRMRFGFADDEIVLLFPSSSHERKGLPLIEAVLRDAGPGIVV
FT                   AVAGRPPERTSERLRYIGYVKDIEDGYRAADFTILASKYEPFGLVGVESVMCGTPVILP
FT                   SNIGCCDAIAPSAKLVFAPGDTAGLRAALDEAVRRTKAGAARIGSGAAAHAAIRYDPSI
FT                   ARHVAQLLDLAVEAAGDGPR"
FT   gene            321840..322919
FT                   /locus_tag="BMA10247_0330"
FT   CDS_pept        321840..322919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0330"
FT                   /product="heptosyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01075"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04777"
FT                   /protein_id="ABO04777.1"
FT                   /translation="MRRKPAHLRRILIAHHLLLGDTLLLTPLVAKLREQHPDAQIVLAC
FT                   PKAIAPLYAKRPFGVDALAFDPRDGVSVRRLLASGPYDLGIVAGDNRHSWLALGAGCRW
FT                   IVAHAGDAPGWKNWPVDELVPYPEAPAAWADFAAALVDGPAPRLYRPSDWPAPQASAPL
FT                   PAALRERPYVVLHPGASTAVKRWPSERWRELASLIEAQGYQPVWSGGPSEVEFVAQIGP
FT                   DSAQPNLAGRLGLADLWHVLAGARAVVCPDTGIAHLARLVGVPTVALFGPGNAGIHGAG
FT                   RYWRDAPFIALTIADMPCRDQPSMFRRHVAWVRRCDRSAQTCVAWRGDHADCMGRLSVD
FT                   AVHRALQNVLALAPSSSSR"
FT   gene            322916..324214
FT                   /locus_tag="BMA10247_0331"
FT   CDS_pept        322916..324214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0331"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05552"
FT                   /protein_id="ABO05552.1"
FT                   /translation="MTITTSRVERVLWIACPTLMFGVMFGHMNGVVNTTLALIGVGTLA
FT                   GILSASRPPFRQWPLVLPIVVWAAWSLASVGWSLYPRISLRAWFDEVLYPLVTFWGFWL
FT                   FGSRVKRPEWPVLVVWAACVLLALLSAFYWGHLQPPTPNTFPIRFYNRVGHTSTLVVFA
FT                   MPLFATLLLRARWRAIGAVGLVACGFVGLASLNRFFWPAAGATLVVAFYPLYRRRLGVS
FT                   IVAIAILGATALGLLEYSARERDLSASTATASASSAARDITVAGQRVYVPGELNALGDT
FT                   LSSDTRPKLWAFYTEQGKQHAWLGVGFGKPLPGHAYAADAPPLLLQIEPQALTHAHNLF
FT                   LNTWLQTGYIGVALEALLLVSLAAAFWRLRRDVPAVSAAGLALVVGMIAKNTVDDFMWQ
FT                   TTMLAFWSFAGFLLGCGERDACMARVSQNADAR"
FT   gene            324211..325473
FT                   /locus_tag="BMA10247_0332"
FT   CDS_pept        324211..325473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0332"
FT                   /product="glycosyltransferase, group 1 family"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06529"
FT                   /protein_id="ABO06529.1"
FT                   /translation="MTPPVAPPAFTAQPAETAADVARPGVRRVRILFHINDFGRGGTET
FT                   ALLAWLNALDRSAFEVGLSVTYPTADLTMWRAKAIPADVALQVLASERWMHALHQRERV
FT                   RRLRGGEKLLHKASTHALIRPAVARRFLRLARGYDVVCDFDFSLRRIAGRGGMPWIGVS
FT                   HYSFAARFGEKSAAYMARRVRQYERYTALAVLTPDMRREAESLFADTRVVVTALPNVID
FT                   PQALRARADEPADLPAGRFIVSVARLDEGQKDHRTLLRAYAQVRASRADAPRLVLLGDG
FT                   PDRGALEQLAAELGLRDAVLFAGFCANPFPYVRAADMLILSSRYEGFGMVIGEAMALGT
FT                   PVISADCPTGPRDLLDFGRAGLLVPPGAADALADAIERMLADGALRASLVAHATRKIES
FT                   FGPRAANARMQALAAQLLNRA"
FT   gene            325560..326732
FT                   /locus_tag="BMA10247_0333"
FT   CDS_pept        325560..326732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0333"
FT                   /product="lipopolysaccharide core biosynthesis
FT                   heptosyltransferase"
FT                   /note="identified by match to protein family HMM PF01075"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04253"
FT                   /protein_id="ABO04253.1"
FT                   /translation="MTLSRPPRTILVSCTRRLGDVLLTTPLVRSLKARWPDAQIDMIVF
FT                   RGTEGVLEHNPDIRRVITVAPRARPKERIADALRIWRKYDLACAAISSDRARFYAFFAG
FT                   RRRIGLVDPGRLTRLTRFILNGIVLDEHRDVHTVTSNLSLADALDVPRCADVVAPGIGD
FT                   DPAARARFDAKLYGTPALSRGEPYIVLHPYPMFRYKQWHEDGWVDLVRWARGSGFAVAL
FT                   SGGPAQAERDYAARIARAAGEPVLNMTGELSFGESAEMFRHARLFIGPDTGATHVAAAC
FT                   GVPTIALFGPSNPTRWGPWPAHWPAGDEPWPLRGSGRRGNVYLLQGEGDCVPCKLEGCD
FT                   RHLDSWSRCLSELPSARVIGVAAAMLGFDAANAPADVATPVDVSRLAARK"
FT   gene            complement(326999..327763)
FT                   /locus_tag="BMA10247_0334"
FT   CDS_pept        complement(326999..327763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0334"
FT                   /product="lipopolysaccharide core biosynthesis
FT                   glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06112"
FT                   /protein_id="ABO06112.1"
FT                   /translation="MAEPTLGVALIAYNAAARLAECLSALSFADDVIVVDGGSTDATVD
FT                   IAKAHGARVIVAADWPGFGPQKNRAVSALDTDWILSVDTDEIVTPELAASIRAAIRAPR
FT                   APVYSLDRLSSFCGTWVRHSGWYPDWLPRLFKRGAARFSDDLVHERLVFDGPSAKLDGK
FT                   LLHYSYEDFETVLRKLDAYSSAGAEQRRAAGKRGGLAKAFGRGAWAFVRTYVLRCGFLD
FT                   GRAGFMIAVFNAETVYYRFLKLGLARQRKARD"
FT   gene            328221..328601
FT                   /pseudo
FT                   /locus_tag="BMA10247_0335"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(328882..329475)
FT                   /locus_tag="BMA10247_0336"
FT   CDS_pept        complement(328882..329475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0336"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04042"
FT                   /protein_id="ABO04042.1"
FT                   /translation="MRRASPAPCLNEMETIKAFNEARRQIQESVLELFKGLSLRERLLQ
FT                   GVLMAVQAASGACLAYGIGRALHTEQAVWAAITAIAVTQHNYADTINLSRDQFIGAMVG
FT                   GLIGFAGAATGAGHFVAYAITIVTAIICCWCLNVGSAARLGAITATIVLLFPGEGPLWD
FT                   IPLVRLGEVTLGTACAMAVGWTMSRIERRWFAKR"
FT   gene            complement(329734..330981)
FT                   /locus_tag="BMA10247_0337"
FT   CDS_pept        complement(329734..330981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0337"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04789"
FT                   /protein_id="ABO04789.1"
FT                   /translation="MTVRHTVSARSLRALDWLNFFVANVQTGFGPFIASYLASHKWTQG
FT                   EIGMVLSIGTISAMVSQVPGGAAVDALKNKKGAAAWAIAAIILSAVLLAASPTVVPVIA
FT                   AEVFHGFASCMLVPAMAAISFALVGRESLGDRLGRNARWASLGSAVAAGLMGLTGEYFS
FT                   ARAVFWLTAALALPALVALAMIEPTHHHHHAAPRADEDEDEERETLRELLRDKRMLIFA
FT                   ACVVLFHLSNAAMLNLAAGEVTAGMGENVQLVIAACIIVPQAIVAMLSPWVGRSAQRWG
FT                   RRPILLLGFAALPLRALLFAGVSSPYLLVPVQMLDGISAAVFGVMLPLIAADVAGGKGR
FT                   YNLCIGLFGLAAGVGATLSTALAGFAADHFGNAMSFFGLAAAGALATLLVWFAMPETRD
FT                   AALAEDARHSSAEPAQ"
FT   gene            complement(330978..331958)
FT                   /locus_tag="BMA10247_0338"
FT   CDS_pept        complement(330978..331958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0338"
FT                   /product="putative liporotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06514"
FT                   /protein_id="ABO06514.1"
FT                   /translation="MSGGFPRSAFRLPRPVAAAAPVVLATLALSGCALFRAPQASAPVV
FT                   EAVAVPVEPASEPIAAPEPASAPEPAETAPPKKPHREAAPPRKPARVAPPAPAPAPAPA
FT                   PLVTTRAIERSQVHALLDSEVRRGGKVIGRAVDMTADANGAPREMLVNLQGFMGVGDRK
FT                   VSFPWKLFRFTPGGRHEPVILDMPATAQLQPADRPKAVPLTGSTQAGAEPGQMRIIDAD
FT                   VERPNGAKVGRVVDVLIGRDAQPQAVVLDVGGLVDPDRRTIAANWSALRFAPKDKSLRA
FT                   LLDLNDAQLKASPPYAGDKPILAVSPAAGGAPAAAPATARAGAKR"
FT   gene            complement(332271..332510)
FT                   /locus_tag="BMA10247_0339"
FT   CDS_pept        complement(332271..332510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0339"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06055"
FT                   /protein_id="ABO06055.1"
FT                   /translation="MPGIRRSAPAPRHLRLTPTVFRCRATIDAALLSRPMANLAAVTVA
FT                   AAAPRCSYGGNRRPQPNRPMKDGNRQAASGQADK"
FT   gene            complement(332641..333093)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0340"
FT                   /note="carboxymuconolactone decarboxylase family protein;
FT                   this gene contains a frame shift which may be the result of
FT                   a sequencing error; identified by match to protein family
FT                   HMM PF02627; match to protein family HMM TIGR00778"
FT   gene            complement(333587..334480)
FT                   /locus_tag="BMA10247_0341"
FT   CDS_pept        complement(333587..334480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0341"
FT                   /product="RNA polymerase sigma-70 factor, TIGR02957 family"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937;
FT                   match to protein family HMM TIGR02957"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04248"
FT                   /protein_id="ABO04248.1"
FT                   /translation="MTETSRPAPSDEPFAALRPRLFSIAYRMLGTRADAEDVLQDAWLR
FT                   WHQAERDTLDSPEAWLVTVVTRLSIDRLRAAKAQRDAYVGWWLPEPLVDIDERTPEAAA
FT                   EFADDLSVALLWVLERLSPEERAAFLLRQAFERDYAEIAQLLDKSEAACRQLVHRASTR
FT                   VQQEHRRFDVSRERHRQLVERFARAAASGERNAIRALLADDVELVGDGGGKVPSFFKVL
FT                   RGALRIANLYWAVGRRHAGQIEYRLAQINGEPGLLRFIDGRIESAQAFATDGARIVAIY
FT                   AVRNPDKLAHIPNRPA"
FT   gene            complement(334658..335080)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0342"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(335227..335520)
FT                   /locus_tag="BMA10247_0343"
FT   CDS_pept        complement(335227..335520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05728"
FT                   /protein_id="ABO05728.1"
FT                   /translation="MFEPPLPSRQIDYEGFEIHVSPTPTHTDANRYAYAGYVCHPGADP
FT                   RLPGHTVPFHADGEESFRSVDEALDEAVSIGRSIVDGTHPDLSVLSLVTHGY"
FT   gene            complement(335843..336247)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0344"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            336208..336561
FT                   /locus_tag="BMA10247_0345"
FT   CDS_pept        336208..336561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0345"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05063"
FT                   /protein_id="ABO05063.1"
FT                   /translation="MGPSDGGRDMGSTLNPDDEPREPDERSPSSGDNRTLGPSDSSDSG
FT                   SDVAGARRRPFDVDTELDNHALETGDAELDSDTDRSGTGERASADGDSTFDDSADIEPD
FT                   RTERVPRTKRGDD"
FT   gene            complement(336913..337407)
FT                   /locus_tag="BMA10247_0346"
FT   CDS_pept        complement(336913..337407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0346"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06144"
FT                   /protein_id="ABO06144.1"
FT                   /translation="MAIATRGSTEQRRVFDPIGSERPSRKSTKRRSTSAHGWPPVCSRR
FT                   CRRYLPAPPALPLPLPPPMRDARRRIVSGGPDGRARLSPCRPVRYANRDVTRRIVIHVF
FT                   AAHTLAHARASIEARIESGQFDRRGAQPQRRATRAFNACSDDGFGSRRATMDAAMRARS
FT                   G"
FT   gene            337704..338420
FT                   /locus_tag="BMA10247_0347"
FT   CDS_pept        337704..338420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0347"
FT                   /product="putative phospholipase C accessory protein"
FT                   /note="identified by match to protein family HMM TIGR03398"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07129"
FT                   /protein_id="ABO07129.1"
FT                   /translation="MKKSKALWRTAWLLAMIGVAVAGWRYVSPSQTAVAQPLKPGAASD
FT                   ERGGPPARARTDDAPAQAGPAERRLDLVALRKSLEGRDDAQAQVQRIVAFARFRDRIAA
FT                   YGEGRNSMPAEERARLAREILAELPEHVARNEIVPVQAEALSAALLADATSDSRTRDAA
FT                   IQSMRQQWDAYAGRTVGPSPASDPRYLAYARQSRDIVAQVQASVPDPDQQQAVIAQRLQ
FT                   ALRVQLFDQASRSDTR"
FT   gene            338482..339879
FT                   /locus_tag="BMA10247_0348"
FT   CDS_pept        338482..339879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0348"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07160"
FT                   /protein_id="ABO07160.1"
FT                   /translation="MEESMPVRECLECLRRLCVAGLLSAAAADGHAAVAAAQDPSIPYY
FT                   SWYEVTLPESSGASCGNGTPMRFYINRAQSDNLLYMMEPGGACWDHGTCTETATGAQAG
FT                   LGAFNPDGIPHNYVNGTVQQSLKTSFLSPLMTRMDLAHILVGEPKVETQEWTQVFVPYC
FT                   TGDIHMGSAVRSYASPSGDWRIQHYSGLKNVRVIAQWLVDHGFGKPSRLLVYGTSAGGY
FT                   GTLGNYATLRGTLQPQSHSSLLDDAGTVFNTRFGADPAAYPSVGLYDKVRDEWGMTAPD
FT                   GMITVNSRLTRYFDPGNMGSAYAALSATYPHDRFGYTTYRRDRIIAAYHYRPFVPAVIA
FT                   APDDATKDALSLAMFDRELSDLKQVLNPLPNFGYFIPWARDDFMGNHQVTAVSFTGSGI
FT                   HENGIDADVGTFVADLLNQQDPADVPVMKAYRTEQWSDFTFSTFLAWLDSIFNLTGEAG
FT                   PISGHRS"
FT   gene            complement(339907..341295)
FT                   /locus_tag="BMA10247_0349"
FT   CDS_pept        complement(339907..341295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0349"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM TIGR00801; match to protein
FT                   family HMM TIGR03173"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07170"
FT                   /protein_id="ABO07170.1"
FT                   /translation="MQPAPLARPASHGADAAESAHDLVYGPDERPAPMIACVAALQHLL
FT                   AILVPIVTPGLLICQALGVSSRDTTLIVSMSLVISGIATFVQCRRFGPLGAGLLIVQGT
FT                   SFNFVGPLIAGGSLMVKQGTPVETVMAAIFGVVIAGSFVEMAVSRILPFVKRLITPLVT
FT                   GVVVLLIGLTLIKVGLVSMGGGYGAIAKGSFGSAQNLTLSGLVLGAIIVLNRVPIVWVR
FT                   STALVIALAIGYLAAAAMGRLDFTGAREAALFQIPTPLHFGLGFSWALFVPMLIIYLVT
FT                   SLEAIGDVTATSKISRQPVEGPLWMRRIKGGVLVNGANSLLAGVFNTFPSSVFAQNNGV
FT                   IQLTGIASRHVGIWIAGMLVLLGLFPVVAGVLQAVPEPVLGGAAMVMFGAVAASGINIL
FT                   AGIRLDRRALLIIAVSLALGLGVSQAPEILTNLPHALGNVLESGVATGGICALVMNWFL
FT                   PEKQ"
FT   gene            341260..341550
FT                   /locus_tag="BMA10247_0350"
FT   CDS_pept        341260..341550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06725"
FT                   /protein_id="ABO06725.1"
FT                   /translation="MGSGAGEGGGLHRERAGAVERRNFNGSGGGGLPSRVRGLAARVFD
FT                   ESRRLEKARAARAHRGIRMSRAICPDNSGEPHVDQAGEDRRIPRIGLMRAG"
FT   gene            complement(341613..343079)
FT                   /locus_tag="BMA10247_0351"
FT   CDS_pept        complement(341613..343079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0351"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /EC_number="3.1.4.-"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM TIGR00757"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05922"
FT                   /protein_id="ABO05922.1"
FT                   /translation="MNEEILINITPQETRVALVQQGAVQELHVERTLSRGRVGNVYLGK
FT                   VVRVLPGMQSAFIDIGLERAAFLHVADIWQPRAGDAPAAATHQPIEKIVFEGQTLMVQV
FT                   IKDPIGTKGARLSTQISIAGRTLVYLPQEPHIGISQKIESEAEREAVRARLTAVIPSDE
FT                   KGGYIVRTIAEDATSDELAADVAYLRKTWATIVAQGQRVPPTSLLYQDLDLAQRVLRDF
FT                   ANDDTTRIQVDSRETHQRLVEFAAEFTPAVSPKLHHYTGKRPLFDLYNIEAEIQRALSR
FT                   RVDLKSGGYLMIDQTEAMTTIDVNTGGYVGARNFDDTIFKTNLEAAHTIARQLRLRNLG
FT                   GIIIIDFIDMENAEHRDAVLAELKKALSRDRTRVTVNTFSQLGLVEMTRKRTRESLAHV
FT                   LCEPCPTCQGKGQVKTSRTVCYDILREILRESRQFNPREFRVIASQQVIDLFLDEESQH
FT                   LAMLIDFIGKPVSLQVESNLSQEQYDIVLM"
FT   gene            complement(343088..343717)
FT                   /gene="maf_1"
FT                   /locus_tag="BMA10247_0352"
FT   CDS_pept        complement(343088..343717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf_1"
FT                   /locus_tag="BMA10247_0352"
FT                   /product="septum formation protein Maf"
FT                   /note="identified by similarity to SP:Q02169; match to
FT                   protein family HMM PF02545; match to protein family HMM
FT                   TIGR00172"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05414"
FT                   /protein_id="ABO05414.1"
FT                   /translation="MPEHAAPSYPFVYLASQSPRRRELLDQLGVRYELLAPAPDEDAEA
FT                   LEAELPGEAPDHYVLRVCVAKAQAARARLVARGLPAAPVLVADTTVTIDGAILGKPADA
FT                   ADALAMLARLAGRTHDVLTALAVIDATGELMPPALSRSAVRFAPAAREALARYVETGEP
FT                   FGKAGAYAIQGRAAEFVERIDGSHSGIMGLPLFETAALLRAAHVAF"
FT   gene            complement(343770..344240)
FT                   /locus_tag="BMA10247_0353"
FT   CDS_pept        complement(343770..344240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0353"
FT                   /product="conserved hypothetical protein TIGR00246"
FT                   /note="identified by match to protein family HMM PF02590;
FT                   match to protein family HMM TIGR00246"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04098"
FT                   /db_xref="GOA:A3MI42"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MI42"
FT                   /protein_id="ABO04098.1"
FT                   /translation="MKLHIVAVGHKMPGWIASGFDEYAKRMPPELRIELREVKPELRSG
FT                   SRTADSVMAAEQQRIEAALPKNARVVALDERGRDWTTMQLAQALPAWQQDGRDVAFVIG
FT                   GADGLAPALKSRAELLLRVSSLTLPHGMVRVLLAEQLYRAWSITQNHPYHRA"
FT   gene            complement(344297..344761)
FT                   /locus_tag="BMA10247_0354"
FT   CDS_pept        complement(344297..344761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0354"
FT                   /product="iojap domain protein"
FT                   /note="identified by match to protein family HMM PF02410;
FT                   match to protein family HMM TIGR00090"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05390"
FT                   /protein_id="ABO05390.1"
FT                   /translation="MDIRKLQRVIVDALEDVKAQDIKVFNTSHLTELFDRVIVASGTSN
FT                   RQTKALASNVRDKVKEAGGDIVSSEGEDTGEWVLVDCGDAVVHILQPALRQYYNLEEIW
FT                   GDKPVRMKLGGPAAHARGARAADGADDDESDEHETPAARPARKATAARRR"
FT   gene            complement(344766..345518)
FT                   /gene="nadD"
FT                   /locus_tag="BMA10247_0355"
FT   CDS_pept        complement(344766..345518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="BMA10247_0355"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR00482"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05075"
FT                   /protein_id="ABO05075.1"
FT                   /translation="MSRAATGRAAAPQGPTPNAEPAGLPALPRRIGILGGTFDPIHDGH
FT                   LALARRFAHVLRLTELVLMPAGQPYQKQDVSAAEHRLAMTRAAAASLVLPGVAVSVATD
FT                   EIEHAGPTYTVETLARWRERIGDRASLALLIGADQLVRLDTWRDWRRLFDFAHVCAATR
FT                   PGFDFTAASPAVAAEIASRQASADVLQATPAGRLLIDTTLSLDVAATDIRAHLRACIAR
FT                   RAQVPDASAEHVSPAVWAYILQHRLYHP"
FT   gene            complement(345515..346438)
FT                   /gene="hemF"
FT                   /locus_tag="BMA10247_0356"
FT   CDS_pept        complement(345515..346438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="BMA10247_0356"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /EC_number="1.3.3.3"
FT                   /note="identified by match to protein family HMM PF01218"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07246"
FT                   /db_xref="GOA:A3MI45"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MI45"
FT                   /protein_id="ABO07246.1"
FT                   /translation="MTDSTYDVNRVRAYLQGLQMRIADALGAFDGTPLAADTWRRGPGE
FT                   RLRGGGCTRILEAGGFFERAGIGFSDVAGDALPPSANASRPQLAGRGFEALGVSLVLHP
FT                   RNPYCPTVHMNVRMLIATKPGEAPVFWFGGGMDLTPIYGFEEDARHFHRTCRAALEPFG
FT                   AELYPRFKKWCDDYFFLKHRNEARGIGGIFFDDFSELGFERSFEMLQSVGDAFLPSYLP
FT                   IVERRRDTPYGERERAFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILLSMPPTAGW
FT                   RYDWHPDPGTPEARLQSEFLVPRDWA"
FT   gene            complement(346569..347846)
FT                   /gene="purD"
FT                   /locus_tag="BMA10247_0357"
FT   CDS_pept        complement(346569..347846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BMA10247_0357"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02843; match to protein
FT                   family HMM PF02844; match to protein family HMM TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06449"
FT                   /protein_id="ABO06449.1"
FT                   /translation="MKLLVVGSGGREHALAWKLAQSPRVQLVYVAPGNGGTAQDERLKN
FT                   VDLSSLDDLADFAESEGVAFTLVGPEAPLAAGIVNHFRARGLKIFGPTKEAAQLESSKD
FT                   FAKAFMKRHGIPTADYETFTDAAAAHAYVDSKGAPIVVKADGLAAGKGVVVAMTLEEAH
FT                   AAVDMMLSGNKLGDAGARVVIEAFLDGEEASFIVMVDGKHALALASSQDHKRLLDEDRG
FT                   PNTGGMGAYSPAPIVTPQMHARVMREIIMPTVRGMEKDGIRFTGFLYAGLMIDRDGNPR
FT                   TLEFNCRMGDPETQPIMARLKSDFSKVVEQAIAGTLDTVELDWDRRTALGVVLAAHGYP
FT                   DAPRKGDRINGIPAGTAHAVTFHAGTTFDGDKLVTSGGRVLCVVGLADSVRGAQQAAYE
FT                   TINQINFEGMQYRRDIGYRALNRKTV"
FT   gene            complement(347957..348685)
FT                   /locus_tag="BMA10247_0358"
FT   CDS_pept        complement(347957..348685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0358"
FT                   /product="conserved hypothetical protein TIGR01033"
FT                   /note="identified by match to protein family HMM PF01709;
FT                   match to protein family HMM TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05803"
FT                   /db_xref="GOA:A3MI47"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MI47"
FT                   /protein_id="ABO05803.1"
FT                   /translation="MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDVNS
FT                   NPRLRLAVDKAADANMPKDNVKRAIDRGVGGADGANYEEIRYEGYGIGGAAIIVDTLTD
FT                   NRTRTVAEVRHAFSKFGGNMGTDGSVAFMFDHVGQFLFAPGTSEDALMEAALEAGANDV
FT                   NTNDDGSIEVLCDWQEFSKVKDALEAAGFKAELAEVTMKPQNEVDFTGEDAVKMQKLLD
FT                   ALENLDDVQEVYTNAVVVEE"
FT   gene            complement(348648..349232)
FT                   /locus_tag="BMA10247_0359"
FT   CDS_pept        complement(348648..349232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06555"
FT                   /protein_id="ABO06555.1"
FT                   /translation="MPAVPARDYPRARRAANHPGATRGRASGIGHRASGVGVGRRASGV
FT                   GRRASGVGRRASGVGRRASGVGRRASGVGRRASGVGRRASGVGRRASGVGRRASGVGRR
FT                   ASGVGRRASGVGRRASGVGRRASGVGRAPAGARPRDKISFHSTTRGPSGTRPLKRPPDS
FT                   TTDTLLDAGAGYARAHGEKYGWSLEMGQHQA"
FT   gene            complement(349271..349921)
FT                   /gene="upp"
FT                   /locus_tag="BMA10247_0360"
FT   CDS_pept        complement(349271..349921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="BMA10247_0360"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01091"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04783"
FT                   /db_xref="GOA:A3MI49"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MI49"
FT                   /protein_id="ABO04783.1"
FT                   /translation="MKQDSRFPNLFILDHPLIQHKLTHMRDKDTSTRTFRELLREITLL
FT                   MGYEITRNLPITTKRVETPLVEIDAPVIAGKKLAIVPVLRAGVGMSDGLLELIPSARVG
FT                   HIGVYRADDHRPVEYLVRLPDLEDRIFILCDPMVATGYSAAHAIDVLKRRGVPGERLMF
FT                   LALVAAPEGVQVFQDAHPDVKLYVASLDSHLDDHAYIVPGLGDAGDRLFGTKN"
FT   gene            350179..350958
FT                   /locus_tag="BMA10247_0361"
FT   CDS_pept        350179..350958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0361"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05537"
FT                   /protein_id="ABO05537.1"
FT                   /translation="MDLGIAGRTALVCAASKGLGRGCAQALAAEGARLVIVARTRETLE
FT                   AAAADIRAATGADVTAVACDITTPEGRAAALAACPQPDILVTNAGGPPPGDFRDFTHDD
FT                   WIRALEANMLTPIELIRASVDGMIARRFGRVVNITSSAVKAPIDVLALSNGARSGLTGF
FT                   VAGLARKVAEHNVTINNLLPGLFDTDRIATTLAAAAQAQGATVDELRARRTKEIPAKRL
FT                   GTPHEFGAACAFLCSVHAGYITGQNWLLDGGAYPGTF"
FT   gene            351196..351588
FT                   /gene="mgsA"
FT                   /locus_tag="BMA10247_0362"
FT   CDS_pept        351196..351588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgsA"
FT                   /locus_tag="BMA10247_0362"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="identified by match to protein family HMM PF02142;
FT                   match to protein family HMM TIGR00160"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06302"
FT                   /db_xref="GOA:A3MI51"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MI51"
FT                   /protein_id="ABO06302.1"
FT                   /translation="MSTPRIALIAHDAKKDDIVALAGAYRATLAQCRLVATGTTGGRIA
FT                   QAHGLDVERKLSGPLGGDLQIGAELADGRVDIVIFLRDPMTAQPHDPDITALVRACDVH
FT                   DVPVATNVATARVLLDDLARRLTANA"
FT   gene            352419..353393
FT                   /gene="qor_1"
FT                   /locus_tag="BMA10247_0363"
FT   CDS_pept        352419..353393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor_1"
FT                   /locus_tag="BMA10247_0363"
FT                   /product="NADPH:quinone reductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="identified by similarity to SP:P43903; match to
FT                   protein family HMM PF00107; match to protein family HMM
FT                   PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07097"
FT                   /protein_id="ABO07097.1"
FT                   /translation="MPKAIRYDQPGGPEVMKWVDIDVGAPQPGEVRIKQHAVGLNYIDV
FT                   YFRTGLYPQPLPGGLGMEAAGEVTELGEGVTALKPGDRVAYVAQPPGAYAQERVLAAAK
FT                   LVKLPEAIGYEDAASAMLQGLTAQYLLRRTYKVEPGDTIVIHAAAGGVGLLVCQWAKAL
FT                   GATVIGTVGSDEKAALAKAHGCDHPIVYTRENFTERVKEITNGAGVPVVYDSIGKDTYI
FT                   GSLDCLAPLGMFVSFGNASGPLPPIDSKEFSSRGSLFFTRPTLFSYIAKREDLDRNAAE
FT                   LFDVLASGRVKTSIRQRYPLENVAQAHRDLEARRTTGSTVLLP"
FT   gene            353399..353689
FT                   /locus_tag="BMA10247_0364"
FT   CDS_pept        353399..353689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0364"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06297"
FT                   /protein_id="ABO06297.1"
FT                   /translation="MRPRARRGRARARIARRVPARSPAARERASAARAGIRCVAFARAG
FT                   ISARERRSLDRATRAGAAPPFPSERGAATRVRRARRAPPAFTRFLHPPANL"
FT   gene            353819..353950
FT                   /gene="kdpF"
FT                   /locus_tag="BMA10247_0365"
FT   CDS_pept        353819..353950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpF"
FT                   /locus_tag="BMA10247_0365"
FT                   /product="potassium-transporting ATPase, KdpF subunit"
FT                   /note="identified by match to protein family HMM PF09604"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07331"
FT                   /protein_id="ABO07331.1"
FT                   /translation="MREACAIRSRGAFMSWMLWLAGASTFLLFAYLVYALLRAEDIE"
FT   gene            353947..355755
FT                   /gene="kdpA"
FT                   /locus_tag="BMA10247_0366"
FT   CDS_pept        353947..355755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="BMA10247_0366"
FT                   /product="K+-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF03814;
FT                   match to protein family HMM TIGR00680"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06528"
FT                   /protein_id="ABO06528.1"
FT                   /translation="MNANNLLQAAIFIVVLIAAAVPVARYLTRVMDGSSAVVRVFGPLE
FT                   RALYRLAGIDPLTEMSWKQYALATVAFNALGVLFLYALLRVQGWLPGNPQGFGPMTVDG
FT                   ALNTAVSFVTNTNWQDYTPEQTVSYLAQMLGLTVQNFLSAATGIVVVLALIRGFARHTA
FT                   QTIGNFWVDVTRVTLYVLVPMAAIIAALLMSQGVIQNTKAYQDVPTLQTTSYAAPRLDA
FT                   QGNPVKDAKGNPVTVQTSVKAQTLAMGPVASQEAIKMLGTNGGGFFNGNSSHPYENPTP
FT                   FSNFLEIFAILIIPAALCLVFGNTIGDRRQGVAVLAAMTVALAAAIGIETSAEQGGTPV
FT                   LASLNVDQAASPLQAGGNMEGKETRFGIAQTGLFVVATTAASCGAVDAMHDSLTPVGGL
FT                   VPMLLMQLGEVIFGGVGSGLYGMLVFALLAVFVAGLMIGRTPEYVGKKIESYEMKMVSI
FT                   VVLLTPLLVLVGTSIAVLADAGRAGIANPGPHGFSEILYAFSSAANNNGSAFGGLSVNT
FT                   PFYNWMTAIAMWFGRFGTIVPVLAIAGSLAAKKRIAATSGTLPTHGPLFVVLLLGTVLL
FT                   VGALTYMPALALGPGVEHLMLFVGAH"
FT   gene            355824..357902
FT                   /gene="kdpB"
FT                   /locus_tag="BMA10247_0367"
FT   CDS_pept        355824..357902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="BMA10247_0367"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01497"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04047"
FT                   /protein_id="ABO04047.1"
FT                   /translation="MTQHSATRSMFDPALVRPAIVDSFKKLTPRTQLRNPVMFCVYVGS
FT                   ILATILWIAALTGQAEAPAGFILAVALWLWFTVLFANFAEAIAEGRSKAQAASLRSAKK
FT                   DVMAKKLNEPHPKSPVRIMTASDLRRGDVVLVEAGDTIPADGEVIEGVASVDESAITGE
FT                   SAPVIRESGGDFSSVTGGTRVLSDWIVVKVTANPGEAFLDRMIAMVEGAKRKKTPNEIA
FT                   LTILLVALTIVMLLATATLLPFSMFSVDAMHSGHVVTITALVALLVCLIPTTIGGLLSA
FT                   IGVAGMSRMMQANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASAFLPAPEVTEAT
FT                   LADAAQLSSLADETPGGRSIVVLAKERFNIRQRDMGALHAVFLSFSAHTRMSGVDLSPE
FT                   REIRKGAADAVKKYVESHGGRFPAEVTNAVTDVARRGSTPLVVAEKRGALARVLGVIEL
FT                   KDIVKGGIKERFAELRKMGIKTVMVTGDNRLTAAAIAAEAGVDDFLAEATPETKLSTIR
FT                   EHQAAGRLVAMTGDGTNDAPALAQADVAVAMNTGTQAAKEAGNMVDLDSNPTKLIEIGK
FT                   QMLMTRGSLTTFSIANDIAKYFAIIPAAFATTYPQLNALNVMHLATPASAIMSAVIFNA
FT                   LIIVLLIPLALKGVKYRPLGAATLLRRNLLVYGLGGILVPFVGIKLIDVVLAALGWV"
FT   gene            357915..358496
FT                   /gene="kdpC"
FT                   /locus_tag="BMA10247_0368"
FT   CDS_pept        357915..358496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="BMA10247_0368"
FT                   /product="K+-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF02669;
FT                   match to protein family HMM TIGR00681"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05434"
FT                   /db_xref="GOA:A3MI57"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MI57"
FT                   /protein_id="ABO05434.1"
FT                   /translation="MKSLFRPLIVVFVVLVAVTGLAYPAVMTVFGQAVFPAQANGSLIE
FT                   KGGRVVGSALIGQQFDAPQYFWGRLSATSPMPYNAAGSGGSNLGPLNPALKDQVKSRLD
FT                   ALKAAGTDLSQPVPVDLVTASASGLDPEISPAAADYQVARVARARKMADADVRRLVADH
FT                   TSGRQFGVLGEPRVNVLKLNLALDAAQAAH"
FT   gene            complement(358542..358745)
FT                   /locus_tag="BMA10247_0369"
FT   CDS_pept        complement(358542..358745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0369"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06358"
FT                   /protein_id="ABO06358.1"
FT                   /translation="MSFENAREGKDSAAGAPSGVRAGASSPMRAAEFAALRPACVPARA
FT                   FIRVLVRAFAAMHGAPPPGGAP"
FT   gene            358897..361761
FT                   /pseudo
FT                   /locus_tag="BMA10247_0370"
FT                   /note="sensor protein KdpD; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00512; match to
FT                   protein family HMM PF00582; match to protein family HMM
FT                   PF02518; match to protein family HMM PF02702"
FT   gene            361748..362452
FT                   /gene="kdpE"
FT                   /locus_tag="BMA10247_0371"
FT   CDS_pept        361748..362452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpE"
FT                   /locus_tag="BMA10247_0371"
FT                   /product="DNA-binding response regulator KdpE"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07055"
FT                   /protein_id="ABO07055.1"
FT                   /translation="MPMSEPTVTVVLIEDEKQIRRFVRSALEEEGIAVFDAETGRQGLI
FT                   EAATRKPDLAIVDLGLPDGDGLDVIRELRGWSEMPVIVLSARTHEEEKVAALDAGADDY
FT                   LTKPFGVSELLARIRAHLRRRNQAGAAESPVVRFGDVSVDLALRRVWRGGEVVHLTPLE
FT                   YRLLATLVRHAGRVLTHRQLLRDVWGPTHVESHHYLRIYMAHLRQKLEADPAQPQHIVT
FT                   ETGVGYRLVGAG"
FT   gene            362834..363130
FT                   /pseudo
FT                   /locus_tag="BMA10247_0372"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF03891"
FT   gene            363346..363666
FT                   /gene="sugE"
FT                   /locus_tag="BMA10247_0373"
FT   CDS_pept        363346..363666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="BMA10247_0373"
FT                   /product="sugE protein"
FT                   /note="identified by match to protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04289"
FT                   /protein_id="ABO04289.1"
FT                   /translation="MPWLWLLVAGLLEVAWAAGLKSSEGFTRLGPSVFTIVTALGSFGL
FT                   LAVAMRELPLGTAYAVWTGIGAVGAFIFGIVMLGEAVTLARIASASLIVAGLVGLKLSS
FT                   AG"
FT   gene            363858..364475
FT                   /locus_tag="BMA10247_0374"
FT   CDS_pept        363858..364475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0374"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:DR2371"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05049"
FT                   /protein_id="ABO05049.1"
FT                   /translation="MVEAISLGAGLAWASGLRLYLTVLIAGVFARAGFIHLPDTLAVLT
FT                   SPWVIGSAAVLAVAEFLADKVPAFDSLWDAVHTFIRIPAGAVLAAASLGHADPALLVVA
FT                   GLAGGTLAGSAHIAKAGTRALINLSPEPISNWIASTTEDGLTVGGLVLAFFVPLLFLAL
FT                   MIGFLAFSAWALPRLWRGVSGGFRGMANHMVSRLNSIGSKRD"
FT   gene            364472..365335
FT                   /pseudo
FT                   /locus_tag="BMA10247_0375"
FT                   /note="efflux ABC transporter, permease protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error"
FT   gene            365332..367041
FT                   /pseudo
FT                   /locus_tag="BMA10247_0376"
FT                   /note="ABC lysophospholipase exporter, fused innermembrane
FT                   subunits, FtsX; this gene contains a frame shift which may
FT                   be the result of a sequencing error; identified by match to
FT                   protein family HMM PF02687"
FT   gene            367038..367160
FT                   /pseudo
FT                   /locus_tag="BMA10247_0377"
FT                   /note="putative globin; this gene contains a frame shift
FT                   which may be the result of a sequencing error"
FT   gene            367141..367551
FT                   /locus_tag="BMA10247_0378"
FT   CDS_pept        367141..367551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0378"
FT                   /product="protozoan/cyanobacterial globin family protein"
FT                   /note="identified by match to protein family HMM PF01152"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05610"
FT                   /protein_id="ABO05610.1"
FT                   /translation="MIDVTDDAPSPPTAFELVGGEARVRELVDRFYDLMDLEPEFAGIR
FT                   ALHPPTLEGSRDKLFWFLCGWLGGPDHYIERFGHPRLRARHLPFPIASSERDQWLRCIA
FT                   WAMQDVGLDEPLRERLMHSFHDTADWMRNRPG"
FT   gene            367662..368393
FT                   /locus_tag="BMA10247_0379"
FT   CDS_pept        367662..368393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0379"
FT                   /product="threonyl and alanyl tRNA synthetase domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF07973"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04730"
FT                   /protein_id="ABO04730.1"
FT                   /translation="MATQALFREDAYLTRCDALVTAVDEAGIHLDRTVFYPLGGGQAGD
FT                   SGTLTLAGGAALAVADTRKAKFDGATPDDAVHVLAPGQAALAAGVKPGDALVAEIDWAP
FT                   RHRRMRLHTASHLLCAVLPYPVDGCSVTADYVRIDFATVEPIDREHVQARLAELVGGAH
FT                   PVTTEWITDDEMVARPELVRTMSVKPPMGLGRVRLLRIEGVDLQPCGGTHVRNTAEIGA
FT                   LRVAKLEKKSARTRRLVLELA"
FT   gene            368390..369031
FT                   /locus_tag="BMA10247_0380"
FT   CDS_pept        368390..369031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06041"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05798"
FT                   /protein_id="ABO05798.1"
FT                   /translation="MTAPHASDGAREAAARERAALDSRAREVLDFWFGAPDDPAFGTAR
FT                   PMWFGGAPALDAQLRERFGALADAAKAGELDAWAGTPLGALALIVVLDQFPRNIHRGTP
FT                   LAFAADRAALAHAKALVASGGDRALPTGHHRAFAYLPFEHDESPDSQREAVRLCAQIKD
FT                   EAGCAGYHDYALRHAVVIERFGRFPHRNAILGRASTDAEAAFLKEPGSSF"
FT   gene            369375..370769
FT                   /locus_tag="BMA10247_0381"
FT   CDS_pept        369375..370769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0381"
FT                   /product="amidase family protein"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05034"
FT                   /protein_id="ABO05034.1"
FT                   /translation="MSELLDLSACSLAERFKNRSVTPVDYAHALLDHIARWEPHLNALC
FT                   RFDPARVRDEALASTRRWAAGASLSEIDGVPVTIKELIATQGDRVAQGSAAAADAPPAT
FT                   VDALAAARLREAGAVVIGKTTVPDYAMLSSGLSSLYGITRNPWRLDLNPGGSSSGAAAA
FT                   AAAGYGPLHVGTDIGGSIRLPAGWCGIVGFKPSNGRIPIEPYYTGRCAGPMTRTIDDAA
FT                   LLMRFLSRPDWRDATSLPPETIDWSIAPAHVKGMRIGLMLDAGCGLAPDPQIVAAVEAA
FT                   AERFAAHGARIVAAPPVLSRPMLEGLDRFWRARLWADLERLPDAARARILPYIAEWAGQ
FT                   GASVSGVEAVRGFGATFEMRAAAARLFQSVDAVLSPTNVVTGFPAEWAGPTDDPARPFE
FT                   HIAFTVPWNMGEQPALSINCGFARDGMPIGQQIVGPRFADRLVLQLGRAYEAWRGEMPR
FT                   WPAPPR"
FT   gene            complement(370822..372042)
FT                   /locus_tag="BMA10247_0382"
FT   CDS_pept        complement(370822..372042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0382"
FT                   /product="ISBma1, transposase"
FT                   /note="identified by match to protein family HMM PF01610"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07177"
FT                   /protein_id="ABO07177.1"
FT                   /translation="MLDRKALQALGCWTGYRLERVEWPQGDSRTLSLYLKPVSQIMYCE
FT                   QCGARCQQIHETTVRRVRDLPLFEYRVVLHVPRRRVWCERCGAARLEKLDWLGRYQRVT
FT                   QRFAKACEKLLQAASVQAVAAFYELGWHTVKSIDKMRLRARVAEPDWSTIRYLAMDEFA
FT                   LHKGHRYATVVVDPIGRQVLWVGPGRSRETARAFFEQLPEGGAERIEAVAIDMTTAYEL
FT                   EIKEQCPQAEIVFDLYHVVAKYGREVIDRVRVDQANQLRHDKPARKVLKSSRWLLLRNR
FT                   HNLKPEQAVHLKELLAANQSLLCVYVLRDELKRLWFYRKPACAEKAWGQWFEQAQQSGI
FT                   AALQKFAQRLQGYWHGIVARCRHPLNTSVVEGINNTIKVIKRRAYGYRDEQYFFLKIRA
FT                   AFPGIPR"
FT   gene            372330..373646
FT                   /locus_tag="BMA10247_0383"
FT   CDS_pept        372330..373646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0383"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06190"
FT                   /protein_id="ABO06190.1"
FT                   /translation="MAGMAGMAGMAGVDGADAARADARRDVAAVALGNAIEFFDFGAYA
FT                   TFAVMIGRTFFPTQRPFVSLLLSVSVFGLGFVVRPLGALVIGAYADRAGRKPAMTLTLA
FT                   MMAVGTGAIAVLPGYETIGVAAPILLVVTRLIQGLAWGGEAGPATTYILEAAPPEQRAA
FT                   YACWQVATQGFAAVAAGLAGYALTLALPEAELDAWGWRVPFALGLLVLPVGVYIRRRLS
FT                   DTIDPRHAYCTTREILRELNARHRRPIAIGLMVLLGSTITQYFLNYMTTFALTELHLPG
FT                   GVAMLATFVTGAALAVGALAGGSLSDRVGRRAILIWPRVLLLLLLFPALQLIVSRPTPA
FT                   VFLATLTVLSGLHGMSGAALIVLIAESFPQRVRSTGFSIVYAVAVSLFGGTAQSIVTWL
FT                   IGTTGNPMAPSGYLLVANAICIAAGWLAAETRPGGRGTR"
FT   gene            complement(373969..375786)
FT                   /locus_tag="BMA10247_0384"
FT   CDS_pept        complement(373969..375786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0384"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06467"
FT                   /protein_id="ABO06467.1"
FT                   /translation="MALAAGAPGTVGAAGERAIGSRGAAATRTALTGWRAWFVAAAVLC
FT                   AYLLPGILGHDPWKQDETYTFGIIQHMLESGDFVVPTNAGQPFLEKPPLYDWVATGFAW
FT                   LFSRFLPLHDAARLASALFAALAFGFTARAARVATGAARWLELPVIGTVALCAGSLVVI
FT                   KHSHDLMTDVALMAGAAMGFCGLLELVIRHAGDAFGARAERPPANRFAAPLFGLGVGIA
FT                   LMSKGLFVPLVFGATLAATLVLYPACRSRAFFRSLAIAALVCAPFALIWPTALFLRSES
FT                   LFLVWFWENNVGRFFGFSVPTLGAENDKPLFIWRALLTVGFPVAPLALVALARGLWRDW
FT                   RAPRVALPLTFAGIGMVVLHISATSRQLYILPFIAPLALVAAQAIPRLPQRLHAAWDYA
FT                   SRLLFGAAAALVWIVWSLMSDHGGPRAGLQWLGRWLPLDWTMPIEPALVLSALAITIGW
FT                   VGLLPSLRLAGKWRGALSWAMGALVAWGLVYTLLLPWLDVAKSYRSVFEDLNRRLALEW
FT                   NDGDCMASVDLGESEAPMLYYFSGVLHQPVAQPNASACTWLIVQGTRANPPVLDAEWKP
FT                   FWAGARPGDEQEMLRVYVRTPAAARPAHP"
FT   gene            375692..375805
FT                   /locus_tag="BMA10247_0385"
FT   CDS_pept        375692..375805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0385"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05346"
FT                   /protein_id="ABO05346.1"
FT                   /translation="MSAVRVAAAPRDPIARSPAAPTVPGAPAASATEGERE"
FT   gene            complement(376405..377163)
FT                   /locus_tag="BMA10247_0386"
FT   CDS_pept        complement(376405..377163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0386"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04121"
FT                   /protein_id="ABO04121.1"
FT                   /translation="MTNTPRKVVLITGASRGIGRASALLAAARGWSVGINYARDAAAAE
FT                   ATADAVRAAGAQACVVRGDVAHEADVIHMFDAVQSAFGRLDALVNNAGIVAPSLPLADM
FT                   DIARLKRVFDTNVLGAYLCAREAARRLSTDRGGGGGAIVNVSSIAARLGSPNEYVDYAG
FT                   SKGAVDTLTLGLAKELGPHGVRVNAVRPGLIATEIHASGGQPGRAERLGAQTPLGRAGD
FT                   ADEVAETIVWLLSDAASYVTGALLDVGGGR"
FT   gene            complement(377581..378168)
FT                   /locus_tag="BMA10247_0387"
FT   CDS_pept        complement(377581..378168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0387"
FT                   /product="decarboxylase family protein"
FT                   /note="identified by match to protein family HMM PF03641;
FT                   match to protein family HMM TIGR00730"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07337"
FT                   /protein_id="ABO07337.1"
FT                   /translation="MNSVCVYCGSANGAKPVYADAARAFGRALANAGLTLVYGGGRVGL
FT                   MGVIADEVIASGGRAIGVITELLYDKEVGHTGLTELHVVPDMHHRKKMMAELADAFVAM
FT                   PGGAGTLEEFFEVYTWAQLGYHRKPVALYNVDAFYQPLITLLEHTVDEGFMQRTYFDAL
FT                   CIDAAPDALIDQLVRYRPPARDKWTFVSTQEA"
FT   gene            complement(378165..378884)
FT                   /locus_tag="BMA10247_0388"
FT   CDS_pept        complement(378165..378884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0388"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07046"
FT                   /protein_id="ABO07046.1"
FT                   /translation="MEAKPPRRTRERILELSLKLFNEIGEPNVTTTTIAEEMEISPGNL
FT                   YYHFRNKDDIINSIFAQFEQQIERRLRFPEDHRPTIDETWSYLQYMADFMWTYRFLYRD
FT                   LNDLLARNRTLETHFKQIISHKVRFAREMCELLAADGELVATPAEIEVIATNMAVIATY
FT                   WLSYQYVMHPRKYNDQDAIREELHQVSMHVISVIAPYLRGRSRQIFDDLVSGKLPKREF
FT                   HDYLPPRDGSPRKDTKQ"
FT   gene            complement(379121..379591)
FT                   /gene="dgkA"
FT                   /locus_tag="BMA10247_0389"
FT   CDS_pept        complement(379121..379591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="BMA10247_0389"
FT                   /product="prokaryotic diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /note="identified by match to protein family HMM PF01219"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06359"
FT                   /protein_id="ABO06359.1"
FT                   /translation="MRLAPSETHEPAEPHEPLGPDDPLALPHNPYKGNRGLMRAWYALK
FT                   NSYNGFRVAIREESAFRQELTLAAIMLPIAVFVPVEPASRALLIGTVLLVLIVELLNSS
FT                   VETAIDRISLERHELSKRAKDLGSAAVTVALCTCLSTWGLILGPLVWRRLAG"
FT   gene            complement(379675..380709)
FT                   /locus_tag="BMA10247_0390"
FT   CDS_pept        complement(379675..380709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0390"
FT                   /product="glycosyltransferase, group 1 family"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04674"
FT                   /protein_id="ABO04674.1"
FT                   /translation="MKIMIVTDAWEPQVNGVVRTLKSTARELTALGHRVELVTPLEFRT
FT                   VPCPTYPEIRLSILPYRRLRERLDAFEPHALHIATEGPLGLAARRYARARKLPFTTAYH
FT                   TRFPEYVQARFGVPLAATYRFLRWFHGASLAVMAPTPVVKDDLERFGFDNVVLWTRGVD
FT                   LDIFRPIESKVLNTARPIFLYVGRVAIEKNVEAFLKLDLPGSKWVAGEGPALAELKSRY
FT                   PEANYLGVLTQAELAKVYAAADVFVFPSRTDTFGLVLLEALACGTPVAAYPVTGPVDVL
FT                   GDGGAGAMNDDLREACLEALKIDRRHARAWAERFSWRAASEQFASHLKPLQKSACPHTE
FT                   GAAV"
FT   gene            complement(380731..381669)
FT                   /locus_tag="BMA10247_0391"
FT   CDS_pept        complement(380731..381669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0391"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07205"
FT                   /protein_id="ABO07205.1"
FT                   /translation="MGKKTSATSFFRDPAGLHAASAFLSGSAASDTLAPARPPAADTTR
FT                   HDDNEPASHRYRTIWLSDIHLGTSGCQAGYLLDFLKHNESEYLYLVGDIIDGWQLRKGW
FT                   YWPQAHNDVVQKILRKARKGTQVVYIPGNHDEAARQFCDLAFGEIHVRGEAFHTTLAGK
FT                   RLWIVHGDLFDGVIQHAKWLAYLGDTLYTLILVLNRWFNRIRSRFGFQYWSLSQYLKHQ
FT                   VKNAVNFISSFEAVMTDEARRRGCDGVVCGHIHKAEIRDIDGVLYCNDGDWVESLSALV
FT                   ETMEGELKVVYWTVMRTPPAALPRKTKAATA"
FT   gene            complement(381760..382269)
FT                   /locus_tag="BMA10247_0392"
FT   CDS_pept        complement(381760..382269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0392"
FT                   /product="RDD family protein"
FT                   /note="identified by match to protein family HMM PF06271"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06108"
FT                   /protein_id="ABO06108.1"
FT                   /translation="MIAPALPSEPPPPSVRRRLAALAYEGLLLFGVVFFAGLMFGVALQ
FT                   QRNGLDHRNLLAGWIALVVGAYFVWFWTHGGQTLPMKTWRLRVETARGAPLSAGRALAR
FT                   YALGWLWFLPPLALHPLAGFPLLRTLAATAVWFALWALAARLHPSRQFPHDRLAGTRIV
FT                   DASRRG"
FT   gene            complement(382276..382992)
FT                   /locus_tag="BMA10247_0393"
FT   CDS_pept        complement(382276..382992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04328"
FT                   /protein_id="ABO04328.1"
FT                   /translation="MIALVVAYAATYPRFHPQPAAVAAASAPVIASAAIALSSGEFPPL
FT                   PPSSPLSWGRLTPQQHVALAPFASQWDSFSDERKRKWLKIAARFPRMSPEAQKRLQERM
FT                   TEWVRMTPEQRRVARENYLVSKDLSAQAREKAWKAYQQLSPEQKEKLAAAERRRRPTVV
FT                   SAPPTGKTDRDINRLVNAHDRHPASAPTASIAPSAASAPAAAPVPASPATTGAVTPPTA
FT                   PTPVSPSEAPSLFNGS"
FT   gene            complement(383062..383484)
FT                   /locus_tag="BMA10247_0394"
FT   CDS_pept        complement(383062..383484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04304"
FT                   /protein_id="ABO04304.1"
FT                   /translation="MSSAPATKEELDFALKVRRALDERAASLPAATADRLAAARRAALA
FT                   RKKPDAAIVLVPALAGGAGTLELRPPGEPRSSLARRLARAWPLALLLAGLIGIAYWEDM
FT                   QRTAELADIDAAMLSDDLPLTAYLDHGFNAYLSHTH"
FT   gene            complement(383481..384041)
FT                   /locus_tag="BMA10247_0395"
FT   CDS_pept        complement(383481..384041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0395"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="identified by match to protein family HMM PF04545;
FT                   match to protein family HMM PF08281; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07165"
FT                   /protein_id="ABO07165.1"
FT                   /translation="MASDKELADFLAGVERRAFKQAAYAVRDDDASLDIVQDAMIRLAE
FT                   KYGDRPAAELPLLFQRILQNAIHDYFRRQKVRNTWVSLFSSLNNTDDDEFDPLETLESA
FT                   DGDGVESGETRLEREQVLALIDDEIQKLPARQREAFLMRYWEDMDVAETAAAMGCSEGS
FT                   VKTHCSRATHALALALKAKGITL"
FT   gene            384437..386200
FT                   /gene="ilvB"
FT                   /locus_tag="BMA10247_0396"
FT   CDS_pept        384437..386200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="BMA10247_0396"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06387"
FT                   /protein_id="ABO06387.1"
FT                   /translation="MNMPSAEFSTSESLSPQKTGSIGATVLMKALADENVEFIWGYPGG
FT                   SVLYIYDELYKQDKIQHVLVRHEQAAVHAADAYSRSTGKVGVCLVTSGPGVTNAVTGIA
FT                   TAYMDSIPLVVISGQVPTAAIGQDAFQECDTVGITRPCVKHNFLVKDVRELAQTVKKAF
FT                   YIARTGRPGPVLIDIPKDISKTPCEYEPVKNVSLRSYNPVTKGHSGQIRKAVSLLLSAK
FT                   RPYIYTGGGIILADASRELNQFADLLGYPVTNTLMGLGGYRSSDRKFLGMLGMHGTYEA
FT                   NMAMQHCDVLIAIGARFDDRVIGDPAHFASRPRKIIHIDIDPSSISKRVKVDIPIVGDV
FT                   KEVLKELIEQLQTAEHGSDADALAQWWKEIEGWRGTDCLKYDRASEIIKPQYVVEKLWE
FT                   LTDGNAFVCSDVGQHQMWAAQFYRFNKPRRWINSGGLGTMGFGLPAAMGVKMAHPDDDV
FT                   VCITGEGSIQMCIQELSTCKQYDTPVKIISLNNRYLGMVRQWQQIEYSKRYSHSYMDAL
FT                   PDFVKLAQAYGHIGMRIEKSADVEPALKEALSLKDRTVFLDFQTDPTENVWPMVQAGKG
FT                   ITEMLLGSEDL"
FT   gene            386312..386803
FT                   /gene="ilvN"
FT                   /locus_tag="BMA10247_0397"
FT   CDS_pept        386312..386803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="BMA10247_0397"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM TIGR00119"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05618"
FT                   /protein_id="ABO05618.1"
FT                   /translation="MRHIISVLLENEPGALSRVVGLFSARGYNIETLTVAPTEDQSLSR
FT                   LTIVSIGSDDVIEQITKHLNRLIEVVKVVDLTDGAHIERELMLIKVRAVGKEREEMKRM
FT                   ADIFRGRIIDVTEKTYTIELTGASDKLDAFIQALDAGSILETVRTGSSGIGRGERILKV
FT                   "
FT   gene            386886..387902
FT                   /gene="ilvC"
FT                   /locus_tag="BMA10247_0398"
FT   CDS_pept        386886..387902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="BMA10247_0398"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="identified by match to protein family HMM PF01450;
FT                   match to protein family HMM PF07991; match to protein
FT                   family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07112"
FT                   /db_xref="GOA:A3MI87"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MI87"
FT                   /protein_id="ABO07112.1"
FT                   /translation="MKVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDSGVNVTVG
FT                   LRRGGASWSKAENAGLAVKEVAEAVKGADVVMMLLPDEQIAAVYAQEVHANIKEGAALA
FT                   FAHGFNVHYGQVIPRADLDVIMVAPKAPGHTVRGTYAQGGGVPHLIAVAQDKSGAARDI
FT                   ALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTVELIKAGFETLVEAGYAPEM
FT                   AYFECLHELKLIVDLIYEGGIANMNYSISNNAEYGEYVTGPRVVTEETKKAMKQCLTDI
FT                   QTGEYAKSFILENKAGAPTLQSRRRLTAEHQIEQVGSKLRAMMPWIAKNKLVDQSKN"
FT   gene            388024..388674
FT                   /gene="psd"
FT                   /locus_tag="BMA10247_0399"
FT   CDS_pept        388024..388674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="BMA10247_0399"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="identified by match to protein family HMM PF02666;
FT                   match to protein family HMM TIGR00164"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05505"
FT                   /db_xref="GOA:A3MI88"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MI88"
FT                   /protein_id="ABO05505.1"
FT                   /translation="MNYPHPIIAREGWPFIAIAAVVALLIHAVGGFGLAWPFWLLLVFV
FT                   VQFFRDPPRAVPTQANAVLCPADGRIVAVETAHDPYADREALKISVFMNVFNVHSQRSP
FT                   VDGAVQKVEYFPGAFLNAALDKASAENERNAVVIQTGAGHTVTAVQIAGLVARRILCYV
FT                   RAGEPLSRGQRYGFIRFGSRVDVYLPKGSRARVSIGEKVSASSTILAELPEQP"
FT   gene            388691..389563
FT                   /gene="pssA"
FT                   /locus_tag="BMA10247_0400"
FT   CDS_pept        388691..389563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="BMA10247_0400"
FT                   /product="CDP-diacylglycerol-serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="identified by similarity to SP:Q48269; match to
FT                   protein family HMM PF01066; match to protein family HMM
FT                   TIGR00473"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06824"
FT                   /protein_id="ABO06824.1"
FT                   /translation="MAAFKPRRPRNGNAPWPRSFRHKKSVAQDVAPVESRRAARQQFLR
FT                   TRGIYLLPNAFTTAALFCGFFAVVQAMNVRFETAAIAIFAAMVLDGMDGRVARMTHTQS
FT                   AFGEQFDSLSDMVSFGVAPALVMYEWVLKDLGRWGWLAAFVYCSGAALRLARFNTNIGV
FT                   VDKRFFQGLPSPAAAALIAGFVWLATDNRVPMKLGWLPWVAFVLTIYAGVTMVSNAPFY
FT                   SGKALDVRHRVPFAAILLVVVAFVLVSSDPPLMLFGLFVLYGLSGYVFWAYMAVRGRAN
FT                   SARSSQREH"
FT   gene            390244..391473
FT                   /pseudo
FT                   /gene="leuA-2"
FT                   /locus_tag="BMA10247_0401"
FT                   /note="2-isopropylmalate synthase; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00682; match to
FT                   protein family HMM PF08502"
FT   gene            complement(391608..393155)
FT                   /locus_tag="BMA10247_0402"
FT   CDS_pept        complement(391608..393155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0402"
FT                   /product="inorganic anion transporter, sulfate permease
FT                   (SulP) family"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04882"
FT                   /protein_id="ABO04882.1"
FT                   /translation="MKNLRASFSTFPRDFVAGTVVFLVALPLCLGIANASGVEPFAGLV
FT                   SGIVGGLVVAVLSGSPLSVSGPAAGLVVIVVDGIAQLGSFQAFLLAVLLSGVIQFGFGL
FT                   LKAGRFAAYVPSPVIKGMLAAIGILLIVKQVPFALGLSGDGDAPGHAVFASSAIALASL
FT                   ALLAVWETRAMRRFAFVRLVPAPLAVVILSIGATVLLGFVSPNFAPPAEHRVALPELAS
FT                   FAALGEALKTVDLGPNFAYLLSPDVWRIAITIAVVASLETLLSLEAVEQIDPKRRPSQP
FT                   NRELKAQGVGNLVAGAIGGLPITSVIVRSSVNVNAGAQSRMSAIVHGVMLVVSVFALTW
FT                   LLNLIPLASLAAILIHTGFKLAKPALFTSVAKQGPGAFLPFAVTIAGVLAIDLLAGIAL
FT                   GLACSVFAVACANLRSPATLAQHDDHYLLSFRKDVSFLGKVQIKQYLAQIPDRAVVIID
FT                   ATRADYIDHDVREMIDAFVAEAPRREITVDYRRQVQHVRGAGLRWFFRNPAAQQAPQ"
FT   gene            complement(393212..393847)
FT                   /locus_tag="BMA10247_0403"
FT   CDS_pept        complement(393212..393847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0403"
FT                   /product="putative carbonic anhydrase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04130"
FT                   /protein_id="ABO04130.1"
FT                   /translation="MNRPKSMLVANIAWARETSERSPDFFDALSRGQNPRVLWIGCADS
FT                   RVPAEAITQSAPGELFVHRNIANIFQPDDDNCASVLEYAVKVLKVDHVIVCGHYGCGGV
FT                   RASLLPPSPELPHVNRRIAPLCALAGRHRAELDGVPPDAAADRLAELNVLEQVRLLRSS
FT                   PIIRDAAPAPLVHGWIFSLADGRLKELASGYPAAQRPPQAERAQAAAA"
FT   gene            complement(394292..394792)
FT                   /locus_tag="BMA10247_0404"
FT   CDS_pept        complement(394292..394792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0404"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04924"
FT                   /protein_id="ABO04924.1"
FT                   /translation="MFARLPVLFACAAALLAGCAQPWQQFHAGDDSSAIVARLGPPREI
FT                   YDLPNGGKRLMWPTQPMGEVTTAADIDAHDRIVSVRQVLQPLEFYRAEIGKWTKTDVLV
FT                   NFGRPVETSYFPLMKREVWTYRYLEDNVWYMLYSFYFDDDGILRLTQKTPDPLHDPDRR
FT                   TLF"
FT   gene            394814..395215
FT                   /locus_tag="BMA10247_0405"
FT   CDS_pept        394814..395215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0405"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03940"
FT                   /protein_id="ABO03940.1"
FT                   /translation="MATFYHGARPRARAGSEKFALRHSYAGICRGARPAAAHPRPAPVG
FT                   RRRRGRGGRGGFVRTADLRDREPASNRLSDRPVGRACLARREVSAGAPRGLPAHRALAY
FT                   DPALDERTVQETTRCLPIGCVLPPRRRRR"
FT   gene            395167..396444
FT                   /locus_tag="BMA10247_0406"
FT   CDS_pept        395167..396444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0406"
FT                   /product="putative amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07391"
FT                   /protein_id="ABO07391.1"
FT                   /translation="MSSYWMRFAAAASAALTLALPMPFAAAAATGEPIRIALVEGMSGP
FT                   FANAGAAVERNLRFGIERVNAQGGVRLRDGAHPLELVVLDSKGSVEEALVQLRAATDKG
FT                   IGFVAQGNGSAVAAALVAALDRHNARDPEHRALFLNYSADDPALTGRDCSFWHFRFDAH
FT                   AGMRMDALADVLARDRAVKKVYLLNQDYSFGHDVSALARAALKARRPDIAIVGDEFHPI
FT                   GRVKDFSPYAAKIRASGADAVVTGNWGNDLTLLVRATREQGLAAKFYTFYGNSLDAPAA
FT                   LGDAGVKRVLAVADWHPNAGGARSDAFYRAFRARFPAAQDDYPVRRMSEMIEMLAAAMT
FT                   RAGSADPVAVAKALEGMRYDDGFHPAQMRAADHQLIQPLYVIEMERAGAPGVRFDNAGS
FT                   GYGFATVLEAPPTQGAAPAECRMKRP"
FT   gene            396550..396819
FT                   /gene="rpsO"
FT                   /locus_tag="BMA10247_0407"
FT   CDS_pept        396550..396819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="BMA10247_0407"
FT                   /product="30S ribosomal protein S15"
FT                   /note="identified by match to protein family HMM PF00312;
FT                   match to protein family HMM TIGR00952"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06319"
FT                   /db_xref="GOA:A3MI96"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MI96"
FT                   /protein_id="ABO06319.1"
FT                   /translation="MSVADIKKSEVVAQFARGANDTGSPEVQVALLTARITELTGHFKT
FT                   HAKDHHSRRGLLRMVSRRRKLLDYLKGKDADRYRALIEKLGLRK"
FT   gene            397123..399264
FT                   /gene="pnp"
FT                   /locus_tag="BMA10247_0408"
FT   CDS_pept        397123..399264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="BMA10247_0408"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF00575; match to protein
FT                   family HMM PF01138; match to protein family HMM PF03725;
FT                   match to protein family HMM PF03726"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05379"
FT                   /db_xref="GOA:A3MI97"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MI97"
FT                   /protein_id="ABO05379.1"
FT                   /translation="MSLFNKIVKEFQWGQQKVRLETGEIARQASGAVIVDIEDTVVLAT
FT                   VVGAKSAKPGQDFFPLTVDYIEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPL
FT                   FPEGFYNEVQVVIHVLSVNPEIPADIPALIGASAALAVSGLPFNGPVGAARVAYVNNEY
FT                   VLNPTREQIKASRLDLVVAGTERAVLMVESEADQLPEDVMLGAVVFGHEQMQTAIDAIH
FT                   ELVREGGKPEWDWQPAPKDEALNARVTELAQPELLAAYQIRDKQARLTKLKEVYAATSA
FT                   KLEEEAVAAGTVAADKATVGNILFDLEAKIVRGQILNGEPRIDGRDTRTVRPIEIRTGV
FT                   LPRTHGSALFTRGETQALVVATLGTKGDEQIIDALEGEYRERFMLHYNMPPFATGETGR
FT                   VGSPKRREIGHGRLAKRALVACLPSADEFGYSIRVVSEITESNGSSSMASVCGGCLALM
FT                   DAGVPMKAHVAGIAMGLILEGNKFAVLTDILGDEDHLGDMDFKVAGTADGVTALQMDIK
FT                   IQGITKEIMQVALAQAKEGRMHILGKMKDAVAGANTQLSEFAPRMITIKINPEKIRDVI
FT                   GKGGSVIRALTEETGTTIDISDDGVVTIASTNSEGMAEAKKRIENITAEIEVGHVYEGT
FT                   VLKLLDFGAIVNLLPGKDGLLHISEIVNERVKDINDYLKEGQQVKVKVIQTDEKGRVRL
FT                   SAKALLNEAAAQADTPPQQ"
FT   gene            399380..400399
FT                   /locus_tag="BMA10247_0409"
FT   CDS_pept        399380..400399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0409"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240; match to protein
FT                   family HMM TIGR02824"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07149"
FT                   /protein_id="ABO07149.1"
FT                   /translation="MKAIEITEFGAPDVLKLTERPQPEPKRGEVLIKVAASGVNRPDVF
FT                   QRKGAYAPPPGASDLPGLEVAGEIVGGDLADSAANPFGLKLGDRVCALLAGGGYAQYVA
FT                   APLAQCLPVPKGLTDVDAASLPETFFTVWSNVFDRAQLGAGEGGAQETFLVQGGSSGIG
FT                   VTAIQIAHALGFRVFATAGTDDKCRACEALGAERAINYKSEDFVEVVKSLTHDRGVDVI
FT                   LDMVAGAYVPRELAALADGGRLVVIALLGGAKAEINVAEILRRRLTITGSTLRPRPVEF
FT                   KAAIAAQLKARVWPLIEDGRVKPVIYRVLPAAQAADAHALMESSEHVGKIVLDWGANA"
FT   gene            400459..401259
FT                   /gene="tpiA"
FT                   /locus_tag="BMA10247_0410"
FT   CDS_pept        400459..401259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="BMA10247_0410"
FT                   /product="triose-phosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="identified by match to protein family HMM PF00121;
FT                   match to protein family HMM TIGR00419"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05591"
FT                   /protein_id="ABO05591.1"
FT                   /translation="MNTTPGFGASTTRQTMSKQRIKRVIGNWKMHGRLSGNEALLDEVA
FT                   QGAQAVPEHVGIGVCVPFPYLAQARARLHGGRVAWGAQDVSAHEQGAFTGEVAAGMVAE
FT                   FGAAYAIVGHSERRAYHGESNEIVAAKAQRALAAGLTPVVCVGETLAEREAGATEQVVG
FT                   VQLDAVLAVLSQDEAARIVVAYEPVWAIGTGRSATAEQAQQVHAFLRGRLAAKGAERVS
FT                   LLYGGSVKADNAAELFGQPDIDGGLIGGASLKSGDFLAICRAAQ"
FT   gene            401339..401716
FT                   /gene="secG"
FT                   /locus_tag="BMA10247_0411"
FT   CDS_pept        401339..401716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="BMA10247_0411"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="identified by match to protein family HMM PF03840;
FT                   match to protein family HMM TIGR00810"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04668"
FT                   /protein_id="ABO04668.1"
FT                   /translation="MPYLKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSL
FT                   FGATGSANFLSRTTAVLATIFFVATLALTYLGSYKSAPSVGVLGAAPAPAASAPAASQT
FT                   PAASAPAAVSAASAPGQDVPK"
FT   gene            401824..401910
FT                   /locus_tag="BMA10247_0412"
FT   tRNA            401824..401910
FT                   /locus_tag="BMA10247_0412"
FT                   /product="tRNA-Leu"
FT   gene            402065..402424
FT                   /gene="nuoA"
FT                   /locus_tag="BMA10247_0413"
FT   CDS_pept        402065..402424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="BMA10247_0413"
FT                   /product="NADH dehydrogenase I, A subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF00507"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04119"
FT                   /db_xref="GOA:A3MIA1"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MIA1"
FT                   /protein_id="ABO04119.1"
FT                   /translation="MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYEC
FT                   GFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFL
FT                   LGFAYIWKKGGLDWE"
FT   gene            402487..402966
FT                   /gene="nuoB-1"
FT                   /locus_tag="BMA10247_0414"
FT   CDS_pept        402487..402966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB-1"
FT                   /locus_tag="BMA10247_0414"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="identified by match to protein family HMM PF01058;
FT                   match to protein family HMM TIGR01957"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06590"
FT                   /db_xref="GOA:A3MIA2"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MIA2"
FT                   /protein_id="ABO06590.1"
FT                   /translation="MSIEGVLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHA
FT                   GAARYDLDRFGVVFRPSPRQSDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCAN
FT                   GGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGVIQLQAKIRRTSTIARQ"
FT   gene            402987..403589
FT                   /gene="nuoC"
FT                   /locus_tag="BMA10247_0415"
FT   CDS_pept        402987..403589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="BMA10247_0415"
FT                   /product="NADH dehydrogenase I, C subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF00329;
FT                   match to protein family HMM TIGR01961"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07018"
FT                   /db_xref="GOA:A3MIA3"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MIA3"
FT                   /protein_id="ABO07018.1"
FT                   /translation="MASKIETLKANLEAALGARAVSLVEAVGELTLVVKASDYLEVAKQ
FT                   LRDDRSLGFEQLIDLCGVDYQTYGDGAYDGPRFAAVLHLLSVANNWRLRVRVFASDDDL
FT                   PIVPSVVDIWNSANWYEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKDFPVSGYVE
FT                   MRYDPQEKRVVYQPVTIEPREITPRVIREDRYGGLKH"
FT   gene            403600..404853
FT                   /gene="nuoD"
FT                   /locus_tag="BMA10247_0416"
FT   CDS_pept        403600..404853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="BMA10247_0416"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF00346;
FT                   match to protein family HMM TIGR01962"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06439"
FT                   /db_xref="GOA:A3MIA4"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MIA4"
FT                   /protein_id="ABO06439.1"
FT                   /translation="MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHR
FT                   ATEKLAENKTFIQSVPYMDRLDYVSMMVNEHGYVLAIEKLLGIEVPERAQYIRVLFDEI
FT                   TRVLNHLMWIGAHALDVGAMAVFLYAFREREDLMDVYEAVSGARMHAAYYRPGGVYRDL
FT                   PEAMPQYKASKIRNERALAKMNEARSGSVLDFIDDFFTRFPKCVDEYETLLTDNRIWKQ
FT                   RLVGIGVVSPERALQLGLTGPMIRGSGIAWDLRKKQPYEVYDRLDFDIPVGVNGDCYDR
FT                   YLVRVEEMRQSTRIAKQCIEWLRKNPGPVITDNHKVAPPSRVGMKTNMEDLIHHFKLFT
FT                   EGFHVPEGETYAAVEHPKGEFGIYLVSDGANKPYRLKIRAPGYAHLSALDEMARGHMIA
FT                   DAVTIIGTQDIVFGEIDR"
FT   gene            405022..405507
FT                   /gene="nuoE"
FT                   /locus_tag="BMA10247_0417"
FT   CDS_pept        405022..405507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="BMA10247_0417"
FT                   /product="NADH dehydrogenase I, E subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF01257;
FT                   match to protein family HMM TIGR01958"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05299"
FT                   /protein_id="ABO05299.1"
FT                   /translation="MISAEGLKEIDRAIAKYPADQKQSAVMSALAVAQEEHGWLSPELM
FT                   QFVADYLGMPAIAVQEVATFYTMYELAPVGKHKITLCTNLPCQLGPHGGAEATADYLKQ
FT                   KLGIDFGETTPDGKFTLKEGECFGACGDAPVLLLNNHKMCSFMSREKIDQLLEELSK"
FT   gene            405504..406814
FT                   /gene="nuoF"
FT                   /locus_tag="BMA10247_0418"
FT   CDS_pept        405504..406814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="BMA10247_0418"
FT                   /product="NADH dehydrogenase I, F subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF01512;
FT                   match to protein family HMM TIGR01959"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04558"
FT                   /protein_id="ABO04558.1"
FT                   /translation="MTSLHDRHIKPLILAGLTGENWHLEDYVARGGYKQLRRILEEKIP
FT                   PEQVIADVKASGLRGRGGAGFPTGLKWSFMPRQFPGQKYLVCNSDEGEPGTFKDRDILR
FT                   WNPHALIEGMAIGAYAMGITVGYNYIHGEIFEVYRRFEAALDEARRAGFLGEKIMGSDF
FT                   SFQLHAHHGYGAYICGEETALLESLEGKKGQPRFKPPFPASFGVYGKPTTINNTETFAA
FT                   VPFLLAVGPQNYLEMGKPNNGGTKIFSVSGDVERPGNYEIPLGTPFATLMELAGGMRGG
FT                   KKIKAVIPGGSSAPVIPGDIMMQTDMDYDSIAKAGSMLGSGAVIVMDETRCMVRSLLRL
FT                   SYFYYEESCGQCTPCREGTGWLYRVVNRIEHGEGRQEDLDLLNSVAENIMGRTICALGD
FT                   AAVMPVRGMLKHYWDEFAYHVEHKHCMVGGHAHAAVA"
FT   gene            406897..409227
FT                   /gene="nuoG"
FT                   /locus_tag="BMA10247_0419"
FT   CDS_pept        406897..409227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="BMA10247_0419"
FT                   /product="NADH dehydrogenase I, G subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF00384; match to protein
FT                   family HMM TIGR01973"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06805"
FT                   /protein_id="ABO06805.1"
FT                   /translation="MVELEIDGKKVEVPEGSMVIQAAHKADTYIPHFCYHKKLSVAANC
FT                   RMCLVEVEKMPKAVPACATPVSAGMIVHTNSEKAVKAQQSVMEFLLINHPLDCPICDQG
FT                   GECQLQDLAVGYGKSTSRYAEEKRVVFHKEVGPLISMEEMSRCIHCTRCVRFGQEIAGV
FT                   MEFGMLGRGEHSEITTFVGKTVDSELSGNMIDLCPVGALTSKPFRYSARTWELSRRKSV
FT                   SPHDSVGANLVVQVKNNRVMRVLPFENEAVNECWISDKDRFSYEGLNSEERLTKPMIKQ
FT                   GGEWREVDWQTALEYVARGLKGIGDEHGPAAIAALGSAHSTVEELFLLKQLAHELKTPN
FT                   VDFRLRQTDFSAAAQGAPWLGMPIADLSAVDAAFVVGSFLRRDHPLFAARLRQAAKNGA
FT                   KLHFLHATGDDALIPTAQRIVAAPSAWLDTLAGVAAAVAQARGVALPEALAGVEASDAA
FT                   RSVAQSLANGERRAVLLGNSVVRHPQFAQIHAIAQWIAENTGATLGFLTEAANTVGAHL
FT                   VGALPGANGLNARDAFAQPRKGYVLLNVEPEFDTADPAQALAALKQAETVVVLSPFKYG
FT                   LDYADVLLPISPFTETAGTYVNAEGRAQSFNGVVRPLGDTRPAWKVLRVLGSLLGLPNF
FT                   EYETSEEVRLAALGDGEITSRLSNKTAAVPARAAAGAANGALERLADVPIYHADALSRR
FT                   AGALHLTAASKAAHQVGLPAALFDKLGLKNGDAVRVRQGDRTVQLPAVRDENLAEAVVR
FT                   VSAATPAGAALGSLSGELVVEKA"
FT   gene            409234..410292
FT                   /gene="nuoH"
FT                   /locus_tag="BMA10247_0420"
FT   CDS_pept        409234..410292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH"
FT                   /locus_tag="BMA10247_0420"
FT                   /product="NADH dehydrogenase I, H subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF00146"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03942"
FT                   /protein_id="ABO03942.1"
FT                   /translation="MFDTINSGGAQLLGVAWPTVWALVRILVVAVVILLCVAYLILWER
FT                   KLIGWMHVRLGPNRVGPAGLLQPIADVLKLLLKEVIRPTAASRWLYLVAPVMTVVPAFA
FT                   VWAVIPFQAGAVLANINAGLLYAMAISSIGVYAVILAGWASNSKYAFLGAMRAAAQMVS
FT                   YEISMGFALVLVLMTAGSLNLSEIVGSQQHGFFAGHGVNFLSWNWLPLLPVFVIYFISG
FT                   IAETNRHPFDVVEGESEIVAGHMIDYSGMAFALFFLAEYINMIVISALAATLFLGGWDA
FT                   PFEFLSFIPGIFWLVLKIFALLSVFIWARATFPRYRYDQIMRLGWKVFLPVCVFWVIVV
FT                   GFWMMSPLNIWK"
FT   gene            410308..410796
FT                   /gene="nuoI"
FT                   /locus_tag="BMA10247_0421"
FT   CDS_pept        410308..410796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="BMA10247_0421"
FT                   /product="NADH dehydrogenase I, I subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM TIGR01971"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04732"
FT                   /db_xref="GOA:A3MIA9"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MIA9"
FT                   /protein_id="ABO04732.1"
FT                   /translation="MTAIQQFFKTFFLTELLKGLALTGRYTFKRKFTVQFPEEKTPISP
FT                   RFRGLHALRRYENGEERCIACKLCEAVCPALAITIESETRADNTRRTTRYDIDLTKCIF
FT                   CGFCEESCPVDSIVETQILEYHGEKRGDLYFTKDMLLAVGDRYEKEIAAAKAADARYR"
FT   gene            410906..411562
FT                   /gene="nuoJ"
FT                   /locus_tag="BMA10247_0422"
FT   CDS_pept        410906..411562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ"
FT                   /locus_tag="BMA10247_0422"
FT                   /product="NADH dehydrogenase I, J subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF00499"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05477"
FT                   /protein_id="ABO05477.1"
FT                   /translation="MDFTTVLFYIFSLLLVVSGLKVITSRNPVASALFLVLAFFNAAAI
FT                   WMLLEAEFLAILLVLVYVGAVMVLFLFVVMMLDVNIDVLRRDFKRFVPMATAVGAIIVV
FT                   ETALILWRGYGATASPVRDMAAGALAGMPNTKLIGKVIYTDYIFAFEIAGLVLLVAIIA
FT                   AVALTAQKGKDSKRQRVSEQVKVRREDRVRLVKMPADKPQPEAAASDAASGSNNG"
FT   gene            411581..411886
FT                   /gene="nuoK"
FT                   /locus_tag="BMA10247_0423"
FT   CDS_pept        411581..411886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK"
FT                   /locus_tag="BMA10247_0423"
FT                   /product="NADH dehydrogenase I, K subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF00420"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06691"
FT                   /db_xref="GOA:A3MIB1"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MIB1"
FT                   /protein_id="ABO06691.1"
FT                   /translation="MLTLAHYLVLGAILFAIAIVGIFLNRRNIIIILMAIELMLLAVNT
FT                   NFVAFSHYLGDVHGQIFVFFVLTVAAAEAAIGLAILVTLFRKLDTINVEDLDQLKG"
FT   gene            411904..413943
FT                   /gene="nuoL"
FT                   /locus_tag="BMA10247_0424"
FT   CDS_pept        411904..413943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /locus_tag="BMA10247_0424"
FT                   /product="NADH dehydrogenase I, L subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF00361;
FT                   match to protein family HMM PF00662; match to protein
FT                   family HMM TIGR01974"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04011"
FT                   /protein_id="ABO04011.1"
FT                   /translation="MSTTLNENLLLAIPLAPLAGSLIAGLFGNAVGRKGAHRVTILGVA
FT                   LAFVLSALVFFQVLDGASFNATVYEWMNVGSLKLEVGFLVDTLTAMMMVVVTFVSLMVH
FT                   IYTIGYMSEEDGYQRFFSYISLFTFSMLMLVMSNNFLQLFFGWEAVGLVSYLLIGFYFT
FT                   RESAIYANMKAFLVNRVGDFGFLLGIGLILAYAGSMNYGEVFAKRAELASLHFPGTQWG
FT                   LLTVACICLFIGAMGKSAQFPLHVWLPDSMEGPTPISALIHAATMVTAGIFMVTRMSPL
FT                   FELSDAALSFITVIGAITALFMGFLGIVQNDIKRVVAYSTLSQLGYMTVALGVSAYPVA
FT                   VFHLMTHAFFKALLFLGAGSVIIGMHHDQDMRNMGGLRKYMPITWITSLVGSLALIGTP
FT                   FFSGFYSKDSIIDAVKLSHLPGSGFAYFAVVASVFVTALYSFRMYFLVFHGEERFRHPK
FT                   TFGNNHGAESAAHHGHDDHGHAHEPHETPWVVWVPLVLLAIPSVIIGAIAIGPMLYGDF
FT                   FQHGVAFDKVIFIGQNHPALAEMAEEFHGWTAMGLHSVSGLPMWLALAGVVVAWFLYLK
FT                   RPDLPAAIRRAFGPIYTLLDNKYYMDKINEVVFTKGSIAIGRGLWKEGDVVVIDGLVNG
FT                   SARFIGWFAGVIRFLQSGYIYHYAFAMIIGMLGLLTLFVTLGGK"
FT   gene            413959..415449
FT                   /gene="nuoM"
FT                   /locus_tag="BMA10247_0425"
FT   CDS_pept        413959..415449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM"
FT                   /locus_tag="BMA10247_0425"
FT                   /product="NADH dehydrogenase I, M subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF00361;
FT                   match to protein family HMM TIGR01972"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04864"
FT                   /protein_id="ABO04864.1"
FT                   /translation="MHSFPILSTAIWLPIVFGLVVLAVGSDKHPGAARWIALIGSLAGL
FT                   AVTIPLITGFDSSTAALQFVEQSTWIERFNISYHLGVDGISMWFVVLTALITVIVVIAG
FT                   WEVITENVSQYLAAFLILSGIMIGVFSAADGLLFYVFFEATLIPMYIIIGVWGGPNRVY
FT                   AAFKFFLYTLAGSLLMLVALIYLYTQTHSFDLATWQNAKIAMTPQVLLFIAFFLAFAVK
FT                   VPMWPVHTWLPDAHVEAPTGGSVVLAAIMLKLGAYGFLRFSLPITPDASHFFAPVVISL
FT                   SLIAVIYIGLVAMVQADMKKLVAYSSIAHMGFVTLGFFIFNQLGVEGAIVQMISHGFVS
FT                   GAMFLCIGVLYDRLHSRQIADYGGVVNVMPKFAAFAMLFSMANCGLPGTSGFVGEFMVI
FT                   LAAVQFNFWIAFGAAFTLILGAAYTLWMYKRVYFGAVANDHVAKLKDIGRREFTMLAVL
FT                   AAFTLLMGLYPKPFTDVMHVSVENLLSHVAQSKLPLAQ"
FT   gene            415489..416946
FT                   /gene="nuoN"
FT                   /locus_tag="BMA10247_0426"
FT   CDS_pept        415489..416946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="BMA10247_0426"
FT                   /product="NADH dehydrogenase I, N subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="identified by match to protein family HMM PF00361;
FT                   match to protein family HMM TIGR01770"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05857"
FT                   /protein_id="ABO05857.1"
FT                   /translation="MNVLLPDALVMAAIIVAWLNDTFVGAAGRRLTYLIAVVASAAAGV
FT                   WFALQALDPQQYYFFSRMVVVDSFASAMKAVVSIGFAVTLVYSRKYLEDRDLFRGDVFL
FT                   LGMFSLLGQLVMISGNHFLTLYLGLELMSLSLYAVIALRRDAAQSSEAAMKYYVLGALA
FT                   SGFVLYGISMLYGATGSLELNEVLKAVASGRINDAVLLFGVIFIVAGVAFKLGAVPFHM
FT                   WVPDVYQGAPTAMTLFVGGGPKVAAFAWGLRFLVMGLLPLAVDWQEMLVILAALSLIVG
FT                   NLTGIVQRNIKRMLAYSAISNMGFVLLGLLAGIVNGNPSAAASAYSSAMFYTIVYLVTT
FT                   LGSFGVVMLLARRDFEAETLDDFKGLNKRSPVFAFVMMVMMFSLAGIPPTVGFYAKLAV
FT                   LEATVNAGLTWLAVLAVVTSLFGAFYYLRIVKLMYFDAPQDTTPIAGDACKRAILVLNG
FT                   LAVVVLGIVPGPLMTICLQAISHTLPL"
FT   gene            416946..417251
FT                   /locus_tag="BMA10247_0427"
FT   CDS_pept        416946..417251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07334"
FT                   /protein_id="ABO07334.1"
FT                   /translation="MSASGWFIVLLALAGANLPFLNQRLFAVVPLKSAAAAKKSAWIRI
FT                   GEMIVLYLIVGALGFWLESRAGNRFEQGWQFYAITFSLFVVFAFPGFTFQYLVKRR"
FT   gene            417288..417878
FT                   /locus_tag="BMA10247_0428"
FT   CDS_pept        417288..417878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0428"
FT                   /product="pyrophosphatase, MutT/NUDIX family"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04393"
FT                   /protein_id="ABO04393.1"
FT                   /translation="MADLPNHDATLTETCIESESVYDGAFLKVKRDTVRLPDGKHATRE
FT                   YVTHPGAVMVIPLFDDGRVLMESQYRYPIGKVMAEFPAGKLDPNEGALACAVRELREET
FT                   GYTAREYVFLTRIHPIISYSTEFIDIYLARGLTAGERKLDDGEFLETFTATLPDLLEWV
FT                   RTGRISDVKTIIGTMWLEKAVSGAWPLGDVIRP"
FT   gene            418030..418452
FT                   /locus_tag="BMA10247_0429"
FT   CDS_pept        418030..418452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06676"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05721"
FT                   /protein_id="ABO05721.1"
FT                   /translation="MKVLDLQCPHGHRFEGWFASADEFEAQLSRKLVECPVCGATEVSR
FT                   MPSAPRLNLSGATQAQPADPRALQAQAMRALREVLAKTENVGERFAEEARRIHYNEAPA
FT                   RSIRGVTTPEDARALAEEGIDVMPLPVPAALKEPLQ"
FT   gene            418513..419709
FT                   /locus_tag="BMA10247_0430"
FT   CDS_pept        418513..419709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0430"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05321"
FT                   /protein_id="ABO05321.1"
FT                   /translation="MDLDYSPADDAFRAEIRAWLEANLPRALRDKVLNHKRLNRDDFAG
FT                   WHRLLGTRGWSAPAWPAEYGGPGWNATQRHIWEEECARIGAPPVLPFGVSMVAPVLMKY
FT                   GSEAQKRRYLPRILDGTDWWCQGYSEPGSGSDLASLRTRAERRGDHYLVNGQKTWTTLG
FT                   QHADMMFCLVRTDPDAKKQEGISFLLIDMKSPGITVRPIVTLDEDREVNEVFFEDVKVP
FT                   VENLVGDENRGWTYAKYLLGHERTGIARVGASKRELDFLKRIASRERKNGKPLIADPVF
FT                   AAKIAALEIELMALEVTVLRVVSSEASGRGPGPEASMLKIKGTEIQQALTELMVDAIGP
FT                   LAAPFDAAFLEGERERSIAGDDDAAPLAAYYFNYRKTSIYGGSNEIQKNIIAQMILGL"
FT   gene            419721..420854
FT                   /locus_tag="BMA10247_0431"
FT   CDS_pept        419721..420854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0431"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06486"
FT                   /protein_id="ABO06486.1"
FT                   /translation="MNFTFSEEQQQFAHALRRYLDERYGFDARRAIIHSDAGVCDEQWR
FT                   AFAELGLTALPVPEAHGGFGGGAVDMLVATQELGRALVVEPYWATAVGIEALRVAGSAD
FT                   GEDAALLARAAQGDAKLAVAFHEPHARHDLFAIETLARPDGDGFALTGVKSVVRHGAQA
FT                   DVLIAPARLPNGAIGLFAIARGAAGAEIVDYRTIDGQRAATVRFSDTPARALVGGERDA
FT                   AALERIADYGVVLLCGEAIGALDALNHATLDYTKTREQFGVPIARFQALQHRMVDMLIH
FT                   AEQARSLTYLAAVRYASDDANARRKAVSAAKARVGQAARFVGQQAVQLHGGMGVTDEVA
FT                   AAHLFKRLSIIETTLGDVDHHLARFASLPDFALLQDA"
FT   gene            420895..421353
FT                   /locus_tag="BMA10247_0432"
FT   CDS_pept        420895..421353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0432"
FT                   /product="MoaC domain protein"
FT                   /note="identified by match to protein family HMM PF01575"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07148"
FT                   /protein_id="ABO07148.1"
FT                   /translation="MGISYEDLEVGSRTEVGKHRFTADEIVTFAQAYDPQPFHVDAQAA
FT                   KSSMFGGLVASGWHTCSVFMGMLVRGVLQGSTSMGSPGIEEIRWIKPVRAGDTITMYNK
FT                   ILDKRLSESKPDRGIVTTEWEGGDEQGETVITVRSKVIFGLRSPQVRA"
FT   gene            421350..421832
FT                   /locus_tag="BMA10247_0433"
FT   CDS_pept        421350..421832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0433"
FT                   /product="MaoC family protein"
FT                   /note="identified by match to protein family HMM PF01575"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04405"
FT                   /protein_id="ABO04405.1"
FT                   /translation="MTARVHALPVVASADALHARVGAAPFASGWIDIDQTRVDRFADAT
FT                   GDHQWIHVDPERAARESPFGGPIAHGFLTLSLIPALMTDALRFEQRMGVNYGLNRVRFL
FT                   KPVPVGSRVRALFAVKGTGPAKQGGVQATWAVSVEVELGGQPVPACAAEFITLHYF"
FT   gene            421925..423190
FT                   /locus_tag="BMA10247_0434"
FT   CDS_pept        421925..423190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0434"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to OMNI:DRA0112"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05998"
FT                   /protein_id="ABO05998.1"
FT                   /translation="MMNRSQQTFAGFAAACAFAAGSAAQAWAAPADAIVYPAGNGSDQA
FT                   DALQAALDALQTGQRLVLAPGQYVVGRSLLVKNAQVVVSGYGATLVATNDADQTIEMRG
FT                   RDSTLVGVTLVGTGATRLTTPESTKVDVTGAGVQVLDVEVRGGASAGIFVFGGTDVAVV
FT                   GNTVRDTLADGIHTTYGSRNVLVRDNTVQNTGDDMVAVVSYKGDGKLSSNVLIQNNTLL
FT                   GNYWGRGATVVGGADVTITGNTVRNVQKAAGILVGQEDPANTYDARNVIVSNNTISDIE
FT                   WPDPDNTRPPAYMAAIDVNTWSGKATSVSVTDNRISRARYAGVRALGNVCQLRVSRNAL
FT                   ASIDGTPIALQQAPSCAAGQIVCASNTLDGAALASPAGCSATDGLTITGANVARMPQVR
FT                   AYLRQTAAPSAAKAGSAAASGE"
FT   gene            423187..423378
FT                   /locus_tag="BMA10247_0435"
FT   CDS_pept        423187..423378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06751"
FT                   /protein_id="ABO06751.1"
FT                   /translation="MSGRPPGIVRRRWAARGMWRGGRPVSALARLAGAGAVAVAVRAAV
FT                   LVALGERDSRRVLARLPA"
FT   gene            complement(423468..424694)
FT                   /locus_tag="BMA10247_0436"
FT   CDS_pept        complement(423468..424694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0436"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04081"
FT                   /protein_id="ABO04081.1"
FT                   /translation="MHFDYSAKVEALRAQLGAFFDEHIYPNERAFYEEIARNRRAGDAW
FT                   RPVELIETLKAKARAAGLWNLFLPDSARGAGLTNLEYAPLCEIMGRVPWAPEVFNCNAP
FT                   DTGNMETLERYGTDAHKAAWLEPLLDGVIRSAFLMTEPEVASSDATNIRTRIERDGEHY
FT                   VINGHKWWSSGAGDPRCKLYIVMGKTDPDAPRHAQQSMMLVPSDAHGVTVHRPLNVFGY
FT                   DDAPHGHMEITLENVRVPASNLLLGEGRGFEIAQGRLGPGRIHHCMRLVGLAERALELM
FT                   CRRASERIAFGKPVAAQTVTQERIAEARCMIEQARLLTLKTAYMMDTVGNKGARGEIAM
FT                   IKVVAPNMACQVIDWAIQAHGGGGVSDDFPLAYAYASARTLRFADGPDEVHRNAIAKLE
FT                   LARHAPRSA"
FT   gene            complement(424738..425844)
FT                   /locus_tag="BMA10247_0437"
FT   CDS_pept        complement(424738..425844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0437"
FT                   /product="phosphotransferase enzyme family protein"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04844"
FT                   /protein_id="ABO04844.1"
FT                   /translation="MATEHDPQSSQADYAAFEGTRAVGDAQRFDVDALAAWLAKHVGGF
FT                   AGPLAVEQFKGGQSNPTFKLVTPARSYVLRAKPAPAAKLLPSAHAIEREYRVMAALAGT
FT                   GVPVAPMLARCDDESVIGRAFYVMAFVDGRVLWDPSLPGMTPAERGRHYDEMNRVIAAL
FT                   HSIDPQAVGLADYGKPGNYLARQIARWSKQYLASETEPIDAMRRLIDWLPQHLRPESGR
FT                   DARVSIVHGDYRLDNLIFDAHAPRVLAVLDWELSTLGDPLADFAYHCMAWHVAPERFRG
FT                   IAGLDLRSLGIPDEAQYVARYCERTGLTMPENWNFYLAYNMFRIAAILQGIMKRVADGT
FT                   ASSAQALDAGRRARPMAELAWRYAQHAR"
FT   gene            complement(425872..426585)
FT                   /locus_tag="BMA10247_0438"
FT   CDS_pept        complement(425872..426585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0438"
FT                   /product="putative phosphoglycerate mutase"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04404"
FT                   /protein_id="ABO04404.1"
FT                   /translation="MSYQLPKRRRIYLMRHGDVTYFDASGRPFDQDAVPLNERGRMQAA
FT                   AAGRVFAEQNVRFDRVIASGLPRTIETAQRVLAETGQQLDIDIEPAWREIRGGFLADIP
FT                   PAEQEAAFLRVLDGIVAEHTRFLGGETIGELIDRVLPPLAALRADPSWDTVLLVLHGGV
FT                   NCALLSHATVPGHRLFIGTLSQSAGCINALDVGERDDDWVVRLVNYSPPEVLHRDVRNT
FT                   TMEVLYHQFLQSTRE"
FT   gene            complement(426595..427386)
FT                   /locus_tag="BMA10247_0439"
FT   CDS_pept        complement(426595..427386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0439"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05365"
FT                   /protein_id="ABO05365.1"
FT                   /translation="MSAELLASRPPESESTLVLTLSNPGARNALHPDMYAAGLEALNTA
FT                   ERDPSIRAVVLTGADRFFCAGGNLNRLLDNRAKAPSVQAASIDLLGEWITAINTVTKPV
FT                   IAAVEGAAAGAGFSLALACDLLVAADDAKFVMSYARVALTPDGGGSWFLARALPRALAA
FT                   EILFEGKPAAATRLHQLGVVNRLTKPGTTRDEAIAWADQLGTMSPNALARIKSLIADAQ
FT                   TQPLAAHLAAERDHFVASLHHADALEGITAFLDKRAPIYKR"
FT   gene            427425..427544
FT                   /locus_tag="BMA10247_0440"
FT   CDS_pept        427425..427544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0440"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06646"
FT                   /protein_id="ABO06646.1"
FT                   /translation="MRRADASHDRASSRPACFEAVLGMRGGADVAARFEVALD"
FT   gene            427626..428282
FT                   /locus_tag="BMA10247_0441"
FT   CDS_pept        427626..428282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0441"
FT                   /product="glutathione S-transferase N-terminal domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06109"
FT                   /protein_id="ABO06109.1"
FT                   /translation="MLRLCGFPVSNYYNKVKFVLLEHDIPFEASIVSVPIKDPAFLADT
FT                   PLGKVPYLMTEHGSLCESQAIIEYLAAIHPDKPIFPADPFAAAKAREITAVLELYLEWN
FT                   VRELFPEAFFGGKVSDGTKAHVEKRMPRALDGFKRLAKFSPYVLGDTFCIADIAAFIHL
FT                   PVVALATKAIYGRDFVVDAGIDWKAYVKRIEEARPAAKRVSDERKAFVAGLAKPG"
FT   gene            complement(428513..429688)
FT                   /locus_tag="BMA10247_0442"
FT   CDS_pept        complement(428513..429688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0442"
FT                   /product="aromatic aminotransferase"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07100"
FT                   /protein_id="ABO07100.1"
FT                   /translation="MMNAPHNMPTTPTLLSRLPEVGTTIFTVMSALAAEKGAVNLGQGF
FT                   PDFDCDPRIVDAVAHAMRDGRNQYPPMAGVAPLREAIADKIERLYGRRYDAATEITVTA
FT                   GATQALLTAILCAVHPGDEVIVIEPTYDSYLPSIELAGATPVFVTLNAPDYAIPFDKLA
FT                   AAITPKTRAILINTPHNPTGTVWREADMRALEDIVRGTGLLIVSDEVYEHMVYDGARHE
FT                   SVARYPELAARSIIVSSFGKTFHVTGWKIGYVAAPAPLTAEFRKVHQFNVFTVNTPMQF
FT                   GLADYLRDPEPYLTLPAFYQQKRDFFRAGLANTRFALLPCAGTYFQCVDYSAISDLPEA
FT                   EFAKWLTTEIGVAAIPVSAFYHEPHESGVVRFCFAKREDTLATALERLARL"
FT   gene            complement(429734..430366)
FT                   /locus_tag="BMA10247_0443"
FT   CDS_pept        complement(429734..430366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0443"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04162"
FT                   /protein_id="ABO04162.1"
FT                   /translation="MVLDSNVWIDILVFDDPAARPIRDALETGAITALIDVRCLIELER
FT                   VLDYPQFKARAVDKAAALATVARLSERVAGPERGDARAHAATAAGAHASPALAASPAHI
FT                   ADSGNARSGACGTPAPHARACPPPCADAAARAPADDAPPRPLPKCRDRDDQKFLELAYT
FT                   ARADWLVSKDRALLKLTRRTERDFGFRIAQPAPFAASALAADASEPA"
FT   gene            430460..431242
FT                   /locus_tag="BMA10247_0444"
FT   CDS_pept        430460..431242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:17429027; match to
FT                   protein family HMM PF03883"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05140"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MID2"
FT                   /protein_id="ABO05140.1"
FT                   /translation="MIIVLSPAKSLDYETPPHVSHHTQPQFADDAAALIDELRRLSPQQ
FT                   IATLMSISDPLARLNFQRYADWSRASTPANAKQAVLAFNGDVYEGLDARSLSPDDLDYA
FT                   QRHVRVLSGLYGLLRPLDLLQPYRLEMGTRFSNARGKDLYAFWGERITHALNAELKTRV
FT                   GASRVLVNCASAEYFKSVKPKLLDARVVTPVFEDWKDGRYKIISFHAKRARGLMARYVV
FT                   EGRIDSPDALKDFASEGYAFDASASNDDTYVFRRRAGA"
FT   gene            431301..432455
FT                   /locus_tag="BMA10247_0445"
FT   CDS_pept        431301..432455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0445"
FT                   /product="zinc carboxypeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00246"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05093"
FT                   /protein_id="ABO05093.1"
FT                   /translation="MTLSITSNFDAGAIDVVSCERADAIRLRVRGDNRSEFAQWFYFRL
FT                   TGARGERCVMTFENANDCAYPAGWRDYRAVASYDRVNWFRVPTSYDGQMLTIDHTPEFD
FT                   SIHYAYFEPYSEERHSEFLGAVQQMPQASVVELGRTVEGRPMSLVVLGTPDEAGAAKKK
FT                   VWIIARQHPGESMAEWFIEGLVKRLVGWGDWSGDPVARKLYDHATFYIVPNMNPDGSVH
FT                   GNLRTNAAGANLNREWMEPDAERSPEVLVVRDAIHAIGCDLFFDIHGDEDLPYVFAAGS
FT                   EMLPGFTEQQRVEQSAFIDSFKRASPDFQDEHGYPPGKYREDALKLASKYIGHRFGCLS
FT                   LTLEMPFKDNANLPDEHIGWNGARSASLGAAMLGAILEHVRAFA"
FT   gene            complement(432666..433286)
FT                   /locus_tag="BMA10247_0446"
FT   CDS_pept        complement(432666..433286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0446"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04341"
FT                   /protein_id="ABO04341.1"
FT                   /translation="MDSFPASLRLLGALGKLTACAAGLSLVLAAPAFADLLDQRAELVN
FT                   KYVNEMHADPLVADCAAHGNFIASTSSAFDHVEFAPNAFDSGSASITPWNDSFDEGKQR
FT                   VKVDNIVTVEGLGVRASGGDPEPLKFRCGYVGTQMLAFSWNDPVPPAKPRVERATSSKK
FT                   KLRAHSGKGKVKAKATGKSGKRAVSKKSSTTKKAAKKRSTRKS"
FT   gene            complement(433446..434120)
FT                   /locus_tag="BMA10247_0447"
FT   CDS_pept        complement(433446..434120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0447"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07066"
FT                   /protein_id="ABO07066.1"
FT                   /translation="MGFLYTPLPFWIAVGGWIAAVGLLVLALWKRPFGRLQDATLQHVW
FT                   LALVTTITVLWASNAWLDDGLVMHLLGATLLVTLFDWTLALVGMAAVIGVAAIVFDATW
FT                   QGVGLTYLVYGALPVAVSTLLQRAALAWLPHNLPALIVGQGFVSPAIAVGIVAAAAAGV
FT                   QIAIAEGTLVVVPSGYALNALLLALGEAWFTGMATALIAVYRPAWVTTSDVRRYRLGGP
FT                   RA"
FT   gene            complement(434187..435026)
FT                   /locus_tag="BMA10247_0448"
FT   CDS_pept        complement(434187..435026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0448"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06286"
FT                   /protein_id="ABO06286.1"
FT                   /translation="MRFLVLNSDAERRDGLKTLLRQIDRHAGYNDAKDWRQAQRLIKQQ
FT                   SFDLIVVDWQDIKRLGDLHALCQACAPTPVAALVDDASPVHAQALFEAGVLGVISRTTR
FT                   PHLIVRTLEMVLLGGHYVPPSALNLTEPAARARDGRVEAIVSQLPRRKRSPCSLLSPRQ
FT                   AQIMRFVHMGSTNKMIARTLGISEGTVKIHLASIFQQLGATNRAAAVAIYNGWLPPHLE
FT                   VLLSARETSPKPVHGAAGPVPLRPAKSRHPYPLAAENESSAQPLIAAEPRTPFKANE"
FT   gene            complement(435229..436446)
FT                   /locus_tag="BMA10247_0449"
FT   CDS_pept        complement(435229..436446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04413"
FT                   /protein_id="ABO04413.1"
FT                   /translation="MRQRTAKRLPPDADKLVGLSLALFASGSRVEDRFWEAKLDALLAK
FT                   IVRNGNQTTLDAALDHLQQNHPDAYGALADMAETHSESLSVEHDGKPYEALLVAIPVLA
FT                   WTRYMIPSGALKNEISDVLRTHLQAHVLAQGTLVAMAPFLYSIDQLPRHHVETYRLAQQ
FT                   LAHAALGNHSVKLNYGDLPETSPILADPRFLLAVVAAPAGAPLFRWQEEEHGSRIERGQ
FT                   CLEQWAAQGGVNLSAALPGCEFECLLPDAYYSACRDADERIRPHTVRTAIRYLFDTIGA
FT                   APQELRAVLAGFGERRIDEYRVAFTRRGSNDVIYGVVWPLYGRENGEASVDEATLEAEA
FT                   PADGPLEEIASLLKEAGVTDIRRHAGRFEPEYCDDCGVPLYADPLGEIVHAEMPEDATP
FT                   AQPHFH"
FT   gene            437083..438570
FT                   /gene="rrsA"
FT                   /locus_tag="BMA10247_0450"
FT   rRNA            437083..438570
FT                   /gene="rrsA"
FT                   /locus_tag="BMA10247_0450"
FT                   /product="16S ribosomal RNA"
FT   gene            438653..438729
FT                   /locus_tag="BMA10247_0451"
FT   tRNA            438653..438729
FT                   /locus_tag="BMA10247_0451"
FT                   /product="tRNA-Ile"
FT   gene            438763..438840
FT                   /locus_tag="BMA10247_0452"
FT   tRNA            438763..438840
FT                   /locus_tag="BMA10247_0452"
FT                   /product="tRNA-Ala"
FT   gene            complement(440574..441116)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0453"
FT                   /note="transcriptional regulator, IclR family, truncation;
FT                   comparison of this gene to its homologs suggests this gene
FT                   has been truncated; identified by match to protein family
FT                   HMM PF09339"
FT   gene            441010..441165
FT                   /locus_tag="BMA10247_0454"
FT   CDS_pept        441010..441165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06667"
FT                   /protein_id="ABO06667.2"
FT                   /translation="MAMRRNTAKPRARAVISSVVASRSRGMAWALERVVTEISLFRNLI
FT                   SDFYQL"
FT   gene            complement(441661..443622)
FT                   /locus_tag="BMA10247_0455"
FT   CDS_pept        complement(441661..443622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06526"
FT                   /protein_id="ABO06526.1"
FT                   /translation="MPALPNPSRRHALKILAGAPMLPLSGVALPALLSGCGGDDDVAAA
FT                   PPAAGFAAAAFASMAAPTLADPAAMATTTVGSTLSVSFTDDSTRNYKLAYRPFFVTGDR
FT                   VPDGKGGTILAGGYYDINGQPIIDRSVPGQERQFYSDCPDGSSLLTLKNANVAGVKGNT
FT                   VFAVVQFEYTTRDLASASQYGRLPSPIAVLTLDQDPATGALKLVKYHNVDTSAAHGLWI
FT                   TCGASLSPWNTHLSSEEYEPDATKAAGDAQFRAFSKNTFGSETAANPYHYGHLPEITVN
FT                   PDGTGSVRKHYCLGRISHELVQVMPDRRTVLMGDDATNGGLFMFIADKAADLSAGTLYV
FT                   AKWAQTSSAGAGAATLTWLNLGHATSAEIEALANQLKAADIMDVATKDPGDTSFTKINF
FT                   SGTFNWIRIKPGMTKAAAFLETHRYAAYAGGSMGFTKLEGTTVNAKDKVLYSAMSYIQK
FT                   SMVRGNAAASPDIALDRAINAGAVYALNLRGGQRDTSGAAIASEWVPVDMSAPAALVGE
FT                   DLAAADALGNTAHPDKIANPDNLKFSEKLRTLFIGEDSGMHVNNFLWAYNVDTQRLSRV
FT                   LSCPAGAESTGLHAVDEINGWTYVMSNFQHVGDWESPLHDKVKGVLDPLVRANYKDRFG
FT                   ASVGYLTAEPAAIQLKKA"
FT   gene            443996..444394
FT                   /locus_tag="BMA10247_0456"
FT   CDS_pept        443996..444394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0456"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05128"
FT                   /protein_id="ABO05128.1"
FT                   /translation="MRAVALAAIAAAALAGRKKPEEASAPPDNAASAAAHAARQTTQKL
FT                   DQVASFVNQQIEAAKQGVASAASAVPPVTASSVSAAAQGAASAVLGQAATAAGTSLEAA
FT                   GRKLQQWSQTAALGTSGASAASGAAASQ"
FT   gene            444484..444945
FT                   /locus_tag="BMA10247_0457"
FT   CDS_pept        444484..444945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0457"
FT                   /product="Rrf2 family protein"
FT                   /note="identified by match to protein family HMM PF02082"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04171"
FT                   /protein_id="ABO04171.1"
FT                   /translation="MNTSSRFAFAVHVLALLSLQEGVPLSSEVIAGSVNTNPALIRRLL
FT                   SMLAAAGLTASQLGAGGGALLAREPSRITLLDVYRAVDDAQLFALHREAPNPACLVGRH
FT                   IQGVLTDYIGDAQRAMEASLATRTLADVTADVLRSEAAGQPPRGQQAGG"
FT   gene            445212..445838
FT                   /locus_tag="BMA10247_0458"
FT   CDS_pept        445212..445838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01370;
FT                   match to protein family HMM PF05368"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07225"
FT                   /protein_id="ABO07225.1"
FT                   /translation="MKIALFGATGMIGSRIAAEAARRGHQVTALSRNPAASGANVQAKA
FT                   ADLFDPASIAAALEGQDVVASAYGPKQEEASKVVAVAKALVDGARKAGVKRVVVVGGAG
FT                   TLEVAPGKQLVDTEGFPDAYKAVALAHRDAYGYLSTVRDLDWTFFSPAALIAPGERTGR
FT                   FRTGAGRLIVDEQGNSKISAEDYAIAFVDEIEQGRFIRQAATAAY"
FT   gene            complement(446633..447287)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0460"
FT                   /note="putative cysteine dioxygenase type I, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:ABC39087.1"
FT   gene            447305..447901
FT                   /locus_tag="BMA10247_0461"
FT   CDS_pept        447305..447901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0461"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04554"
FT                   /protein_id="ABO04554.2"
FT                   /translation="MARGDVARVRYVFIPVDLEKRIPYCSLMRTMNRIIFYSLRTGEMD
FT                   AIDRKLLELLQEDATLPIAELAQRVNLSQTPCWKRIQRLKETGAIRAQVALCDPRRLGV
FT                   GTTVFVAVRTNQHTEEWAARFTQVVRDMPEVVEVYRMSGETDYLLRVVVADIDDYDRIY
FT                   KKLIRSVPLFDVSSSFAMEQIKYSTALPVRDGGAG"
FT   gene            complement(448030..448800)
FT                   /locus_tag="BMA10247_0462"
FT   CDS_pept        complement(448030..448800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0462"
FT                   /product="ferric iron uptake ABC transporter (FeT) family,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05897"
FT                   /protein_id="ABO05897.1"
FT                   /translation="MLLELNAVTLAYDTPRGRRTIVDRLSLALERGAIGCLLGASGCGK
FT                   TTVLRAIAGFEPVRAGEIVLAGAALASRDADVPPEKRRVGMMFQDYALFPHLSAQQNVE
FT                   FGLRRMPKGPRRARAAQMLELVGLADAANAYPHELSGGQQQRIALARALAPSPALLLLD
FT                   EPFSNLDVDTRERLAFEVRDILKAAGHTALFVTHNQAEAFALADRIGVIDDGRLAQWDT
FT                   PYNLYHRPANAFVADFVRRDALADERRRALERGR"
FT   gene            complement(448811..450523)
FT                   /locus_tag="BMA10247_0463"
FT   CDS_pept        complement(448811..450523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0463"
FT                   /product="ferric iron uptake ABC transporter (FeT) family,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06930"
FT                   /protein_id="ABO06930.1"
FT                   /translation="MTTEADARVARRAHAPVWARAGGRARLSRIAAHGWLAGAAAIAAV
FT                   VGTPLVALACAALGADLSHWRHLAEFVLPQAAANTLALLAGVGAIVTCVGTGAAWLVTA
FT                   YDFPGRRTLAWALLLPLAVPSYIVAFAYLDLLHPIGPVQSALRWALGFDSPREFRLPEL
FT                   RSLPGAIVVLGFVLYPYVYLCTRAMFVTQSASLVEAARTLGAGRIETFVRVVLPLARPA
FT                   IAVGASLALLETLNDVGASEFLGVQTLTVSVYTTWVTRSDLASAAQIALAMLAIVLGAL
FT                   ALERYGRRRERYAHGRRMRAIAPRRLRGAAAAGAAVLGWLPVAVGFGAPAAYLVHETAQ
FT                   RVHLVGGVSAQLLASLGNTLAVALTATVVTLGGGIVVAWATRRTRDSARFQPGRVCARL
FT                   ASVGYAVPGTVLAIGLLAPLALADRAIAAVLGRDALVLMGSAAALVIAYAIRFLAIPAG
FT                   GIEAGLARIPASLEQASRTLGESAGMTLRRVHLPLLRPALGASALLVFVDAMKELPATL
FT                   LLRPLNFDTLATWLYAEAARGTYEEGAVAALAIVAAGLAPVIVLARTQLKSGS"
FT   gene            complement(450513..451568)
FT                   /locus_tag="BMA10247_0464"
FT   CDS_pept        complement(450513..451568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0464"
FT                   /product="ferric iron uptake ABC transporter (FeT) family,
FT                   periplasmic iron-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06876"
FT                   /protein_id="ABO06876.1"
FT                   /translation="MFVKQARPLLRTLLRPLAFAFALAAVAPAAHAANEVNLYTTREPK
FT                   LIQPLVDAFTKQSGIAVNTVFVKDGLLERVKAEGARSPADVLMTVDIGNLLDLVDGGLT
FT                   QPVRSASLDGAIPANLRGAGGNWYALSLRDRVLYVDKNMQLDAITYESLADPKWKGKVC
FT                   VRSGQHPYNTALVAAMIAHDGEAAAEQWLRGVKANLARKATGGDRDVARDILGGICDIG
FT                   LANAYYAGHMKHAQPGTDARKWGDAIKVVRPTFANAKSGGTHVNVSGAAVAKHAPNRDN
FT                   AVKLLEYLASPPAQALYAQANYEYPVRAGVALDPVIAGFGPLKADPLPLVEIAKYRKRA
FT                   SQLVDKVGFDN"
FT   gene            451692..451811
FT                   /locus_tag="BMA10247_0465"
FT   CDS_pept        451692..451811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0465"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05208"
FT                   /protein_id="ABO05208.1"
FT                   /translation="MRIARKKTDESRRAQRTAVRMRLRVECRLDEFLMERDRR"
FT   gene            451808..451987
FT                   /locus_tag="BMA10247_0466"
FT   CDS_pept        451808..451987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0466"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04409"
FT                   /protein_id="ABO04409.1"
FT                   /translation="MNDPRSKKNPVFGVAILIVVVIALVIGTILYNAISQKHEYDEAHP
FT                   HAASAASAASAQHG"
FT   gene            complement(452129..453493)
FT                   /locus_tag="BMA10247_0467"
FT   CDS_pept        complement(452129..453493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0467"
FT                   /product="amino acid transporter, AAT family"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07259"
FT                   /protein_id="ABO07259.1"
FT                   /translation="MKNLQRHLSARHIRFLALGSAIGTGLFYGSASAIRLAGPAVILAY
FT                   IVGGAAVYMVMRALGEMAVREPVPGSFGHYATENLGPFAGFVTGWTYTLEMVIVAIADI
FT                   TAFGIYMGFWFPHVPQWIWVLAIVAIICGLNLCHVKVFGELEFWLSIVKVGAIVAMIGG
FT                   GAAILFTGMRLGSGGAPSLANLWSHGGFLPNGVGGLVASLSVVIFAYGGIEVIGMSAGE
FT                   AKEPERVIPRAINAVPMRILLFYVLTMIVLMSIFPWTGVGANGSPFVQIFSALGVRSAA
FT                   EILNLVVISAAISAINSDIFGAGRMMYAMALQGQAPRALAAMSARGVPWVTVLVMAGAL
FT                   LVGVVLNYLMPKDVFLMVAASATFATVWVWLMILLSQVAMRRRLGAAEVAALKFKVPFW
FT                   PVGPALTIAFMAFVIAMLGYFDDTRVALFVGAAWLAILALVFYTRIRPRLAAVAR"
FT   gene            complement(453490..453681)
FT                   /locus_tag="BMA10247_0468"
FT   CDS_pept        complement(453490..453681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07255"
FT                   /protein_id="ABO07255.1"
FT                   /translation="MSRPPPPFLSTVSRRARTQGFPDYCPRASIGMIYPAPSCLYNFSS
FT                   ASAGPHRPADDTNHSETR"
FT   gene            complement(453678..455954)
FT                   /locus_tag="BMA10247_0469"
FT   CDS_pept        complement(453678..455954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0469"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF05976"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06495"
FT                   /protein_id="ABO06495.1"
FT                   /translation="MRYSVEIRKFFYSQYFFGGLRIALGVSLPAVLSLAVLHDRELGFT
FT                   IATGALGACVVDMPGPLKYKHNEMLACSVIGFFSALATGLATPNIFALWLTIVPLTFVL
FT                   SLIVVYGNRWPQISFATLFMMVMTLEEKFTPLQALVNASWILAGGLWYTYWATIVSRWQ
FT                   ARRIEQQALAESLFACASYLLARADFYDLDADLDECYRNLVARQITAVETQETARDIVL
FT                   RNLPKLRRGKLDPGRTMMFNLFINSVDLHEMFVGAHTDYPLVRSTFGGSDLMIFYRDLI
FT                   RKASADLEEIGFAVLENRLPHSRISVKAELRAIEYEIELMRKKQFAATHPEAYAAVLAT
FT                   FRRIWSATRLIDKMRRNLSGSADAQRTELKIDKALTRFLQKRRMSPLLIFSNLNMGSPS
FT                   LRHALRVTIAVAVGFWLGRLLPLTNAYWIVMTSIIILKPGYSLTKQRNAQRIVGTLIGC
FT                   AASLALIYTVHEPHVLIAIMFGSMVISYSLLLFNYAASVVFTSSYVLLLFHLLAPGNMR
FT                   IIGERAIDTVVGCMIAIAASRLFPYWEYRAIGKLVADALATTRKYFEATWRAGRGKAAP
FT                   AVPAADGAAAVPAVAAVVDAVAPGLDGDYQYRLARKNVHIAFANLGQAFQRMMLEPKAH
FT                   QKFVPELNDLLVQTHVLGAQITAAAPLLRHACEQGNPPALERGMAAVREHLEQAEAGVP
FT                   PPANQAETSKQLTRELDSMVVDAERSDAGADLAHDLKVLAHQCKQMLASSLLIRKDASV
FT                   IRLPE"
FT   gene            455999..456598
FT                   /locus_tag="BMA10247_0470"
FT   CDS_pept        455999..456598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04799"
FT                   /protein_id="ABO04799.1"
FT                   /translation="MATSLSYFRVAKAVFRGRRSAFGVRRSAFGVRRSAFGVRRSAFGV
FT                   RRSAFGVRRSAFGVRRSAFGVRRSAFGVRRSAFGVRRSAFGVRRSAFGVRRSAFGVRRS
FT                   AFGVRRSAFGVRRSAFGVRRSAFGVRRSAFGVRRSAFGVRRSAFGVRRSAFGVRRSAFG
FT                   VRRSAFGLRPPCAPPVQRGERASRLRRMVPFSQAAE"
FT   gene            456838..460182
FT                   /gene="recC"
FT                   /locus_tag="BMA10247_0471"
FT   CDS_pept        456838..460182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recC"
FT                   /locus_tag="BMA10247_0471"
FT                   /product="exodeoxyribonuclease V, gamma subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="identified by match to protein family HMM PF04257;
FT                   match to protein family HMM TIGR01450"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04109"
FT                   /protein_id="ABO04109.1"
FT                   /translation="MLHLFYSNRHETLADALLDDLAFASDGAGPWAAQQVIVPSAALRR
FT                   RLELDLAKRHGVCANVRFSYLAQWLWAQIGEVLTVPAHSPFAPDRLVWRCYRLLSDHGA
FT                   APWRASPRLAAYLAAADAPMRHELAHRIATVFDHYLTYRPEWLAQWQDGESIFALEGAP
FT                   RHGGEAARDDEAWQAALWRALLAELSDSGMPPAHRFLREARAFDPDVIARARAKWPDAV
FT                   SVFALPTMPPLHIALLRELSRWIDVRIYALNPCREFWFDIVTAARAESLDAADRLDYQE
FT                   VGHPLLAEWGRQTQAQLHMLHELTESAAASDASRYADNPAPTWLARVQNAILDLQPEAA
FT                   LGEPPAERGVEVHVCHSLARQLEVLHDRLLAWFDADPSLAPSDVLVAMPDLATAGPLID
FT                   AVFGTPAGADAARIPYRITGLPPSQANPVARVLLDWLALPERDVGAPELVEWLRADAVA
FT                   ARYGIDATALETVQAWLAASGARRGLAPDAAEPPNPAVPAPRHTFADALTRLFLGYAMP
FT                   DGAAPVSTWLPIAGAEGGEAELLGRLARFTDDLDGFARRIARDLTPQGWGDVFADALAR
FT                   FFDSGPAFADALSGVRDALDAMLAAMAEGAAGAALPAAVVRAGLAAALDDPARGGVPWG
FT                   GVTFSSLTSLRGLPYRIVCLIGMDDGVLPSLARADEFDLMAVFAKLGDRQRRDDERNLF
FT                   LDLLLAARERLLIAYTGRSIRDNAPLPPAALVDELLDHLAAASAGPDAPPDAVDAARRA
FT                   FVIEHPLQPFSAEYFAPGGALFTYDASRATLARLLAEGARAQARPFFAAPLPAEPEQPV
FT                   AFADFERFWRHPARSLLRARLGIVLLDAQAELVDTEPFELDYAGSDALAERVLPLLIET
FT                   ADAAAFEHALRVADASPEVPGGATGAVRRDHALDALAQLAGNVRRALADGATRVPFAFD
FT                   VAPAWPAASDARWFGEHDAALAAAATREPLRLHGALARLTAAGQVIYRYARPGARDYLA
FT                   AWLAHLVYCAIDPGGPRRTLWFGSGDTFEFAPVAAPLEQLAPLAALFRAGRRMPLAFFP
FT                   RSAWALVSESESKAAGVWINDRVAGEADDASLALAWRGANPSLDEPFGALAHLVFDPLV
FT                   EHLRRAS"
FT   gene            460179..463991
FT                   /gene="recB"
FT                   /locus_tag="BMA10247_0472"
FT   CDS_pept        460179..463991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /locus_tag="BMA10247_0472"
FT                   /product="exodeoxyribonuclease V, beta subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="identified by match to protein family HMM PF00580;
FT                   match to protein family HMM TIGR00609"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05776"
FT                   /protein_id="ABO05776.1"
FT                   /translation="MSHVAPSGPSASELDVFACPLDGVNQIEASAGTGKTWNICALYVR
FT                   LLLEKDLGADEILVVTFTKAATAELHERIRARLAQLAHALDTGDDGGDPFIARLFETTL
FT                   APERGLDPQTAAKRVRRALRAFDQAAIHTIHAFCQRALQEAPFAAAMPFAFEMEADDGA
FT                   LRFELAADFWRTRVEPVAAAYPAFAEWLVEYGAGPAALDAQLARRLKKPLARLRWDGLH
FT                   AADDGAESAARAHFDTAAAIWRDERGVLGTLLADAQPSLNQRSHKPEAVSEALDAWARY
FT                   FEQASAVAALPRAALKLTQSALEKATKKGGATPRHAFFDVAQALEAAVAALEAAQRARW
FT                   LSLVEQWLDAAPAELAQRKRTRRVVSFDDLLANLYRALDAHPWLRETLRARYPAALIDE
FT                   FQDTDPLQFAIFDTIFAPAGPLFLVGDPKQAIYSFRAADLHTYLAARARASARYTLAVN
FT                   QRSTPAIVDACNRVFGANPRAFVLDGLDYEPVRAGSRVRAPLVDATDPLAGAGDFRIWT
FT                   LPAGDDVLTKRDAQRHAAHACAAEIARLMRGARERAVTLGGEPLAASGIAVLVQTHRQG
FT                   SLVKRVLAAWGIGSVELAQASVFATIDAEQLERVLAAIDAPGDLRRLRSALASDWFGLD
FT                   AAALWRLEQGDAEQDGIDAAARGASGNGGGARAASAGAPAPSPADADAMGWVERFSRYR
FT                   LLWRERGFAVMWRTLAGELRIAERLMAGADGERRVTDVNHLAELTQARASAQPGIAPTL
FT                   RWLAAQRLEGGGDDAQLRLESDRNLVQIVTVHKSKGLEYAIVFCPFLNDGGLREPAGSG
FT                   LPDAREYHDESGCAVLHYGCDDEAAERASREAVREQAAERARLVYVALTRAVYRCYLVA
FT                   GTYQSSRSTKEARRSVLNWLVAGAGRDFDAWLKEPPEDAELAERWQALAGGPVTLGALP
FT                   VPAHREPLAAGHDAQATRAARRATRGLRDAWRIASFSSLASAIARDESGIARAADDEMR
FT                   PDHDALAAALGADALEPPDAAAAIAPAPAAAPRELAEDDILAFPRGAAAGECLHRLLEL
FT                   SNFADASTWPPAALRALHERPVEAELALAERLPAMMTRLVADLAATELVPGMRLAALDP
FT                   ARRLTEMEFLFPAPALDFNALRRLLAAHGYPDVALEAGTLAGFVKGFIDMIVEHDGRFW
FT                   IVDWKSNHLGTTPEAYGERALDAAMAHHAYHLQALLYMVALHRYLRVRMRGYDYDAHIA
FT                   GYLYVFVRGVRPDWRNGGASAGVHARRPARALIEALDALMREGDA"
FT   gene            463994..466684
FT                   /gene="recD"
FT                   /locus_tag="BMA10247_0473"
FT   CDS_pept        463994..466684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="BMA10247_0473"
FT                   /product="exodeoxyribonuclease V, alpha subunit"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05484"
FT                   /protein_id="ABO05484.1"
FT                   /translation="MVDERFAWTGGLADRLPEPADFGLALAEGFARRIGMLSRRVGASA
FT                   AAARWAARAAFAASRATAAGHVCVALRALAQRDDEPYDDVRAALAASGVTAFDGIVRGG
FT                   ECPLVVDRDGRLYLARYFEYETRLANALVERSRCGGAPAGGADALSPDALGERLVRYFG
FT                   PQKERGVDWQRVAALIALTGRVTIVSGGPGTGKTTTVVGVIACLLDAHPDLRIALAAPT
FT                   GKAAQRMQEALHARAGSLPAELAARLPRTSCTLHRLLGGGPGGRFAHHRDNPLPYDLVV
FT                   VDEASMIDVALAAHLLDALAPNARLVLLGDKDQLAAVEAGAVFAELSARPAFSPATCAT
FT                   IARTLGVGEAEFVAALPDGFVVQAGGAERVADARAAAADMDAAARGTAGAAAAAARTTA
FT                   AAAARMTTAAAAATGAAPESAAQRAPAPHAGRRGGGRASNRTVDDAQGSLFAFDDDAFG
FT                   GGTSGGEPGAGAQGAGRRDGGAPSLDGPHAGHRDGGASPGVAHSRRDAFDARARSGSAD
FT                   VSDLENAARAYAPAGAAGPADSPADASFVEPAAWIEADELAWLDNAVFSFSEGASANAE
FT                   ADGRRSAAATATDAGARTAPPVAREATAPTPRETARSDGSAVAPLTDCVVWLERNYRFG
FT                   LDSPIGRLSLAIRRGAVQDALDALSTQDDAAARFSDDGGATLSAATVEQLARGFAGYAA
FT                   ALRDALATPEPDALPLFDVLNRFRVLCATRTGARGAEEVNARMAAEVRRAVRVPLALGA
FT                   HWFAGRPVMVTRNDYALGLFNGDIGIALPGARGALRVWFRGADGRARAVSPAALPPHDT
FT                   AFALTVHKSQGSEFDDAALILPASFNRVLSRELVYTAITRARARVQVIGSRAVLALAIA
FT                   TRTARDSGLAARIADALRARQEGAR"
FT   gene            466681..467085
FT                   /locus_tag="BMA10247_0474"
FT   CDS_pept        466681..467085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0474"
FT                   /product="peptidyl-tRNA hydrolase domain protein"
FT                   /note="identified by match to protein family HMM PF00472"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05222"
FT                   /protein_id="ABO05222.1"
FT                   /translation="MTLRYAFSPDEVELTAVRAQGAGGQNVNKVSSAIHLRFDIRASSL
FT                   PDDVKARLFARADQRITREGVIVIKAQEYRTQEKNRAAALARLDTLIRSAGVTPRKRVA
FT                   TRPTRASKERRLAEKGRRSEVKSGRGRVVE"
FT   gene            complement(467305..468753)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0475"
FT                   /note="cyclic diguanylate phosphodiesterase (EAL) domain
FT                   protein; this gene contains a frame shift which may be the
FT                   result of a sequencing error; identified by match to
FT                   protein family HMM PF00563"
FT   gene            complement(468925..469680)
FT                   /locus_tag="BMA10247_0476"
FT   CDS_pept        complement(468925..469680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0476"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06803"
FT                   /protein_id="ABO06803.1"
FT                   /translation="MRRIGEWSAPGGPQRRAADAIGRCRSCASRCELANGIRPPALQRL
FT                   SRRRSPHTRQTPFQREPLRTCERHSAASAATFVAPAFAAYARRRAAGHVTEHETARGRR
FT                   RRRQARRGRSPFSCRRPLDRATSRRERRSTPTTTTKSAANAPRRFTRSEPTGESASRRS
FT                   MQPAPHRKKREASLVSVCAAGPPGHDAARPAPWTHTARRAGRRPRGAPHPHRPRRDSAT
FT                   LRTEFKRIPDAHDASTFVTLDSIPHRTQK"
FT   gene            complement(469788..470720)
FT                   /locus_tag="BMA10247_0477"
FT   CDS_pept        complement(469788..470720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0477"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05738"
FT                   /protein_id="ABO05738.1"
FT                   /translation="MNLKNALLLIVLAALWGASFLFIRVGVAAFGVAPLMALRVDIGAL
FT                   FLVALMLTRYAPRELIALLRQHAWPLFVVGLLNSAAPFCLFAFAELTLSAGVTSVINAT
FT                   TPLWGALVAYLWLKDSLSLPRALGLVIGFAGVLTLVWDQVFSPHGANPASPATAALAAA
FT                   AALGATLLYGIAANFTKRKLTGVDPLVSATGSMVGATILLLPFALATWPAAPVSAHAWG
FT                   SVLALGIACTGVAYFIFFHLIAHIGPARAITVTFVIPVFGILWGALFLGERVSFAMLEG
FT                   CVIVLLGTALATGAIRRIPGVRPQRNETA"
FT   gene            complement(470991..471215)
FT                   /locus_tag="BMA10247_0478"
FT   CDS_pept        complement(470991..471215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0478"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03992"
FT                   /protein_id="ABO03992.1"
FT                   /translation="MNKTLVAAALASVALAGCYYPYGYYPASGYYAAPVQTAPVYVAPA
FT                   YPAYYYPAPSLSLNFGYWSGGGRGYWRHH"
FT   gene            complement(471467..471679)
FT                   /locus_tag="BMA10247_0479"
FT   CDS_pept        complement(471467..471679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0479"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04615"
FT                   /protein_id="ABO04615.1"
FT                   /translation="MKSIRRIGVCAMLIATMASLSACDTMTTRQRNAAIGAGIGGVAGA
FT                   AIGGNALSTIGGAAAGGLVGSQVGK"
FT   gene            471884..472147
FT                   /locus_tag="BMA10247_0480"
FT   CDS_pept        471884..472147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0480"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07104"
FT                   /protein_id="ABO07104.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            472171..473004
FT                   /locus_tag="BMA10247_0481"
FT   CDS_pept        472171..473004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0481"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06121"
FT                   /protein_id="ABO06121.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(473143..475074)
FT                   /gene="thiC"
FT                   /locus_tag="BMA10247_0482"
FT   CDS_pept        complement(473143..475074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="BMA10247_0482"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06415"
FT                   /db_xref="GOA:A3MIG6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MIG6"
FT                   /protein_id="ABO06415.1"
FT                   /translation="MNANPKFLSADARVDAAAVAPLPNSRKVYVTGSQPDIRVPMREIT
FT                   QADTPTSFGGEKNPPIYVYDTSGPYTDPDAKIDIRAGLPALRQRWIDARGDTETLSGLT
FT                   SDYGRERAADPATAELRFPGLHRHPRRAKAGKNVTQMHYARQGIITPEMEYIAIRENQR
FT                   RAEYLESLKASGPNGAKLAAMMGRQHAGQAFGAAAFGANAPAEITPEFVRDEVARGRAI
FT                   IPANINHPETEPMIIGRNFLVKINANIGNSAVTSSIGEEVDKMTWAIRWGGDTVMDLST
FT                   GKHIHETREWIIRNSPVPIGTVPIYQALEKVNGKAEDLTWEIFRDTLIEQAEQGVDYFT
FT                   IHAGVRLQYVPLTANRMTGIVSRGGSIMAKWCLAHHKESFLYEHFEEICEIMKAYDVSF
FT                   SLGDGLRPGSIYDANDEAQLGELKTLGELTQIAWKHDVQVMIEGPGHVPMQLIKENMDL
FT                   QLDWCKEAPFYTLGPLTTDIAPGYDHITSGIGAAMIGWFGTAMLCYVTPKEHLGLPNKD
FT                   DVKEGIITYKLAAHAADLAKGHPGAQVRDNALSKARFEFRWQDQFNLGLDPDKAREFHD
FT                   ETLPKDSAKVAHFCSMCGPHFCSMKITQDVREFAAQQGVSENDALKKGMEVKAVEFVKS
FT                   GSEIYHRQ"
FT   misc_binding    complement(475197..475314)
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); Rfam score 54.75"
FT                   /inference="nucleotide motif:RFAM:RF00059"
FT   gene            475724..476029
FT                   /locus_tag="BMA10247_0483"
FT   CDS_pept        475724..476029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02953"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04933"
FT                   /protein_id="ABO04933.1"
FT                   /translation="MKRNLIAFACVAGFALAAPFAHAQNDAMSKDGMGMSKDAMSKGAM
FT                   SGDAMSKDAMSKDAMSKDRMGKRHDHMAKGGMKAGPMSKDAMKEPMSSDKMSPMSN"
FT   gene            476190..477014
FT                   /pseudo
FT                   /locus_tag="BMA10247_0484"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF06764"
FT   gene            477005..478105
FT                   /locus_tag="BMA10247_0485"
FT   CDS_pept        477005..478105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0485"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06438"
FT                   /protein_id="ABO06438.1"
FT                   /translation="MRLNDARAIDQRTRVSPMSATPTTSASTTAMAGARASGAADAPAR
FT                   APTGADIDAGATAWAEANANATADATTDAMANVTTDAATRVTANPPIHETANVPASTAA
FT                   AATTEAVAGARAGAALDAAHPGATQTMSQTMAQTMAQTMTQAGTEAASPAGTDAAASGA
FT                   CITRATRARRPIHPLWVRASHWLNALAAVTMALSGWRIYNASPIYAGFVFPRGATLGGW
FT                   LGGALQWHFAAMWLLFFNGVFYLTMGVATGRFTRKLLPLSASGVARDLRDALRGRLSHD
FT                   DLSVYNALQRAAYVAAIADLALLVLSGLVIWKSVQFPLLREWLGGYDRARVVHFWAMAF
FT                   LVAFFVVHVAMAALVPRSLLAMLRGH"
FT   gene            478121..478912
FT                   /locus_tag="BMA10247_0486"
FT   CDS_pept        478121..478912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0486"
FT                   /product="oxidoreductase, molybdopterin-binding protein"
FT                   /note="identified by match to protein family HMM PF00174"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07185"
FT                   /protein_id="ABO07185.1"
FT                   /translation="MSENDRKKRENDIARIDRASLLIDVRKSLALPSRRLFGKRMLTLG
FT                   GLAMLTGCTLRDDASVDDFLEKVSRANDRVQAWLFGPTRLAPTYAEADITRPFPFNAFY
FT                   GIDDVPRVDADGFRLAVSGLVTGQRSWSLPALYALPHAEQITRHICVEGWSAIGRWGGT
FT                   PFREFLRRVGADTSAKYVGFKCADDYYESIDMATALHPQTLLAFEYDGKRLPPEYGFPM
FT                   KLRMPTKLGYKNPKHIVEIFVTNAYPGGYWVDQGYNWFGGS"
FT   gene            478943..479143
FT                   /locus_tag="BMA10247_0487"
FT   CDS_pept        478943..479143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0487"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05604"
FT                   /protein_id="ABO05604.1"
FT                   /translation="MAPSRVRATRAARRAGFAARRCASRFLAASARRSKKRKPRLAECR
FT                   MSRRNVTARAIDSNRHSFSIP"
FT   gene            479228..479362
FT                   /locus_tag="BMA10247_0488"
FT   CDS_pept        479228..479362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06373"
FT                   /protein_id="ABO06373.1"
FT                   /translation="MFAAARSDLSFRTPPSPVIPVFPAPLAGGRIARRSTARRFTRAG"
FT   gene            479366..480301
FT                   /locus_tag="BMA10247_0489"
FT   CDS_pept        479366..480301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0489"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04061"
FT                   /protein_id="ABO04061.1"
FT                   /translation="MTPFDRFLAFVARHPPRLPQSRSGRVALALVFIYFAWGSTYLALH
FT                   VALESFPPLLLSGLRNLLAGVGLFVFAMRRRPVRPTLVEIRNAALVGTMLVTMSSGLIA
FT                   LGMRTVSSGSAAVMVATVPLFATVIASVAGRRVTGGEWGAVALGMVGIVVLNSGGPSSP
FT                   GSTLGSITVLAGALFWAGGAHLAARLALPHDLFLSTALQIGLGGAASTCIAWVLGERIG
FT                   HVAWVPGAAFVYLMLAGTMAAYVAYGYLIRHTSPIIASSCMYVNPVVAVALGALLLGEP
FT                   VTAATVIATIAILGSVGLSFVFDPARRRAQ"
FT   gene            complement(480663..481859)
FT                   /locus_tag="BMA10247_0490"
FT   CDS_pept        complement(480663..481859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0490"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04817"
FT                   /protein_id="ABO04817.1"
FT                   /translation="MSSQPRHSAGTPGHYSRSLLLLLATIAGVSVANIYYNQPLLDAFR
FT                   ASFPGSASWIGVVPTATQLGYATGMLVLAPLGDRFDRRTLILLQIAGLSAALVVAAAAP
FT                   TLGVLAAASLAIGILATIAQQAVPFAAEIAPPAARGQAVGTVMSGLLLGILLARTAAGF
FT                   VAEYFGWRAVFAASVAALAALAAVIVARLPRSSPTSTLPYGKLLASMWQLVRELRGLRE
FT                   ASMTGGAIFAAFSAFWPVLTLLLAGAPFHLGPQAAGLFGIVGAAGALAAPYAGRFADKR
FT                   GPRAIISLAIALIAASFAIFALSGASLIGLVIGVIVLDVGVQAAQISNQSRIYALKPDA
FT                   RSRVNTVFMVCYFIGGAIGSSAGVAAWRATGWLGMCAVGLLFSIVAAIVHFRGGAGAR"
FT   gene            481867..482019
FT                   /locus_tag="BMA10247_0491"
FT   CDS_pept        481867..482019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04829"
FT                   /protein_id="ABO04829.1"
FT                   /translation="MGEARRAGGRAVRASIEINEGEMPRAPIIPEPSEFRRRAARPLGA
FT                   PLISP"
FT   gene            482174..482926
FT                   /locus_tag="BMA10247_0492"
FT   CDS_pept        482174..482926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0492"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03988"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06024"
FT                   /protein_id="ABO06024.1"
FT                   /translation="MLNKVPEVTLAFWIVKIMSTTVGETGADYLAVHVGLGAAVTGALT
FT                   ACLLVGALALQWRARAYVPWIYWLNIVLVSVAGTQITDALTDGLGVSLHVSTPLFAAAL
FT                   AATFALWYRSERTLSIHTIVTPRREGFYWAAILLTFALGTAAGDLATEALGLGFRLGIV
FT                   AFGGAIALVAAAALGGMNRVLAFWLAYILTRPLGASLGDFLSQAQAYGGLGLGTIRTSA
FT                   VFLAVIVALVAGLSVAAARAGRLGARGR"
FT   gene            483070..483480
FT                   /locus_tag="BMA10247_0493"
FT   CDS_pept        483070..483480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07214"
FT                   /protein_id="ABO07214.1"
FT                   /translation="MIKRKLIAFAAAPALALAAFGIGTVSPAGVAPSMAEAATVSKLGD
FT                   LSPFRAIAVDVAQRVDKGDLAGAKARIKDLETSWDDAEPSLKPRAAADWHAVDHAIDRA
FT                   LTALRADRPQAGACRQALADLLAVIDRPGGAR"
FT   gene            complement(483836..484663)
FT                   /locus_tag="BMA10247_0494"
FT   CDS_pept        complement(483836..484663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0494"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06454"
FT                   /protein_id="ABO06454.1"
FT                   /translation="MMLLAHISDLHIKRPGALAYRRVDTAAHLARCVARLNALEPRPDA
FT                   VLVTGDLTDFGDDDEYAHLKALLAPLAMPYYLLVGNHDDRAALRRAFPARVELQSGEFV
FT                   QYALDLGPLRVIALDSQIPGASGGTLCDARLAWLADQLDAARDRPVIVALHHPPFACGI
FT                   GHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGGTIASAVPAPAHQVTF
FT                   DLRDGGPSSFSMEPPAFAVHRHAPGAGLASHHVYVDASDGPHPFFEPTGTLID"
FT   gene            complement(484752..484886)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0495"
FT                   /note="Ser/Thr protein phosphatase family protein; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            complement(484886..485914)
FT                   /locus_tag="BMA10247_0496"
FT   CDS_pept        complement(484886..485914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0496"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04144"
FT                   /protein_id="ABO04144.1"
FT                   /translation="MKLDSVPITLTRCAKTFHGTRVLEPLDLAIGAGETLVLLGPSGCG
FT                   KTTTLRLIAGLDTPDAGGAIAFGADDVTALPIEKRGVGMVFQNYALFPNLSVRGNVGYG
FT                   LRIRRTEPRVLRERVDALLAMMRLTAHADKPIDALSGDQRQRVALARALAARPRVLLLD
FT                   EPLTALDAQLRDALRREMNALLRELGVTTVYVTHDQAEAMALGDRIVVMSAGAIEQIGT
FT                   PRDVYYRPASRAVARFIGTLNRLEGVWRDGALVTEGGALAVASPANELFFRPEDARLVD
FT                   PSDAPLRGAVAHCAFLGERTRVTIEHAAPDPLVIDVPGRVDLARGTAVGVAIAAEGLIA
FT                   LA"
FT   gene            complement(486068..487156)
FT                   /locus_tag="BMA10247_0497"
FT   CDS_pept        complement(486068..487156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0497"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06030"
FT                   /protein_id="ABO06030.1"
FT                   /translation="MHSTRRRTTDDRRARAAQAMSRRAAHLACALPVAARGAVISSSST
FT                   PPIILVDENVYIALRTPMTPPSKDAAALARPAAAAGPHAPPAVRRARRAPLDWLAAAQW
FT                   AVTLALCAFLIVPVAMSVLAGLTVNYFRGPSSGLTLRWLGEVWAQYHGSVFLSLEVALA
FT                   TLAVTLVAGVPAGYALARSRSRVSRLIEEALVLPVALPGLASALALLSVYGGFAAFRTS
FT                   LWFIVVGHVVFTLPFMVRAVAAVAARADLRTLEEGAASLGASFATRFATIVLPNLRPGI
FT                   VAGALAVLTLSIGEFNLTWMLHTPDTKTLPVGLADTYASLRLEIGSAYTILFLLMTLPL
FT                   LVAMQRLGVEPPGARDRTCKRR"
FT   gene            487398..487547
FT                   /pseudo
FT                   /locus_tag="BMA10247_0498"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            487738..487926
FT                   /locus_tag="BMA10247_0499"
FT   CDS_pept        487738..487926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07402"
FT                   /protein_id="ABO07402.1"
FT                   /translation="MEQCKRIHGGDNLIDGTFNLLGGTFTINSSSLSTLLTNANTLVVN
FT                   ANNWLTNPKGTLSSTKK"
FT   gene            complement(488188..489012)
FT                   /locus_tag="BMA10247_0500"
FT   CDS_pept        complement(488188..489012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0500"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06321"
FT                   /protein_id="ABO06321.1"
FT                   /translation="MSDLTLPSRWRIALLAPALAVFVAFWLLPMVSLVRVSAGGGFVDA
FT                   YLALLSNARYMKSLASTVALSAAVTLATLALSTIAGLLLARRAFAGKRALIALLTFPLA
FT                   FPGVVVGFMVIMLAGRQGLIGMLSQKLAGDRWVFAYSVSGLFVGYLYFSIPRVIVTVIA
FT                   AASKLDPSLEEAARSLGASRWHVLRDIVLPALAPGLVAAGAICFATAMGAFGTAFTLAT
FT                   DLDVLPMTIYTEFTLNANIATAAGLSIVLGIVTWAVLALARNLTGQATAASA"
FT   gene            complement(489100..490161)
FT                   /locus_tag="BMA10247_0501"
FT   CDS_pept        complement(489100..490161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0501"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05742"
FT                   /protein_id="ABO05742.1"
FT                   /translation="MTVRRSLLPRSPLAAVRRACAAMLIPVASLALSLGASAAHAQDTA
FT                   ICYNCPPEWADWAAQIAAIKQRTGIRVPFDNKNSGQAIAQLIAEQKSPVADVVYLGVSS
FT                   AFQAKDKGVVAPYKPAHWSDIPANLKDPQGYWFAIHSGTLGFFVNKDALDGKPVPRTWA
FT                   DLLKPEYKGMVGYLDPSSAFVGYAGAVAVNQALGGSFDDFRPALDWFRKLKANQPIVPK
FT                   QTAYARVLSGEIPILLDYDFDAYRAKYKDHANVEFVIPKEGTISVPYVMSLVKGAPHEA
FT                   NGRKVLDFVLSDEGQKLWANAYLRPVRAQALGADVAAQFLPASEYARAKSVDFGKLAAG
FT                   QQAFGKQYLQAMQ"
FT   gene            complement(490218..491234)
FT                   /locus_tag="BMA10247_0502"
FT   CDS_pept        complement(490218..491234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0502"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05615"
FT                   /protein_id="ABO05615.1"
FT                   /translation="MTPTIKDVAALAGFSIATVSRAINAPHTVHPATLEKIRAAIGALR
FT                   FRPNPLGRQLRSDRTQLIGVVLPTLANPVFAECLQGVDELATQAGFKLIVMSTEYDAAR
FT                   ERHAIETLRAQRVEGLMLTVADADAHPLLDELDRDGPLYVLMHNDTPHRPSVAVDNRRA
FT                   AYDGVRMLIERGHRRVLMLAGSLDASDRARLRVHGYAQALDERGLEPLPALELDFNAPA
FT                   LPHAMLAHLSARATRPTALFCSNDWLAMVVIRGLRDAHLAVPDDMSVLGFDGLAVGELL
FT                   APPLASVATPNREIGRAAWRRLAERIAGKRHAQPALTLPHAVRDGATVAPPRDARIA"
FT   gene            491182..491295
FT                   /locus_tag="BMA10247_0503"
FT   CDS_pept        491182..491295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0503"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05538"
FT                   /protein_id="ABO05538.1"
FT                   /translation="MAIEKPASAATSLMVGVMKREAEACKRFRRRDYRRRR"
FT   gene            complement(491881..492315)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0504"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(492575..492844)
FT                   /locus_tag="BMA10247_0505"
FT   CDS_pept        complement(492575..492844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0505"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06567"
FT                   /protein_id="ABO06567.1"
FT                   /translation="MLMSIRVGAGNLPHVRRLLHQVLGAALDIYTAVIDNQTGQASLQL
FT                   ELASTSVSDAMTSIMRVLPEAEFGKIRLSPRAPSARAPRMPPRG"
FT   gene            complement(492961..493194)
FT                   /locus_tag="BMA10247_0506"
FT   CDS_pept        complement(492961..493194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05788"
FT                   /protein_id="ABO05788.1"
FT                   /translation="MPDLNTRASRLQRQAAPPHAQPRGTQPAPCTPRGLRDFFVERGTL
FT                   YTESSRRFLECPSCSRRNRRGPSRIAARKIRI"
FT   gene            complement(493572..494726)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0507"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(495092..496456)
FT                   /locus_tag="BMA10247_0508"
FT   CDS_pept        complement(495092..496456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0508"
FT                   /product="diguanylate cyclase (GGDEF) domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04310"
FT                   /protein_id="ABO04310.1"
FT                   /translation="MIGTIARLYTACLLIGFALVPAFLIAYVRFFIDPRLVFENHQFHE
FT                   LAIAAATLEGLFVTYVTWRCYLASGEPLLRWLTLGFLGFALIYSLHGAFTGMAHQNIWL
FT                   FLLYGPASRLVMSILLLVGQLSYFRDADPPERRTHLSMWLPWIAGYVVVCFAVAAIAYS
FT                   PIAGHLWTRASMEGGAMIVSLVNVALLLVRRIRTPLMLVYGISVTSFALSSIAFILGKP
FT                   WNHMWWLAHAVFAGGFFMLSFGVVQALMTTRSFATVYSQQDLMARLAESMARTEGVLQE
FT                   LKRTNQKLEHLATTDPLTGASNRRKFIEQMQSEIARAKRDGTAFSLLALDLDNFKTIND
FT                   NYGHQVGDVVLRNFVRQCLAAIRPYDHIARVGGEEFMVLLPRMLADTASGIAERVRTTI
FT                   ANASFGIDGKHTPVTVSIGVSQYGRDGDTVDEILSAADKLLYRAKNEGRNRVVAS"
FT   gene            496469..496615
FT                   /locus_tag="BMA10247_0509"
FT   CDS_pept        496469..496615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0509"
FT                   /product="200 kDa antigen p200, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06809"
FT                   /protein_id="ABO06809.1"
FT                   /translation="MGCEDGAHGGLRNAVPGSKWEIRAGRRAASGRRAGSRAASFRCAS
FT                   CVV"
FT   gene            complement(496701..496814)
FT                   /locus_tag="BMA10247_0510"
FT   CDS_pept        complement(496701..496814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0510"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07194"
FT                   /protein_id="ABO07194.1"
FT                   /translation="MPSGPGAAIAPDRRTPFARGRANVSTPISRLAGAAQN"
FT   gene            497143..497745
FT                   /locus_tag="BMA10247_0511"
FT   CDS_pept        497143..497745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07040"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05655"
FT                   /protein_id="ABO05655.1"
FT                   /translation="MSYSLEGRILEVCDCKVLCPCWIGEDPDNGTCRATVAYHYDKGMI
FT                   DDVDVAGLTVAFAAFVPGNILQGNWRVIIFIDERATDAQFDALASVYRGERGGPLADFS
FT                   KLFGDIVAIERAPIDFDVRDGRGTLKVGNTTYAELEPYLGPTGEPTKLVESIFSTIPGS
FT                   PAYVGKAGTFRMRERKLGIELDLSGQNAIQGFFTFRS"
FT   gene            497798..498595
FT                   /locus_tag="BMA10247_0512"
FT   CDS_pept        497798..498595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0512"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05087"
FT                   /protein_id="ABO05087.1"
FT                   /translation="MLNATSPRRVFVPLAIASIVAAWGALWTWDSSPYARFLHPVDWSA
FT                   TSLAGLCRLVPAGGAIVPAALHAAAWLLMIVAMMLPTVLPLLRTFERLTAARPERNRLM
FT                   LLVVLGYLAAWSAFGLLAQAGDAGLHALARRAPWLAWHGWLVGAAVLALAGAYQFSPLK
FT                   YRCVDKCRSPLMFVSEQWRGGHPRRDSFALGLRHGLFCVGCCWMLMCVMFALGAGSVGW
FT                   MLAIGAAMAAEKNLPHGRRLSAPLGVALLGWAASIAVAGMGAA"
FT   gene            complement(498829..498954)
FT                   /locus_tag="BMA10247_0513"
FT   CDS_pept        complement(498829..498954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05536"
FT                   /protein_id="ABO05536.1"
FT                   /translation="MRFIPRSGPSALHATPDSPPALGEPRAGDPAVRRRPIVERP"
FT   gene            complement(498988..499626)
FT                   /locus_tag="BMA10247_0514"
FT   CDS_pept        complement(498988..499626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0514"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF04299"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04703"
FT                   /protein_id="ABO04703.1"
FT                   /translation="MYVPAHFEENRTDALHALIAQHPFGILVTHGDGGLDANHIPFELA
FT                   PGEGPLGVLRAHVARANPVWQQVSDGDEVLAVFRAGDAYISPNWYPSKHELHRQVPTWN
FT                   YVVVHAHGRIAVRDEASFVRGVVARLTRTHEAAQPVPWKIGDAPRDYIDTMLQAIVGLQ
FT                   IDITRLVGKCKLGQNKDARDIRGAGQALKARGDDAIGNRMLAKAAEKPE"
FT   gene            499748..501289
FT                   /locus_tag="BMA10247_0515"
FT   CDS_pept        499748..501289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0515"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07057"
FT                   /protein_id="ABO07057.1"
FT                   /translation="MARRARIIEIPSLGMLERTAGNLSRQLAQALRDAVRRGEVMPGDA
FT                   LPSTRLLAASLRIARGTVIDAYEQLIAEGFLESRGGVGTRVAPALAEPRGARRRAAAAA
FT                   RSALPPPAAEYARVAREFAPLPPAPFAISVPAGATAPDDVWRRLGNRLRARGPAAPAGY
FT                   SDPLGVRALREAIAGYVRKSRSVHCAPDQIIVTSGAQQGLYLACQVLLGAHDRAWVENP
FT                   AYRGLTAILECTGRRDAMVRVPVDAEGIDVDAGVRLARDARAAFVTPSHQYPLGMPMSM
FT                   ARRAALLAWARASGAWVVEDDYDSELRYEGYPFPSLQGLDPARVVYLGTFSKILFPSLR
FT                   LGYLIVPDELVDALRGARVLMDRHAPTADQHVLAAFIAGGHFDRHIRRVRGVYAEQRAQ
FT                   LIDTVGRLLSGDLAWLQPGDQGMHAVLWLAAGVDDLRVAAMAAQAGVAVRPVSPMFAPG
FT                   TARPGLVLGFGGFGREQMDAAARRLAEVIAAASGSAVPRAGAGRRRRDGAGGTDA"
FT   gene            complement(501528..502022)
FT                   /locus_tag="BMA10247_0516"
FT   CDS_pept        complement(501528..502022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0516"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06298"
FT                   /protein_id="ABO06298.1"
FT                   /translation="MAYSLDELNLRILAALQADASLSNLALAEHALSSPPTCMRRVRKL
FT                   TEAGIIERRIAVLDRGRIGTSVTAIIEIGLDRQTAEDYDAFEAYACAQPEVTQCYRVSP
FT                   GPDFVIVADLADMAAYDEFARRLFTHASNVRNVRTFFSTHRAKFEANAPVRATPGKRAG
FT                   G"
FT   gene            502181..504097
FT                   /gene="glmS-1"
FT                   /locus_tag="BMA10247_0517"
FT   CDS_pept        502181..504097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS-1"
FT                   /locus_tag="BMA10247_0517"
FT                   /product="glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04314"
FT                   /protein_id="ABO04314.1"
FT                   /translation="MCGIVGAVARRDVVPNLVDGLKRLEYRGYDSCGVVVYQDRRLVRA
FT                   RSVDRVAALQREISARALSGYTGIAHTRWATHGAPVTANAHPHFSSGVATPGVATSGAP
FT                   AASAAASGGTAQADASPEARARIALSHNGIIENYEALRADLERHGYAFASQTDSEAIAH
FT                   LVDHLYDGDLFDAVRRALARLRGSYAIAVMCRDEPHRIVGARDGMPLVVGIGDGEHFLA
FT                   SDAIALSNLTDRIAYLENGDVVDIQLHRHWIVDASGRRVERTVHTIAAHVAAADLGGYR
FT                   YYMQKEIFEQPRAVADTLLDVTSIMPELFGDRAWRALSAADSVLLLACGGSYHAALTAK
FT                   YWIESIAGLPANVEIASEFRYRDGVPNPKALVVAVSQSGETADVLGAVHAAKRLGMPNT
FT                   LAICNVPTSALVRECASSFITRAGIEVGVASTKAFTTQLVALFLLTLALAQVRARLSDE
FT                   DEKRHLHALRHLPEAMSKVLALEPRIIAWSERLARRENMLFLGRGMHYPIALEGALKMK
FT                   EISYIHAEAYAAGELKHGPLALVSDEMPVIAVAPNDRLLEKLRSNMHEVSARNGRLFVF
FT                   ADVDCAIASAPGLDVIRLTEYYGPLSPILHAVPMQLLAFHAALARGTDIDKPRNLAKSV
FT                   TVE"
FT   gene            complement(504316..505647)
FT                   /locus_tag="BMA10247_0518"
FT   CDS_pept        complement(504316..505647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0518"
FT                   /product="putative carotenoid 9,10-9',10' cleavage
FT                   dioxygenase"
FT                   /note="identified by match to protein family HMM PF03055"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07095"
FT                   /protein_id="ABO07095.1"
FT                   /translation="MTTIDLNAGALAPVADEIDAVDLRVTGALARELNGVLVRNGPNPL
FT                   RGRFDGGDVLSWWPQDAMLHAISFDDGRATRYRNRWARTRRWARVHDPAREPSLVDTNP
FT                   NVNVLAHAGEILALAEGGAPLAITAGLDSIGAARRHPGLAHGMAAHPKVDPHTGELIAF
FT                   RADWNRPWLRYLVADAAGAQTVDTEIALPAPSMMHDIAITATHSIVFDLNVAYDFSMLS
FT                   RGHRMPLRWHDARGARIGVVPRRGGDARWFDIAPCFIQHVVNAYDLDRPAIVLDVVRYP
FT                   WFLRVARDGRGFDDNPPGVLWRYVIDLVTGTVAEQPLDDAGIELPRIDARRTGRRHRFL
FT                   YAAEQPTPVELRGIVRYDLDGGSTQRYRVPPGDQNSEPVFVPRPGAAGEDDGWLLVCVY
FT                   RHATDTSDVVILDGRSIGDGPIATVHLPRRVPAGFHGAWLPAGA"
FT   gene            complement(505669..506370)
FT                   /locus_tag="BMA10247_0519"
FT   CDS_pept        complement(505669..506370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05712"
FT                   /protein_id="ABO05712.1"
FT                   /translation="MTSFALPSHIAFDGYRRLAAGPLPTVALAVKRAIANDAIGGALLI
FT                   FDNATGRSIDIDTRGSDDEVAARYAPAASADIAPGAAAGAHRERAADLADAAGTSNAAD
FT                   ADPLAPEPPRGRGRPKLGVVAREVTLLPRHWAWLATQPGGASVALRRLVDEARRAHAHK
FT                   DRSRRAQERAYHFMSAIAGDMPGFEEASRALFANDAARLRAQIAGWPADVRDHALALAS
FT                   PDDGAPLPEVR"
FT   gene            complement(506537..507436)
FT                   /locus_tag="BMA10247_0520"
FT   CDS_pept        complement(506537..507436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0520"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04955"
FT                   /protein_id="ABO04955.1"
FT                   /translation="MDRIDLFRVFARVVECANFTRAADTLGMPRSSVSAAIQELEGRVG
FT                   ARLLHRTTRKVTPTQDGAALYERCLRLIADVEEAENLFRHSIVGPSGTLRVDMPGRIGR
FT                   LIVAPALPEFLERYPQISVELGVTDRAVNLIEERVDCVLRVGTLSDSGLVARAIGDLPL
FT                   INVASPAYLARHGVPRTPADLERHRPVNYASPSNGRVAPWEWVEGDEVKRVALRARVTV
FT                   NSAEAYIACCLAGLGLIQIPAYDVNAHLRAGELVEVLPDHRAAPMPMTLLYPHRQHLSR
FT                   RFQVFAEWLEALLRAKVL"
FT   gene            507687..508460
FT                   /locus_tag="BMA10247_0521"
FT   CDS_pept        507687..508460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0521"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06534"
FT                   /protein_id="ABO06534.1"
FT                   /translation="MADHSIKGKTVIIAGGAKNLGGLIARDLAAQGAQAVAIHYNSAAS
FT                   KGAAAETVAAIEAAGARAVALQADLTAAGAVEKLFVDTVAAIGRPDIAINTVGKVLKKP
FT                   FVEITEAEYDEMAAVNSKTAFFFLKEAGRHVNDNGKIVTLVTSLLGAFTPFYAAYAGMK
FT                   APVEHFTRAAAKEFGARGISVTAVGPGPMDTPFFYPAEGADAVAYHKTAAALSPFSKTG
FT                   LTDIGDVVPFIRHLVSDGWWITGQTILINGGYTTK"
FT   gene            complement(508678..510441)
FT                   /locus_tag="BMA10247_0522"
FT   CDS_pept        complement(508678..510441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0522"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07306"
FT                   /protein_id="ABO07306.2"
FT                   /translation="MTTRAPGLRTRVRKAPQAGARGASARPMRAANRRLGGAFVASRGA
FT                   AARFATQPKERRARRGAGASCCRAPRKTIIAGSPCHLVGPCHMREGHAGRRAGSSAQAA
FT                   PPGRARRPRRARATASAGSRRTWPASLNDAMPNRFRPFPAPSAVAVAAVLSACSSAPKP
FT                   LYQQEQFDATTSPYARTFHEKSAATCEAARRALLSQGYMASATRPDAVDGSKNFQPSND
FT                   SHVVIEFHVVCAEADVDGASSIAYVNAVQDRYSLKKSNTSASVGLSVFGSLSLPIGSSD
FT                   DAMVKIASETIPAGVFYERFFNLVDHFLKIDPTRRDKAAVKAAEKERVAPLPEPAETAE
FT                   GAPMKLKTPAAPTPPAAPVPASSAAPGTSASSAVAAPAAAGSGPAASAPAAPVRHAAPA
FT                   PASATAAASAPTAASAPAPTPASAPAPASTPAPASAPTPTPASAPTPASIPAPAPASAP
FT                   ASTPAPASAPAPAPTTSPASSIAPTAAPFASAIPPARAEKFAPAVTATTAGSTSTPASA
FT                   AAPSSPSSPWLPPLLPPLLSPDAPSPPADTARTAPLAPAASPATAAAAATNATATAGAM
FT                   QSAPRDDAATN"
FT   gene            complement(510044..510466)
FT                   /locus_tag="BMA10247_0523"
FT   CDS_pept        complement(510044..510466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0523"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05656"
FT                   /protein_id="ABO05656.1"
FT                   /translation="MRRPVAQADDDAGTRLAYASTQSAAGGRARRVRAADAGREPPARR
FT                   RVRRFSRRGRPLRNAAERTARAARRGGFMLPRTQKNYNSRLAMPPRRPMPHARRPRGPP
FT                   RRFVRASRAARPCAPAASSPRNCLRRIAPHVAGLFE"
FT   gene            complement(510494..510901)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0524"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF06073"
FT   gene            complement(510898..512799)
FT                   /locus_tag="BMA10247_0525"
FT   CDS_pept        complement(510898..512799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0525"
FT                   /product="nitrite/sulfite reductase family protein"
FT                   /note="identified by match to protein family HMM PF01077;
FT                   match to protein family HMM PF03460"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04220"
FT                   /protein_id="ABO04220.1"
FT                   /translation="MVILAPPMRRLATDTRDRARAAPPHCPAMYRYTEFDKAFVRNRAA
FT                   QFRDQLERWRQGALSEDAFRPLRLQNGWYVQRHAPMLRVAVPYGELSSAQIRMLARIAR
FT                   DYDVPEPARYRAACDAQARLGTVRLPTRNAHFTTRTNVQFNWIPLEKAADVMDLLATVD
FT                   MHGIQTSGNCIRNISCDERASVAPDEIADPRPFAEVMRQWTTLHPEFAFLPRKFKIAIT
FT                   GAADDRAATDWHDVGLRLVRDAAGELGFRVSVGGGMGRTPMTATLVRAFVPWRHVMNYI
FT                   EAIVRVYNRYGRRDNRYKARIKILVKAEGQRYIDDVDEEFRQIVEHDGGPHTIEQAEFD
FT                   RVCASFVPPVPPPCAAGRHAKTDIDADMDAALARMRTLAGAQPAFARWLERNVAPHRDP
FT                   ARRIVTLSFKRRHQAPGDASPEQLDALAHLAERFSAGEARVTHAQNVVLPWVRAIDLHA
FT                   LWEAARDAGLASANVRLLTDMIACPGGDFCALANARSIPIADAIAERFDDLDELHDIGD
FT                   VDLHVSGCINSCGHHHSGHIGILGVDKDGDEWYQVTLGGSDGTAANGPAQPGKVIGPSF
FT                   SADEIVDVVDALVATYLRVRRTEAGRVERFIDAYRRVGPEPFKAAANAARHPETSVA"
FT   gene            513233..513421
FT                   /locus_tag="BMA10247_0526"
FT   CDS_pept        513233..513421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0526"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05283"
FT                   /protein_id="ABO05283.1"
FT                   /translation="MSLARMMRMVLWSFFGVRKGAGHQADLASVKLPWVPVMAILLAAC
FT                   FGGLLFGLAKVAITVIH"
FT   gene            complement(513498..514979)
FT                   /locus_tag="BMA10247_0527"
FT   CDS_pept        complement(513498..514979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0527"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06094"
FT                   /protein_id="ABO06094.1"
FT                   /translation="MSMKRYETLARAMADDIRSGNITTGTRMPSLRQMIAQHRVSQSTV
FT                   FRAYYLLEQWGLIRARERSGYYVAHGAQASVRANGMNGMNGAHATQDGRLTRDAAPAES
FT                   RKVDISDLVFSVLEAATHPRIVPLGSAFASPHLFPLPRLAKSLAQAARLVSPWSAVVDL
FT                   PPGSEQLRRQIALRYLGIGVSQPIDEIVVTNGALEALNLCLTAVTRPGDVVAVEAPGFY
FT                   AALQAIERLDLRAVEIPVDPRTGLDLDALAAALERHDVRACWFMTNFQNPTGVTLSADK
FT                   KKALVDMLAAREVPLIEDDVYGELHHGPDYPLPARAFDKHGLVMHCSSFSKTLAPGYRI
FT                   GWAAAGRFAEKVQRLKLMTTLSASIPAQVGIADYLEHGGYDRHLRKLRGALRGQMERMN
FT                   DALMRHLPPDVHWTLPDGGYFVWLEFPDAIDAMGLHREAIRRGVSVAPGPLFSAAHAFE
FT                   RCVRINFGHPWSAAVDDAIRTVGELVAQPSVRKRR"
FT   gene            515125..515319
FT                   /pseudo
FT                   /locus_tag="BMA10247_0528"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(515678..516079)
FT                   /locus_tag="BMA10247_0529"
FT   CDS_pept        complement(515678..516079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0529"
FT                   /product="heat shock protein, Hsp20 family"
FT                   /note="identified by match to protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05053"
FT                   /protein_id="ABO05053.1"
FT                   /translation="MNTRNPAAERPSAVPARRDAGDAPRALTVTPAVDVYEDKHGVTLW
FT                   ADLPGVSKERLEVKIQDGHLSIDAHAALPMPASLRAQHVEVREPHFARTFQLSPDFDTT
FT                   KIEANLQDGVLKLTIPRRDEARPRRIDVQ"
FT   gene            complement(516111..516548)
FT                   /locus_tag="BMA10247_0530"
FT   CDS_pept        complement(516111..516548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0530"
FT                   /product="heat shock protein, Hsp20 family"
FT                   /note="identified by match to protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06046"
FT                   /protein_id="ABO06046.1"
FT                   /translation="MSDLYFGADLFSEFDRLHRQMANLFGGFPSSIRASRLGGFPALNV
FT                   GTTEDSIEIVVFAPGMRAADFDVSIDKGLLAISGERKAAQRAEGEVRAYAQERFSGAFR
FT                   RVVELPQNADPDKIRARYENGCLLISVGKREASKPRAITVQ"
FT   gene            complement(516712..517368)
FT                   /locus_tag="BMA10247_0531"
FT   CDS_pept        complement(516712..517368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0531"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05481"
FT                   /protein_id="ABO05481.1"
FT                   /translation="MRPGSNVSRRRCPASALAAPRHCDAAQQRRPIALSRQVISTHALA
FT                   HARHACAHSRQCACACLSHSRAQASQMSAHSLQTSPARALRLAIAPDANRHINAQSTSS
FT                   RTQAARPDASGSRRHATAHWSHARAHASHARMHASYRSFIVRSLLSDIGTDARNPRARR
FT                   HASAIRLRRYGSDTVSTPFQHGPDTEGASRPEPFPPARGPHATRVAHARDAPPEK"
FT   gene            complement(517599..517817)
FT                   /locus_tag="BMA10247_0532"
FT   CDS_pept        complement(517599..517817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0532"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05850"
FT                   /protein_id="ABO05850.1"
FT                   /translation="MRAMRAGAGFHRGARAFGRAPGASVASVASVASGASGASAASGAS
FT                   GAAGAAGAAGAAGEPRPPRMLRARHRY"
FT   gene            518200..520050
FT                   /gene="pckG"
FT                   /locus_tag="BMA10247_0533"
FT   CDS_pept        518200..520050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckG"
FT                   /locus_tag="BMA10247_0533"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="identified by match to protein family HMM PF00821"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06422"
FT                   /protein_id="ABO06422.1"
FT                   /translation="MVAATRTVPIDVPEYVKHRGLIDWVARIAELTEPDRVVWCDGSQQ
FT                   EYDRLCDAMVEQRTMVRLNPAKRPNSFLALSDPSDVARVEDRTFICSEHRDDAGPTNHW
FT                   VAPAEMRATLNGLFRGAMRGRTLYVVPFSMGPLGSPIAHIGVELSDSPYVVVNMRIMTR
FT                   MGRAVLDALGERGEYVPCVHSVGRPLAAGEQDVPWPCNPTKYIVHFPESREIWSFGSGY
FT                   GGNALLGKKCFALRIASTMGRDEGWLAEHMLILGVTSPEGRKYHIAAAFPSACGKTNFA
FT                   MLIPPKGFEGWRVTTIGDDIAWLKPGRDGRLYAINPEAGYFGVAPGTGEKTNPNALATL
FT                   RENVIFTNVALTEDGDVWWEGLTDTPPARLTDWQGNAWTPEIGRETGRKAAHPNSRFTA
FT                   PASQCPSIDDDWENPGGVPIDAFIFGGRRSTTVPLVTEARDWIEGVYMAATMGSETTAA
FT                   AAGQQGIVRRDPFAMLPFCGYNMSDYFSHWLALGEKLAAAGATLPKIYCVNWFRKDADG
FT                   RFAWPGFGENMRVLKWMLDRIDGRGEGVEHAFGVTPRYEDLHWAGLAFSPAQYAQVTSM
FT                   NPDEWRAELALHAELFDKLSARLPDALAETKARIEKRLGG"
FT   gene            520345..521262
FT                   /pseudo
FT                   /locus_tag="BMA10247_0534"
FT                   /note="3-hydroxyacyl-CoA dehydrogenase NAD binding
FT                   domain/C-terminal domain protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00725; match to
FT                   protein family HMM PF02737"
FT   gene            complement(521833..522693)
FT                   /locus_tag="BMA10247_0535"
FT   CDS_pept        complement(521833..522693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0535"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04608"
FT                   /protein_id="ABO04608.1"
FT                   /translation="MGLAMRPLPPELLRSFVAVAQTGSFTAASERVSLSQSTVSQHIRR
FT                   LEELLDRPLFERDTRNVRLAPSGEALFRYAVRILALMDEAVASVCGPPLSGKVRLGLSE
FT                   DFALTHLTAALASFVQRNPEVELEIATGLSGDLFDALDAGRHDLVFAKRIAGSRRGRVI
FT                   RTEPLYWCAGPASPLTGREPVLPLALHPQPSVSRQRVLETLDAIGRPYRIAVASTSIAV
FT                   LRAAASAGLGISAFAGYVIPHGLAKLEAGLPPLGELEYVIDRPANASRPALALEATLVA
FT                   AAHEF"
FT   gene            522952..523347
FT                   /gene="madL"
FT                   /locus_tag="BMA10247_0536"
FT   CDS_pept        522952..523347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="madL"
FT                   /locus_tag="BMA10247_0536"
FT                   /product="malonate transporter, MadL subunit"
FT                   /note="identified by match to protein family HMM PF03817;
FT                   match to protein family HMM TIGR00807"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05271"
FT                   /protein_id="ABO05271.1"
FT                   /translation="MIIYGTALLAFCHLAGLFIGDLLGAAIGAKTNVGGVGIAMLLLIG
FT                   LRLALHRRGWLPEETEAGIAFWGAMYIPVVVAMAANQNVVAALKGGPVALLSAVGAVAV
FT                   CVLSIAALARVGHDATSLAALPRPEQN"
FT   gene            523361..524128
FT                   /gene="madM"
FT                   /locus_tag="BMA10247_0537"
FT   CDS_pept        523361..524128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="madM"
FT                   /locus_tag="BMA10247_0537"
FT                   /product="malonate transporter, MadM subunit"
FT                   /note="identified by match to protein family HMM PF03818;
FT                   match to protein family HMM TIGR00808"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05833"
FT                   /protein_id="ABO05833.1"
FT                   /translation="MIDMLGKVVAHNGLVASFALVGCVMFASAALSRKLTLGRVHGSAI
FT                   AIVIGLALAYAGGAYTGGEKGIADVPLFAGVGLMGGAMLRDFAIVATAFEVQPAQARKA
FT                   GLVGAVSLLLGTVLPFIVGASVARAFGYSDAVSMTTIGAGAVTYIVGPVTGAAIGASSD
FT                   VIALSIATGLVKAVIVMVGTPFAAGFMGLRTPRAAMIFGGLAGTVSGVSAGLAATDRRL
FT                   VPYGALIATFHTGVGCLLGPSLLFFATKAAMGG"
FT   gene            524149..524457
FT                   /locus_tag="BMA10247_0538"
FT   CDS_pept        524149..524457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0538"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06623"
FT                   /protein_id="ABO06623.1"
FT                   /translation="MALFRESARDIACGNEAARAARGGTRGFDPERGANDTNDANDAND
FT                   ANDANDANDAKAACAAFAPRSIARATESYRATSSIAPAVRLTMPQNQPGRISQETIL"
FT   gene            524454..526094
FT                   /locus_tag="BMA10247_0539"
FT   CDS_pept        524454..526094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0539"
FT                   /product="putative malonate decarboxylase, alpha subunit"
FT                   /note="identified by match to protein family HMM TIGR01110"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04273"
FT                   /protein_id="ABO04273.1"
FT                   /translation="MTGWNEARAARAARLAAAAPLARGKRVAARDATALLEAVLRPGER
FT                   VCIEGDNQKQADLLAAALAAVDSAKVHGLHMVQSGVVLPEHLDVFERGIAKRLDYAYSG
FT                   PQSQRIAKLLFGGGIELGAVHTYLELFARYFIDLTPHVALIAAVSADGNLYTGPNTEDT
FT                   PTVVEATAFKDGIVIAQVEKIVERVPRVDIPGDRVHFVVEAGRPFYVEPLFTRDPAGIT
FT                   ETQILTAMLAIKGIYARYGVKRLNHGIGFNTAAIELLLPTYGERLGLKGQVCTHWALNP
FT                   HPTLIPAIESGWVEQIHCFGSEVGMDDYIRARSDIFFTGADGSLRSNRAFCQTAGLYAC
FT                   DLFIGSTLQIDLAGHSSTVTAERIAGFGGAPNMGSDARGRRHPSEPWLKAGEEADARTP
FT                   AALRRGRKLVVQIGETFGEKNAPMFVEQLDALRLADKLALDLAPVMVYGDDVTHVVTEE
FT                   GIANLLMCRDADEREHAIRGVAGYTEIGRGRDRRLVERLRERGVIRRPEDLGIDALDAD
FT                   RRLLAARSIKDLVHWSEGLYEPPARFRNW"
FT   gene            526108..526425
FT                   /gene="mdcD-2"
FT                   /locus_tag="BMA10247_0540"
FT   CDS_pept        526108..526425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcD-2"
FT                   /locus_tag="BMA10247_0540"
FT                   /product="malonate decarboxylase, delta subunit"
FT                   /note="identified by match to protein family HMM PF06857;
FT                   match to protein family HMM TIGR03130"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05050"
FT                   /protein_id="ABO05050.1"
FT                   /translation="MEQLNYRHTARARAKGDAEWALVGVVASGNLEVLVERVLPGNECE
FT                   VDIRTAAVGFGDVWQAVVADFVERRSPGGLRLSVNDGGARPDMVSLRLAQAVRAIEANA
FT                   R"
FT   gene            526422..527369
FT                   /gene="mdcD-3"
FT                   /locus_tag="BMA10247_0541"
FT   CDS_pept        526422..527369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcD-3"
FT                   /locus_tag="BMA10247_0541"
FT                   /product="malonate decarboxylase, beta subunit"
FT                   /EC_number="4.1.-.-"
FT                   /note="identified by match to protein family HMM TIGR03133"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06263"
FT                   /protein_id="ABO06263.1"
FT                   /translation="MNAAATTLHPKLAPAGASWFEASARQRLAGLVDAGSLDEFAGPPA
FT                   RLASPHLPLFDLPQQFDDGMIVGRATLAGEPVFVAAQEGRFMGGAFGEVHGAKLTGLLR
FT                   AARELRAAPVLILFDTGGVRLQEANAGEIAVSEIVRAVIDARAAGVPVVGLVGGRAGCY
FT                   GGGGIIAACCSALAVSEAGRIGVSGPEVIESRRGVDEFDSRDRALVWRTMGGKHRRLVG
FT                   GADAFVDDTIDAFRHAAIALLARVRAGGAFGTATLEAEHARLAARIARFRDCDDALDVW
FT                   RALGAPDAGAIPALDAAAFAALADRLTEVCDDAR"
FT   gene            527356..528081
FT                   /gene="mdcC"
FT                   /locus_tag="BMA10247_0542"
FT   CDS_pept        527356..528081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcC"
FT                   /locus_tag="BMA10247_0542"
FT                   /product="malonate decarboxylase, gamma subunit"
FT                   /note="identified by match to protein family HMM PF06833;
FT                   match to protein family HMM TIGR03134"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07050"
FT                   /protein_id="ABO07050.1"
FT                   /translation="MTLDDVLASLFPSGHDVAADAAGLLAGHGMLAGRALDVIGVAHGA
FT                   ALGVDGALALAERVLATIRRGGETPILVLVDGDSQRMSKRDELLGLNECLAHLAKCLLH
FT                   ADALGHPTIGLLYGHAAAGAFIATALATRTLVALPGAQPEVMDLQAISRVTKLPVDVLR
FT                   EKARSTAVFAPGLENFAKTGAVDAVLDPARPLAEQLAAVLARPADRCDRRDRYGAERGG
FT                   RPVAADVAQRVYELARAGR"
FT   gene            528056..528982
FT                   /gene="mdcG"
FT                   /locus_tag="BMA10247_0543"
FT   CDS_pept        528056..528982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcG"
FT                   /locus_tag="BMA10247_0543"
FT                   /product="mdcG protein"
FT                   /note="identified by match to protein family HMM TIGR03135"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07117"
FT                   /protein_id="ABO07117.1"
FT                   /translation="MSSRAPAADAPLVRHTLVRVRAQAWPALLAAHGGIGTLPFVRDWA
FT                   ARGWPLIVRRRSPCDAGVPLGLPLPPSEGKRRVALAAAREQIDSACALPTLADVGRQAP
FT                   PAWRPTLARLRALADAHRVDCRVFGSLAWQTLTGLRYLSDESDLDVLLMPCGASSSASL
FT                   FRFSSSFASSFASVSVSPSSPSVSIPQSSRAWPVPALASASSSAAVTGAEASAPMTAQM
FT                   EASASRLSRWPGSSSMPSRRDAIAPFLAALAEIDADAPMRIDGELLCADGAGVNWRELH
FT                   AGGRAVAMKTATGVELVAPRTFLEAWR"
FT   gene            529168..530238
FT                   /gene="mdcB"
FT                   /locus_tag="BMA10247_0544"
FT   CDS_pept        529168..530238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcB"
FT                   /locus_tag="BMA10247_0544"
FT                   /product="triphosphoribosyl-dephospho-CoA synthase MdcB"
FT                   /EC_number="2.4.2.52"
FT                   /note="identified by match to protein family HMM PF01874;
FT                   match to protein family HMM TIGR03132"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04369"
FT                   /protein_id="ABO04369.1"
FT                   /translation="MSSIWASQYFPPATRNASDGADARDSRGRRRHPTFAAHRLASLTA
FT                   TATATATAAATPASIPTPTPRPTSTATPTPTATAIAANAVRCLRVEIDTWPKPGLVSHV
FT                   DAGSHDDMTADTFYRSAAALAPFFAELADAGARDAGMPALRKIGLRAERAMLAATGGVN
FT                   THRGAIFGLGLLCAAAGLRGSRERRAQRGQAAGATLGDLVAARWGDEIAGGPRAADSHG
FT                   ARAARRYGAGGARAEAAGGFARVYAVGVPALRDGARRARGDAEAARVHACFALIAALDD
FT                   DTNLLHRGGRDGLDFAQRTAREFLAAGGVGACDWRARAAAAHRAFVARRLSPGGAADLL
FT                   AMSLFVVALDDARALP"
FT   gene            530235..531173
FT                   /locus_tag="BMA10247_0545"
FT   CDS_pept        530235..531173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0545"
FT                   /product="acyl transferase domain protein"
FT                   /note="identified by match to protein family HMM TIGR03131"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04837"
FT                   /protein_id="ABO04837.1"
FT                   /translation="MTIAILCSGQGGQHAGMFALTADLPEAAPLFAHAAALLGADPREW
FT                   VCDADDEALRENFAAQLVCTLQAVAAMTRLDALLPRRRCVAGYSVGELAAWSVAGLVEA
FT                   RDALDLVAARARAMDAASDGDARMLFVRGLARDAVDASCAAHGAAVAIVNPGDAYLLAG
FT                   PRAALDALAADARARGAARVTPVCVRVASHTRWLDAAVPRFRAALAGARIARAPAPGTR
FT                   LLSGIDGAPVLDVAAGADKLARQIAEPLDWAACVAGCVEAGARAFVELGPGRALAEMAA
FT                   AAFPALPARSLADFRSWDGVRAWLSRVDLDA"
FT   gene            531327..531812
FT                   /locus_tag="BMA10247_0546"
FT   CDS_pept        531327..531812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05988"
FT                   /protein_id="ABO05988.1"
FT                   /translation="MSAFECARAAQLPSRDAALGAYFDADAGSTDIEVDLIHRARTRVL
FT                   VAGGASVPAAVAAALCAARGRGVDVRVVLDRTGRATRYSGAAFLANAGIDVVLSDRVPN
FT                   AHGPFVVVDDAVVLGRASFAQTRDARAAGNFDVFYRAPQLAQSYATAFWRLYGLARR"
FT   gene            531769..532194
FT                   /pseudo
FT                   /locus_tag="BMA10247_0547"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            532206..533087
FT                   /locus_tag="BMA10247_0548"
FT   CDS_pept        532206..533087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06610"
FT                   /protein_id="ABO06610.1"
FT                   /translation="MHERPPITAETTRFAARDGRLLTGTFYAPGAPSASNGRSVLVSGA
FT                   LGVPRGFYERYARFLASDGFTVLTYDYRGIGDSRKPPAEADGASLRDWGEADLPGALDH
FT                   LAARAPSHRLLAVAHSVGGQLFGLAHNNGRAAALLSICCPSGYWRLWPWPHRLWLAPLW
FT                   FCVVPALGGVLSHLPVRRAGLGFAADLPAGVMREWARWCRHADYLVDDEGHPLREHFRG
FT                   YRGRILAYTVSDDWMAPPAAVQALHRFYSTAQVEHREIAPDRRRHAIGHFGYFRDDNRA
FT                   LWPLGAAWLREQ"
FT   gene            533493..533729
FT                   /pseudo
FT                   /locus_tag="BMA10247_0549"
FT                   /note="conserved hypothetical protein, truncation;
FT                   comparison of this gene to its homologs suggests this gene
FT                   has been truncated"
FT   gene            complement(533740..534573)
FT                   /locus_tag="BMA10247_0550"
FT   CDS_pept        complement(533740..534573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0550"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06377"
FT                   /protein_id="ABO06377.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(534597..534860)
FT                   /locus_tag="BMA10247_0551"
FT   CDS_pept        complement(534597..534860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0551"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06410"
FT                   /protein_id="ABO06410.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            534985..535374
FT                   /locus_tag="BMA10247_0552"
FT   CDS_pept        534985..535374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0552"
FT                   /product="glutathione S-transferase domain protein"
FT                   /note="identified by match to protein family HMM PF00043"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07371"
FT                   /protein_id="ABO07371.1"
FT                   /translation="MPDDLPARVRVLELTGLALAAAEKTVQVVYEHGLRPGEKQHQPWL
FT                   DRVLGQLDAAYGALDARIAGASGWLVGERITQADVTVAVAWRFTQFMQGDYPDLARVDP
FT                   ARYPALAALSARAEALPEFEGTPLD"
FT   gene            complement(535837..537324)
FT                   /gene="proP"
FT                   /locus_tag="BMA10247_0553"
FT   CDS_pept        complement(535837..537324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="BMA10247_0553"
FT                   /product="proline/betaine transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07312"
FT                   /protein_id="ABO07312.1"
FT                   /translation="MTATPAPSSSSSAPTEGALPAAAHEITVVDQGLLKRAVGAMALGN
FT                   AMEWFDFGVYSYIAVTLGQVFFPSSSPSAQLLATFGTFAAAFLVRPLGGMVFGPLGDRI
FT                   GRQRVLAMTMIMMAVGTFAIGLIPSYDSIGLLAPVLLLVARLVQGFSTGGEYGGAATFI
FT                   AEFSTDKRRGFMGSFLEFGTLIGYVMGAGVVALLTASLSHDALLSWGWRVPFLIAGPLG
FT                   LIGLYIRMRLEETPAFKRQAEAREAQDKAVPKAHFRRQLARHWRALLLCVGLVLIFNVT
FT                   DYMALSYLPSYLSSTLHFDEAHGLVLILIVMVLMMPMTLATGRLSDAVGRKPVMLAGCV
FT                   GLFALAIPALLLIRTGETALVFGGLLILGALLSCFTGVMPSALPALFPTEIRYGALAIG
FT                   FNVSVSLFGGTTPLAAAWLVDATGNLMMPAYYLMGAAVIGAISVLALPESARQPLKGSP
FT                   PAVASHREAHALAREIKRREAAERDDSGYPSAAALRA"
FT   gene            537859..538191
FT                   /locus_tag="BMA10247_0554"
FT   CDS_pept        537859..538191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02694"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04584"
FT                   /db_xref="GOA:A3MIN7"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MIN7"
FT                   /protein_id="ABO04584.1"
FT                   /translation="MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSL
FT                   ALFAWLLTLHPAAAARTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVI
FT                   ALQPRG"
FT   gene            complement(538560..539282)
FT                   /gene="dnaQ"
FT                   /locus_tag="BMA10247_0555"
FT   CDS_pept        complement(538560..539282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="BMA10247_0555"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM TIGR00573; match to protein
FT                   family HMM TIGR01406"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05356"
FT                   /protein_id="ABO05356.1"
FT                   /translation="MRQIILDTETTGLNARAGDRIIEIGCVELLNRRLTGKNLHFYVNP
FT                   ERDSDPGALAVHGLTTEFLSDKPKFAEIVDPLRDFVRDAELIIHNAPFDLGFLDAEFAL
FT                   LGLPSFTDHCAGVIDTLVQAKQMFPGKRNSLDALCDRFGISNAHRTLHGALLDSELLAE
FT                   VYLAMTRGQESLVIDMLDEAGDAHRNGDAPRMAFSGLDLPVLAATDAELAAHEAQLDAL
FT                   DKSAKGVCVWRKEAVGEA"
FT   gene            complement(539340..539786)
FT                   /gene="rnhA"
FT                   /locus_tag="BMA10247_0556"
FT   CDS_pept        complement(539340..539786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="BMA10247_0556"
FT                   /product="ribonuclease H"
FT                   /note="identified by match to protein family HMM PF00075"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06451"
FT                   /protein_id="ABO06451.1"
FT                   /translation="MTLQTIDIYTDGACKGNPGPGGWGALLRYGAQEKELFGGEPGTTN
FT                   NRMELTAVIAALEALKRPCKVVVHTDSQYVQKGISEWIHGWKKKGWVTAAKTPVKNADL
FT                   WQRLDALVAQHDVEWRWVKGHAGHPENERADALANRGVESLAQA"
FT   gene            complement(539783..540595)
FT                   /locus_tag="BMA10247_0557"
FT   CDS_pept        complement(539783..540595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08241"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05921"
FT                   /protein_id="ABO05921.1"
FT                   /translation="MSDRSIIDWPAWTDSPPGRYVLGWEQAQLDRTVSDVFGFHALQLG
FT                   LPQLDALRENRMPCRGLVLDPASGASAPYHYPWAREARSAEHAPAGRSTVWCDLLDLPF
FT                   ESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGARHSVGKMAK
FT                   RPFVPATRDQITFIRLKDWIKLLGFDLERGRFGCYRPPLATDKWLSRYAFMEAAGDRWW
FT                   PIFGAVYMVTAIKRVRGMRLVGPIKMKKPVLAPGLTPAATPTTHQEHS"
FT   gene            540616..541422
FT                   /gene="gloB"
FT                   /locus_tag="BMA10247_0558"
FT   CDS_pept        540616..541422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="BMA10247_0558"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="identified by similarity to SP:Q47677; match to
FT                   protein family HMM PF00753; match to protein family HMM
FT                   TIGR03413"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04527"
FT                   /protein_id="ABO04527.1"
FT                   /translation="MNELEYVPVPAFDDNYIWLVSDGRQAVAVDPGEAAPVRRHLDARG
FT                   WRLTAILLTHHHRDHVGGVAELLAGAREGEPIAVFGPAHEAIEHITRRVAGGERVRIGA
FT                   PALEFDVIDVPGHTRGHIAYFQPAGPGNAAPHLFCGDTLFSCGCGRLFEGTPAQMLASL
FT                   DALAALPGDTRVHCAHEYTLSNIQFALACEPGNAALAAWRDEALARRARGEPTLPTTIA
FT                   HECAVNPFLRADSASIRATLEARLHEAAPDRLAAFTLMREWKNRFR"
FT   gene            541575..543167
FT                   /locus_tag="BMA10247_0559"
FT   CDS_pept        541575..543167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0559"
FT                   /product="putative membrane-bound lytic murein
FT                   transglycosylase D"
FT                   /note="identified by similarity to SP:P23931; match to
FT                   protein family HMM PF01464; match to protein family HMM
FT                   PF01476; match to protein family HMM PF06474"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04058"
FT                   /protein_id="ABO04058.2"
FT                   /translation="MRFLLSALLVLTLAACAGTGPTAQNPAASDPQAASDYLRKSASAK
FT                   ETVDVDKQSVGDLTTADSDLWARIRRGFQMPDLQSDLVDMQASWYAQRPDYVQRMTERS
FT                   QKYLYHIVEELESRHMPTELALLPFIESAYNPQALSVAKAAGMWQFMPATGRTFNLKRN
FT                   MWQDERRDVLASTSAALDYLSRLHDMFGDWYLALAAYNWGEGNLQRAIARNQAAGLPTD
FT                   YQSLRMPNETRNYVPKLQAVKNIVTNPQQYGLTLPEIPNHPYFVTVTTSRDIDVTVAAK
FT                   LANLPLDEFKSLNPSFSKPVILGATQPQILLPFDNAAAFEKGLKSYDGQLSSWTAYTVT
FT                   ERARPAAIAEKIGVDADTLMQVNKIPAGMRLKPGSTIVVPRTDDDDEDISADVAENGVL
FT                   AMEPDVPDTRKMLIRVRRKQSMEALASRYGVSAAQLRGWNRTRRAVVMPGQTMVLHVPV
FT                   GRAVPAEPGPERIATSVGGGRIERASLHTGGKASSRGRKAGPAAKASAKAATKSGAKAA
FT                   PAKTAGRKTTKKK"
FT   gene            543302..544540
FT                   /locus_tag="BMA10247_0560"
FT   CDS_pept        543302..544540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0560"
FT                   /product="MFS transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04816"
FT                   /protein_id="ABO04816.1"
FT                   /translation="MIVMSLMQFRVFALFAIGYFVSYVFRGVNLGFAPLITRELGLSAA
FT                   DLGLLTSLYFLGFACAQIPAGVLLDRYGPRRVSAALLLVAAAGAWVFGAAHDTGAMMLG
FT                   RLLIGVGVSVCLGGAFKALAQHFPVARLPLLNGFVMAVGGLGGVAVGSPLDWLLGFAGW
FT                   RAVCAGLGAFTVAVAAALWAFAPDARQSRHDASVAAQFAGTWRIVTNRTFWKIASFSVV
FT                   TQGVFYAMQSLWVGAYLRDVSGFAPRDAAVLVSVLGFAMMAGCVGFGAAARGLERRGMS
FT                   LYAFCGFGMALFVATQLAIMLRAPLPAAVLWAAYGVFGGVGILSYAVLAEYFPVHVIGR
FT                   ANTTLTLVIFVLIFGFQVGVGAVLSHWPMRAGHYPAEAHLSAWGALVALQIASAVWYVL
FT                   PDRALDKSARHAG"
FT   gene            complement(544647..545789)
FT                   /locus_tag="BMA10247_0561"
FT   CDS_pept        complement(544647..545789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0561"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06943"
FT                   /protein_id="ABO06943.1"
FT                   /translation="MSTILAPHSGAAPTLPLIDSDHRRRGWRGWRGRLIAKAAMQILRP
FT                   VEPCVQHGLPAPTTFPPNGGARRFGLVHYGIMIPDLPAPHRFMATAIILGSAGMRVFDA
FT                   DFAAAPGDGPLQTATLVHGTAAAVDRHFTRYSIPRDVESRADGSLLRLGDDLELSGRYP
FT                   EFRLESRRGGFAVDLTLTATGDVTWFAKGLFYEHIALVTRYRGTIEHGGATTEVAGLCT
FT                   YEYARGTSPYLLRNRFLPQAAKLPWDVFSYQVIDLDADTQLLLAHVQVDQYPALTSAYL
FT                   RVIGQRAHRLDADVHFRVTSAQARPAVGPDGHAMWLPETFAWRVRDRHGRTLFAIDATV
FT                   DTPMLFGIGTGYVGGYRWEGERDGRPASGRGYIEYVDRRG"
FT   gene            545802..545936
FT                   /locus_tag="BMA10247_0562"
FT   CDS_pept        545802..545936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0562"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05890"
FT                   /protein_id="ABO05890.1"
FT                   /translation="MSFARGIGGARPAPRRRLRDGGRLADAAAGRPASRPRLAGRARP"
FT   gene            546017..547039
FT                   /locus_tag="BMA10247_0563"
FT   CDS_pept        546017..547039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0563"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07101"
FT                   /protein_id="ABO07101.1"
FT                   /translation="MTAKLAHWDFVRPVATTRVLVDVGVEQGLAVGQCLGGSGVCADLL
FT                   DKPDATVAAAQELRIVRNLMRLLGPDFPLGIEIGRRYHATAYGVWGFALMSSATFGDAV
FT                   SVGLRYLQLTSTFCEIRPTLRGDDATLVIDDRDLPGDVRDVLVEITVAALITLQFDLDA
FT                   ANLPVKRLALKMKPPSYAGRFRTLFDATPEFGAAHNALTVDARCLDLKLPQRNALTRRR
FT                   CEDECRRVLERHRRSEGWAGRVRRQLAGDPARGPTMDVLAAELGLSPRTLRRRLANEGT
FT                   DYETVVDELRQALAEALLATTTLTLAEVSERLGYSEPSAFARAFRRWKGMSPSEYRRAA
FT                   "
FT   gene            547436..548581
FT                   /gene="carA"
FT                   /locus_tag="BMA10247_0564"
FT   CDS_pept        547436..548581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="BMA10247_0564"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00988; match to protein
FT                   family HMM TIGR01368"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06518"
FT                   /protein_id="ABO06518.1"
FT                   /translation="MLPSFSPALLALADGTVFRGYSIGAAGHTIGEVVFNTAITGYQEI
FT                   LTDPSYARQIVTLTYPHIGNVGVNAEDVEATKVHAAGLIVRDLPALASNFRMARTLGDY
FT                   LRDEGVVAIAGIDTRKLTRILRDKGAQNGCILTGSDDETKALALARSFPGLAGMDLAKV
FT                   VSTAKPFEWKQTEWRLGSGYGMQETPRYRVVAFDFGVKYNILRMLAERGCHVSVLPAQS
FT                   SAADALALNPDGIFLSNGPGDPQPCDYAIAATREFIERGVPTFGICLGHQIMGLALGAK
FT                   TLKMKTGHHGANHPVKDLANGRVVITSQNHGFAVDADSLPANARATHVSLFDGTLQGFE
FT                   LTDKPAFCFQGHPEASPGPHDIGYLFDRFTALMDAAKARSA"
FT   gene            548613..549275
FT                   /locus_tag="BMA10247_0565"
FT   CDS_pept        548613..549275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0565"
FT                   /product="putative homoserine/threonine efflux protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05485"
FT                   /protein_id="ABO05485.1"
FT                   /translation="MFGHALGITDLWTYVFGVVFIILLPGPNSMYVLSLAAQRGVKAGY
FT                   RAACGVFVGDTVLMVLSAAGVASLLKANPLLFSVVKYGGAAYLLYIGVGMLRGAWRKLA
FT                   RPAADAGADVRRAVDGERPFRKALVVSLLNPKAILFFISFFIQFVDPAYAHPALSFVVL
FT                   GAIAQLASFVYLSTLIFTGARLADHFRRRRKLAAGASGGVGGLFVGFSVKLALATMS"
FT   gene            549327..552581
FT                   /gene="carB"
FT                   /locus_tag="BMA10247_0566"
FT   CDS_pept        549327..552581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="BMA10247_0566"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM PF02222; match to protein family HMM PF02786;
FT                   match to protein family HMM PF02787; match to protein
FT                   family HMM TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04968"
FT                   /protein_id="ABO04968.1"
FT                   /translation="MPKRTDINSILIIGAGPIIIGQACEFDYSGAQACKALREEGYKVI
FT                   LVNSNPATIMTDPNTADVTYIEPITWEVVERIIAKERPDAILPTMGGQTALNCALDLFH
FT                   HGVLEKYGVELIGASPEAIDKAEDRQKFKDAMTKIGLGSAKSGIAHSMEEALKVHADIA
FT                   AATGGSGYPVVIRPSFTLGGSGGGIAYNREEFEEICKRGLDLSPTRELLIEESLLGWKE
FT                   YEMEVVRDRADNCIIVCSIENLDPMGVHTGDSITVAPAQTLTDKEYQILRNASLAVLRE
FT                   IGVDTGGSNVQFSINPKDGRMVVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLD
FT                   ELKNEITGGATPASFEPTIDYVVTKIPRFAFEKFREADSRLTTQMKSVGEVMAIGRTFQ
FT                   ESFQKALRGLEVGVDGLDEKTTSRDEIIREIGEPGPDRIWYVGDAFRVGMSREQIFEET
FT                   AIDPWFLAQIEQIVLKEKALAGRTLASLTKDELHYLKQSGFSDRRLAKLLGATPADVRA
FT                   RRLELNVRPVYKRVDTCAAEFATKTAYMYSTYEEECEAQPTGNRKIMVLGGGPNRIGQG
FT                   IEFDYCCVHAALAMREDGYETIMVNCNPETVSTDYDTSDRLYFEPLTLEDVLEIVDKEK
FT                   PVGVIVQYGGQTPLKLALDLEAHGVPIIGTSPDMIDAAEDRERFQKLLQDLGLRQPPNR
FT                   TARAEDEALALADEIGYPLVVRPSYVLGGRAMEIVHEPRDLERYMREAVKVSNDSPVLL
FT                   DRFLNDAIECDVDCICDGDAVFIGGVMEHIEQAGVHSGDSACSLPPYSLSTQTVAELKR
FT                   QTGAMAKALNVVGLMNVQFAIQQVPRPDGSKEDIIYVLEVNPRASRTVPYVSKATSLPL
FT                   AKIAARAMVGQKLAQQGVTKEVEPPYFSVKEAVFPFIKFPTVDPVLGPEMRSTGEVMGV
FT                   GATFGEALFKSQLAAGSRLPESGTVLLTVMDADKPKAVEVAKMLHDLGYPLVATRGTAA
FT                   AIEAAGVPVKVVNKVKDGRPHIVDMIKNGEIALVFTTVDETRAAIADSRSIRMSAQAHK
FT                   VTYYTTMSGARAAVEGLRYLKDLEVYDLQGLHARLN"
FT   gene            552700..553176
FT                   /gene="greA"
FT                   /locus_tag="BMA10247_0567"
FT   CDS_pept        552700..553176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="BMA10247_0567"
FT                   /product="transcription elongation factor GreA"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449; match to protein
FT                   family HMM TIGR01462"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04804"
FT                   /protein_id="ABO04804.1"
FT                   /translation="MSTIPLTKRGADQLRDELQRLKSVERPAVINAIAEARAQGDLSEN
FT                   AEYDAAKEKQGFIEGRIAEIESKLSAAQIIDPATLDTDGRVVFSSTVELEDLETGAKVK
FT                   YQIVGDDEADLDHGLISVSSPIARALIGKSEGDVAAVQAPSGVREYEIISVQFV"
FT   gene            553176..553679
FT                   /locus_tag="BMA10247_0568"
FT   CDS_pept        553176..553679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0568"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04333"
FT                   /protein_id="ABO04333.1"
FT                   /translation="MAGAAAPHRLFRLLATVWVGSLLTIGYAVAPVLFATLDRATAGAV
FT                   AARLFSIEATIGAVCGVLLIGLSNLLVRRGHDAYWPLRWLLAAMLGCVLVGYFALQPFM
FT                   NALRVAALEAGTDVGHSAYAGRFALLHGVSSVFYLVESLVGIGLIWRLPGQGGASPLGG
FT                   ERRA"
FT   gene            complement(553750..554304)
FT                   /locus_tag="BMA10247_0569"
FT   CDS_pept        complement(553750..554304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01985"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07133"
FT                   /protein_id="ABO07133.1"
FT                   /translation="MPALSLSPAERSALRSEAHALKPVVLIGAEGLTDAVLAEIEVHLA
FT                   AHQLIKIRVFGDERDERVAIYDEICDRLNAAPIQHIGKLLVIWKPEQAEAAPQRGRRGV
FT                   PSAREAARASAAQPDEGRAAKGRAPRVVKVVKQSPNAPAVRRPKPQKVRVLGNERVTAG
FT                   GNVKRAKKRQSSAKRQHQNEK"
FT   gene            554498..555160
FT                   /gene="rrmJ"
FT                   /locus_tag="BMA10247_0570"
FT   CDS_pept        554498..555160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrmJ"
FT                   /locus_tag="BMA10247_0570"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01728"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06142"
FT                   /db_xref="GOA:A3MIQ3"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MIQ3"
FT                   /protein_id="ABO06142.1"
FT                   /translation="MAKNRFNQSWLHDHINDPYVKMAQREGYRARAAYKLKEIDEQDKL
FT                   IRPGQVIVDLGAAPGSWSQYARNKLAQGKRRDAVREGGIDGTIIALDMLPMEPVADVHF
FT                   IQGDFREESVLHQLEEVLAGRAVDLVISDMAPNLSGVAVADAARIEHVCDLALEFAQNH
FT                   LKPDGALLVKCFHGSGYSQIVEKFKHQFKTVAPRKPKASRDKSSETFILGRHLKQPR"
FT   gene            555328..557214
FT                   /gene="ftsH"
FT                   /locus_tag="BMA10247_0571"
FT   CDS_pept        555328..557214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BMA10247_0571"
FT                   /product="cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04450"
FT                   /protein_id="ABO04450.1"
FT                   /translation="MNNNMFSKAAVWLVIALVLFTVFKQFDKPRVQEGVSYSQFMDDAK
FT                   NGKVKNVVVQGRNLTVTPADGQKYQIVSPGDIWMVGDLMKYGVQVSGKADDEPNALVSA
FT                   LYYLGPTLLIIVFWFYMMRQMQGGGKGGAFSFGKSRARLIDENNNAVNFSDVAGCDEAK
FT                   EEVSELVDFLRDPQKFQKLGGRIPRGVLLVGPPGTGKTLLARAIAGEAKVPFFSISGSD
FT                   FVEMFVGVGAARVRDMFEQAKKHAPCIVFIDEIDAVGRHRGAGMGGGNDEREQTLNQML
FT                   VEMDGFEANSGVIVIAATNRSDVLDKALLRPGRFDRQVYVGLPDIRGREQIMRVHLRKV
FT                   PIANDVDAAVIARGTPGFSGADLANLVNEAALFAARRGKRIVEMQDFEDAKDKIFMGPE
FT                   RKSAVIREEAKRATAYHESGHAVIAKLLPKADPVHKVTIIPRGRALGVTWQLPEHDNET
FT                   YSKDYLLDRLAILFGGRVAEELFLNLVSTGASDDFNKATQTARAMVARFGMTDALGPMV
FT                   YVDDENDGGPFGRGFTRTISEATQQKVDAEIRRVLDEQYGLARRLLEENRDKVEAMTAA
FT                   LMEWETIDADQINDIMEGRPPRSPKSVPPAGDPSSGGSSGAEVKPGNATAPA"
FT   gene            557327..558217
FT                   /gene="folP"
FT                   /locus_tag="BMA10247_0572"
FT   CDS_pept        557327..558217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BMA10247_0572"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07397"
FT                   /protein_id="ABO07397.1"
FT                   /translation="MSSSDSVFPVPAPLQCGRFTLTFERPLVMGILNVTPDSFSDGGRY
FT                   VARDAALAQAERMLAEGADILDIGGESTRPGAPPVPLNEELERVIPLVEALRGRNVPLS
FT                   IDTYKPAVMRASLAAGADLINDIWGLRQPGAIDAVRDSACGLCVMHMLGEPRTMQVHAP
FT                   EYRDVIDDVRAFLAERADALVQAGVDARRISVDPGFGFGKSVIEHNYALLAHLPRTAPA
FT                   RPDGRAYPILAGMSRKSMLGAVIGRPAPERIAASVAAAVCAAERGAAIVRVHDVAATVD
FT                   ALKVWSAVRDAARRA"
FT   gene            558198..559601
FT                   /gene="glmM"
FT                   /locus_tag="BMA10247_0573"
FT   CDS_pept        558198..559601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BMA10247_0573"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880;
FT                   match to protein family HMM TIGR01455"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04218"
FT                   /db_xref="GOA:A3MIQ6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MIQ6"
FT                   /protein_id="ABO04218.1"
FT                   /translation="MPRGEHKSKQGGRFYMGRRYFGTDGIRGKVGDAPITPDFVLRLGY
FT                   AAGKVLASAPGRAASGARPTVLIGKDTRVSGYMLEAALEAGFSAAGVDVMLAGPMPTPG
FT                   VAYLTRALRLSAGVVISASHNPYHDNGIKFFSADGNKLPDEIEAEIEAWLDKPLDCAAS
FT                   DGLGKARRLDDAAGRYIEFCKSTFPAAFDLRGMKLVVDCAHGAAYQVAPHVFHELGADV
FT                   IPIGVAPNGFNINDGVGATAPDALMRAVRANHADLGIALDGDADRLLVVDHTGRLYNGD
FT                   ELLYVLVKDRIATNGQVEGAVGTLMTNFAVEVALKEAGVQFVRAAVGDRYVLEQLRERG
FT                   WQLGAEGSGHILSLDRHSTGDGIVSALLVLAALKRSGKTLAQMLEGVTLFPQKLINVRM
FT                   KPGADWKGSEAIRRAIDSAEQALSGSGRVLIRASGTEPVLRVMVEARQATDANRHAEAI
FT                   ADAVKQATA"
FT   gene            560037..561065
FT                   /gene="pstS"
FT                   /locus_tag="BMA10247_0574"
FT   CDS_pept        560037..561065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="BMA10247_0574"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00975"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06679"
FT                   /protein_id="ABO06679.1"
FT                   /translation="MKLMQTAFAGLAGALFAVAAHADITGAGSTFAMPIYTKWAADYQQ
FT                   SGGAKVNYQGIGSSGGLKQIVAKTVDFAGSDAPLKDDELAKEGLFQFPTVVGGVVPVIN
FT                   VPGVKAGELTLSGAVLGDIYLGKIKKWNDPAIAALNPKVKLPDTDIAVVRRADGSGTSF
FT                   IWTNYLSKVNDEWKSKVGEGTTVNWPTGTGGKGNDGVAAFVQRLPGAIGYVEWAYAKKN
FT                   NMVYTALKNSTGTVVEPKTETFKAAAAGANWSKSFYQILTNQPGKEAWPVVGATFVLLH
FT                   AKQDKPAQGAETLKFFDWAFKNGAKAADDLDYISLPASVETEIRKQWKVKVTDAAGKAV
FT                   AE"
FT   gene            561172..562158
FT                   /gene="pstC"
FT                   /locus_tag="BMA10247_0575"
FT   CDS_pept        561172..562158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="BMA10247_0575"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02138"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05667"
FT                   /protein_id="ABO05667.1"
FT                   /translation="MSDIPFASTRSGGQAPMRAPSRYGDIVFGGLTRVAAIVTLLLLGG
FT                   IIVSLIVASMPTIEKFGLSFLWHAEWDPNSDTYGALVPIYGTIVTSIIALVIAVPVSFG
FT                   IALFLTELSPVWLRRPLGVAIELLAAIPSIVYGMWGLLVFAPIFATYFQKPVGALLGPI
FT                   PVIGALFQGPPIGIGILSAGVILAIMIIPYIASVMRDVFEVTPVLLKESAYGIGCTTWE
FT                   VMWKIVLPYTKTGVIGGVMLGLGRALGETMAVTFVIGNTNLLDNVSLYSPGNSITSALA
FT                   NEFAEAAPGLHTSALMELGLILFVITFVVLAVSKLMLLRLERGEGRK"
FT   gene            562155..563048
FT                   /gene="pstA"
FT                   /locus_tag="BMA10247_0576"
FT   CDS_pept        562155..563048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="BMA10247_0576"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00974"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05573"
FT                   /protein_id="ABO05573.1"
FT                   /translation="MSAPIVNMPGPDGAALDAMRARLQRRRKATNVVALTASLAAMAFG
FT                   LLWLVWILYTTLHLGVGGLSLALFTESTPPPNTAGGGLANAIVGSLLLVALATFVGTPI
FT                   GILTGVYLAEYGQKSWLASVMRFINDILLSAPSIVVGLFVYALVVAKSGHFSGWAGVIA
FT                   LALLQIPIVIRTTENMLKLVPNALREAAFALGTPKWRMILKITLRASVGGIVTGVLLAV
FT                   ARIAGETAPLLFTALSNQFFSADMSQPMANLPVTIFKFAMSPFAEWQSLAWAGVFLITL
FT                   GVLGLNILARSIFSKK"
FT   gene            563064..563912
FT                   /gene="pstB"
FT                   /locus_tag="BMA10247_0577"
FT   CDS_pept        563064..563912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="BMA10247_0577"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="identified by similarity to SP:P07655; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR00972"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05564"
FT                   /protein_id="ABO05564.1"
FT                   /translation="MNMAESHLDPSKLATGPAGFGAAAGQRPLAPLNAKIEVKNLNFFY
FT                   NQFHALKNINLSIPEGKVTAFIGPSGCGKSTLLRTFNKMYALYPEQRAEGEIVMDGENL
FT                   LQSKLDISLLRARIGMVFQKPTPFPMSIYDNIAFGVKMFERLTRSEMDDRVEWALTKAA
FT                   LWNEVKDKLSQSGYGLSGGQQQRLCIARGIAIRPEVLLLDEPCSALDPISTGRIEELIA
FT                   ELKSDYTVVIVTHNMQQAARCSDYTAYMYLGELIEFGETEKIFIKPARKETEDYITGRF
FT                   G"
FT   gene            563932..564636
FT                   /gene="phoU"
FT                   /locus_tag="BMA10247_0578"
FT   CDS_pept        563932..564636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="BMA10247_0578"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="identified by match to protein family HMM PF01895;
FT                   match to protein family HMM TIGR02135"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04474"
FT                   /protein_id="ABO04474.1"
FT                   /translation="MSDKHLSSQFDADLNAVSSKVLEMGGLVEAQITEAMYALNEFDRA
FT                   AAERVIEAEDRLNHMEVEIDEECGNIIARRQPAARDLRLLMSISKTITNLERAGDEAEK
FT                   IAKRVRRLVDEPAARGVNIAEIKVSGDMAVTILRRALDAFARLDTVSAAQIVKDDKEID
FT                   QEFRAFVRKLVSYMQEDPRMISVGLDYLFIAKAIERIGDHAKNIAEFIIYIVKGTDVRH
FT                   QPRDLLDREANS"
FT   gene            564665..565366
FT                   /gene="phoB"
FT                   /locus_tag="BMA10247_0579"
FT   CDS_pept        564665..565366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="BMA10247_0579"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486; match to protein
FT                   family HMM TIGR02154"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06991"
FT                   /protein_id="ABO06991.1"
FT                   /translation="MPSNILVIEDEPAISELISVNLQHAGHCPIRAYNAEQAQSLISDV
FT                   LPDLVLLDWMLPGKSGIAFARDLRNNERTKHIPIIMLTARGDEQDKVLGLEIGADDYVT
FT                   KPFSPKELMARIKAVLRRRAPQLTEDVVSINGLRLDPATHRVAAQSDGSEIKLDLGPTE
FT                   FRLLHFFMTHPERVHSRTQLLDQVWGDHVFVEERTVDVHIKRLRAALKPAGCDAMIETV
FT                   RGSGYRLAKHA"
FT   gene            565436..566746
FT                   /gene="phoR"
FT                   /locus_tag="BMA10247_0580"
FT   CDS_pept        565436..566746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="BMA10247_0580"
FT                   /product="histidine protein kinase PhoR"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM TIGR02966"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05159"
FT                   /protein_id="ABO05159.1"
FT                   /translation="MNIIWARFLVSLVLLALVSVIIGAIAGPVPGLVFALAMLVVQGFV
FT                   STFHTQRLWRLLDAPVYGEVPSAPGIWGEIYYRLHKLAKQWHAQVRQVEQQHSRFIQAI
FT                   QASPNGVAMLDDRDQIEWCNAIAEVHFGLDAKRDLRQHVTHLVRHPDFVRYLNGQHYDE
FT                   TLVMRGMGGNRQNVLAVQVFPYGENRKLLLTQDITELERTDAMRRDFVANVSHELKTPL
FT                   TVLSGFLETMRELPLSDDERARYLELMEQQASRMRHIVTDLLVLAKLEGESKPPADRAV
FT                   DMRTVLDHLRDDAQTLSGGHHEITFKVDETLAVTGAQTEIFSALGNLVTNAIRYTPEGG
FT                   TIRVEWRRDGAQAVFSVTDSGLGIPAAELPRLTERFYRVDRSRSRDTGGTGLGLAIVKH
FT                   VLQRHDAQLSIQSEEGRGSTFTARFPAHRTISRRHAA"
FT   gene            complement(566947..569007)
FT                   /gene="ppk"
FT                   /locus_tag="BMA10247_0581"
FT   CDS_pept        complement(566947..569007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="BMA10247_0581"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="identified by match to protein family HMM PF02503"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05177"
FT                   /protein_id="ABO05177.1"
FT                   /translation="MSLRYPLLNRELGILGFNERVLAQAADPHVPLLERLRFICITSSN
FT                   LDEFFEVRMAGLQEQMRDNPGALAPDGMSLQHVYDLVVERAQRLVHRQYTMLHETILPA
FT                   LEQEGIYFHGTETWSDAQIEWARRYFFDELLPVLTPIGLDPAHPFPRVLNKSLNFVIEL
FT                   EGRDAFGRQAVMGIVQAPRALPRLVRMPHALSGFQHGFVLLSSLMQRFVGELFPKLVVK
FT                   SCNQFRITRNSELFVDEDEITNLRVALQGELPARHLGNAVRLEVSADTPAHLVRRLLDE
FT                   SGLTEKDCYRVDGPVNLVRLMQLPDLVDLPELKFTPFLPAISPAIANAPSMFDAIDHGD
FT                   ILLHHPYESFQPVLELLQQAAQDPSVVAIKQTIYRTGTDSPLMDALMEAARNGKEVTVV
FT                   VELLARFDEETNINWAAQLESVGAHVVYGVVGHKCHAKMMLIVRRVTQGGKSVLRRYVH
FT                   LGTGNYHPRTARLYTDFGLMTSEPTICEDVHHVFQQLTGIGGELKLHEMWQSPFTLHPR
FT                   LMEHIRAEAGNARAGKRARIVAKMNALLEPTVIAELYEASQAGVKIDLIVRGVCALQPG
FT                   VPGLSENITVRSIVGRFLEHHRIYYFHANGEELVYLSSADWMDRNLFRRVEVAFPVRER
FT                   KLKRRVIAEGLSVFLGDNQSAWLMQSDGHYRRRRAGKAPRNAQLGLLAKFC"
FT   gene            568936..569082
FT                   /locus_tag="BMA10247_0582"
FT   CDS_pept        568936..569082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0582"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04207"
FT                   /protein_id="ABO04207.1"
FT                   /translation="MGEHALVEAQDAEFAIQERITEGHRQRIRKVRRRLERSLGNSHGA
FT                   MTC"
FT   gene            569283..570797
FT                   /gene="ppx"
FT                   /locus_tag="BMA10247_0583"
FT   CDS_pept        569283..570797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="BMA10247_0583"
FT                   /product="exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /note="identified by match to protein family HMM PF02541;
FT                   match to protein family HMM TIGR03706"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05944"
FT                   /protein_id="ABO05944.1"
FT                   /translation="MVTSPHLLAAVDLGSNSFRLIVGRVEETPAGSQIYPVDALREPVR
FT                   LAAGLSRDKMLDRASQERGWEALKRFGERLRDFHPDHVRAVATNTLRVAKNAGEFLAEA
FT                   QAALGFPIEVIAGREEARLIYAGAAHSVPANAGKRLVVDIGGGSTEFIIGQHYTPLVME
FT                   SLYIGCVSHSRAFFPAGNVDEYTMRQAELAAKREIQIISGEYKKAGWDQAIGSSGTARA
FT                   LAELVEANGFNDAGVSHGISRGGLERLKRALIKAENVNRLKLVALKPDRVPVLAGGLSI
FT                   MLAVFEELGVDYVDTTDGALRLGVLYDLLGRTQHEDMRAVTVDGFTRRYGVDRAQAARI
FT                   GALAARFYDQLDEPEGEDRDESRTFLGWAAALHEIGLSISHSAYHKHSAYIASNADMPG
FT                   FSRTDQARLAALVLGHAGKLGKLSQSREVEWPLLFCLRLAALLCRRRNDAGLPDINVAQ
FT                   MKKGGYEVHLPSAWVQQNPLTDYSLSQEAAEWEKVGIPYRVVYTDA"
FT   gene            complement(571110..571739)
FT                   /locus_tag="BMA10247_0584"
FT   CDS_pept        complement(571110..571739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0584"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04508"
FT                   /protein_id="ABO04508.1"
FT                   /translation="MAGVFAIIGQTAPATRARSVRFESKASRKARGREAAPFPPDLDRA
FT                   AHLGPSTTRRPCGERHRMNNPLRLIARLLIPFATLAAAPAASADSQALDAALDCSSTGH
FT                   AFVAPLVASGAVRSQPMHVEANSMNAFRTNRSLSAYGFSVYVVLGYQANDPLFAHGDGE
FT                   PIGDWAYGVVVRGSKQAVEAKVRAAGSQAVVKDAFPFLTAIVCTSP"
FT   gene            572068..573141
FT                   /locus_tag="BMA10247_0585"
FT   CDS_pept        572068..573141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0585"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07383"
FT                   /protein_id="ABO07383.1"
FT                   /translation="MPNCADIAAADHARRRALAMRRYRAGAALCAAVALVDAVWLHAGG
FT                   YALQWSGVAVAARAIAVCAAFSLVLRGVARVPRYASVAARFRYGEAARTFAWLALLAAF
FT                   VAAAGILSYLCVTLKPPLIDGALIRLDARLGFDWPAVYERIRAHPALQRALAFAYDSAQ
FT                   WQLIGIPVWLGLTRRDDDLSEFIALFMLTSVTVLLISTPFPAASAFLHFRVADPIALAG
FT                   VSDFVRLRDGTLRVIDPAALQGMVSMPSFHTVLGVLFAYALRRGRVVAPLALLFNGWMI
FT                   ASTPTQGGHYFVDVLAGLLVACAAIAALRYAADARAGTGDTARSGRPRQSMAGPAADGE
FT                   AAFSARAARASRPSGDA"
FT   gene            573263..573832
FT                   /locus_tag="BMA10247_0586"
FT   CDS_pept        573263..573832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05039"
FT                   /protein_id="ABO05039.1"
FT                   /translation="MASPVAHKIMIVRHAEKPAGDGAPYGVNAKGEQDVEALTVFGWQR
FT                   AGALAVLFAPSRGPLQHAELATPDWLFAAAVAKHAKSERPIDTITPLAHKLGLAIGDAY
FT                   TKGQEKDLAQAAVASKGCVLIAWQHEDIPAIADALPLGKQTVPQKWPDDRFDIVWVFDL
FT                   DTGSGTYRFSQVSQMLLKGDRNSVIE"
FT   gene            complement(574255..574512)
FT                   /locus_tag="BMA10247_0587"
FT   CDS_pept        complement(574255..574512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04281"
FT                   /protein_id="ABO04281.1"
FT                   /translation="MNWHCYVARELAHLEVAIGVLEKARKEFVHHTAVCDPAYWRLRLD
FT                   TIRERLDEDPTLERQMSELLARIDRLEARNPRRESADFLA"
FT   gene            complement(575188..575448)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0588"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(575445..575927)
FT                   /locus_tag="BMA10247_0589"
FT   CDS_pept        complement(575445..575927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05864"
FT                   /protein_id="ABO05864.1"
FT                   /translation="MPAQCFFTLNGQRVSNLTCAGFGGVMAFSGNKQFVDKPDATAVAN
FT                   AGPIPKGRYYIVKRDTGGRLGPIRDLALDLWSNSDRSTWFALYRADAKIDDETYVNGVK
FT                   RSAFRLHPNGRWGVSDGCITVTTQVQFDQLRAYLMKQPTAKIPGTDIEYYGTVDVR"
FT   gene            complement(576178..576256)
FT                   /locus_tag="BMA10247_0590"
FT   tRNA            complement(576178..576256)
FT                   /locus_tag="BMA10247_0590"
FT                   /product="tRNA-Pro"
FT   gene            576420..576878
FT                   /gene="sixA"
FT                   /locus_tag="BMA10247_0591"
FT   CDS_pept        576420..576878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sixA"
FT                   /locus_tag="BMA10247_0591"
FT                   /product="phosphohistidine phosphatase SixA"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF00300;
FT                   match to protein family HMM TIGR00249"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05869"
FT                   /protein_id="ABO05869.1"
FT                   /translation="MNLILWRHAEAEDYAGTDLARQLTARGRKDAQAVAKWLRARIERH
FT                   ATVLASPAARTVQTAKALTDHYRTANELAPGCDVGDVLAAAGWPDGIAPTVVVVGHQPT
FT                   LGSVAAHLLAGSHESWSVKKGGLLWLSSRTREGNGQTVLRAAISPDLV"
FT   gene            577096..577848
FT                   /locus_tag="BMA10247_0592"
FT   CDS_pept        577096..577848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0592"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04661"
FT                   /protein_id="ABO04661.1"
FT                   /translation="MPRAAETVTAEFRLRAAWARTEDELREAQRLRHSVFAEEMGAHVS
FT                   GPAGLDVDPFDPYCDHLLVRDLDTLKVVGTYRVLPPHQAARVGRLYAEGEFDLSRLTHL
FT                   RSKMVEVGRSCVHRDYRSGAVIMALWGGLGTYMLQNGYETMLGCASVSMADGGHYAANL
FT                   YQSLGDALTAPEYRAFPHTPLPVDELQTGAKVAPPPLIKGYLRLGAKICGAPAWDPDFN
FT                   CADFLTLFRLSDINARYARHFLSDPLPR"
FT   gene            complement(578004..578135)
FT                   /locus_tag="BMA10247_0593"
FT   CDS_pept        complement(578004..578135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0593"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07035"
FT                   /protein_id="ABO07035.1"
FT                   /translation="MARPHRESTRPSEIVADNRQQSAEKTLLAHRNRCNRSAAGGAP"
FT   gene            complement(578199..578369)
FT                   /locus_tag="BMA10247_0594"
FT   CDS_pept        complement(578199..578369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0594"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07184"
FT                   /protein_id="ABO07184.1"
FT                   /translation="MDAESIAGLIGLGIGLLVLVSLSVYESREYKRAHNGEGMIHHWMA
FT                   EHHLLDWRRKH"
FT   gene            578537..578728
FT                   /locus_tag="BMA10247_0595"
FT   CDS_pept        578537..578728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0595"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04654"
FT                   /protein_id="ABO04654.1"
FT                   /translation="MTRIVIIALVAAVLAGCASDPRQGRRGTPPQDPPDYQGVPTDMTP
FT                   PSMLGEPGTGGTAATPAK"
FT   gene            complement(578983..580374)
FT                   /gene="dinF"
FT                   /locus_tag="BMA10247_0596"
FT   CDS_pept        complement(578983..580374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="BMA10247_0596"
FT                   /product="DNA-damage-inducible protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05649"
FT                   /protein_id="ABO05649.1"
FT                   /translation="MSASSPPTHADEDPEPRAAANGHRRVLGLALPIIAANLTQPILGA
FT                   VDTAVAGHLNGPQYLGGVALGGLFFNFVYWGFGFLRMGTTGLVAQAFGANDLAGIRINV
FT                   LRALLLAFTLGAAVLALQTPLLGIAFAALGGSDSVRSTALEYAHARIGAAPFALANYVV
FT                   LGYLLGMQRVRLALVIQVLVNVVNIGAVLLYVYRFDWGVAGIGAATATADIAGFAASAL
FT                   LLRWLNPRGLAKIRRVELFDRAALARLVALNRDIFIRTLCLLSAFGWFAHLGARQGDAT
FT                   LAANALLLNFQTFMAYALDGFAHAAEALVGAAAGARNRDAFRQALRTTFFWAGIGALAF
FT                   ALAYWCAGGWIVAQLTDQPSVRGVAERYLPWAALSPVISVWGFMLDGVFIGATHTRALM
FT                   RAMATSFALFVAATLALVGPLGNHGLWIALLVFMAARGATLARRLPGLERAVAPDAARA
FT                   PSAAG"
FT   gene            complement(580382..580699)
FT                   /locus_tag="BMA10247_0597"
FT   CDS_pept        complement(580382..580699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0597"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05623"
FT                   /protein_id="ABO05623.1"
FT                   /translation="MSSNTPPSASHSPLYLNLLGETAKIDWCDLERFFAQGKLLSVARD
FT                   LDLVSVAEAIASDDKEQVTRWLSAGHVERMQAGTAQDYATRNPELWAVVVSPWVCVQAR
FT                   S"
FT   gene            complement(580732..580902)
FT                   /locus_tag="BMA10247_0598"
FT   CDS_pept        complement(580732..580902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0598"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05756"
FT                   /protein_id="ABO05756.1"
FT                   /translation="MREAAAPHACAGRHRGRRACRSNGLIGFIHVPIVARRRPPRNPSE
FT                   RPSLAARANGL"
FT   gene            complement(580964..582589)
FT                   /gene="acsA-2"
FT                   /locus_tag="BMA10247_0599"
FT   CDS_pept        complement(580964..582589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsA-2"
FT                   /locus_tag="BMA10247_0599"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06742"
FT                   /protein_id="ABO06742.1"
FT                   /translation="MLPHAAHYAELVERFAWRVPAHYNIGVDACDKWADGSGRLALIHE
FT                   HAHGVVARYTFDELRSSSNRLANSFARAGVKRGDRIGILLAQGPETAIAHLAAYKLGAI
FT                   AVPLFTLFGADALEFRLGDSGAVALVTDRAGYEKIAPLHASLPSLATIYCIDGAPDLAE
FT                   PGVLAFDAALAAESDTFRPADTSADDPALIIYTSGTTGKPKGALHAHRVLLGHLPGVEM
FT                   SQNLFPARARLFWTPADWAWIGGLLDVLLPSLHHGVPVLARRFEKFGGAAAFDLLARHG
FT                   VTHAFLPPTALKLMRAAVARPRERYALALESVASGGESLGAELVSWGRDAFGVTINEFY
FT                   GQTECNVVLSSCSALFEPRAGTIGKAAPGHRVAIVDDAGNALPPGVTGNIGVRAPDPVM
FT                   FIGYWRRPEATREKFAGDFLLTGDLGIADADGFIRFVGRNDDVITSAGYRIGPGPIEDC
FT                   LLEHPAVRMAAVVGVPDAVRTEIVKAFVVLNAGYEGSAALARELQTHVKTRLAAHEYPR
FT                   ALAFVDSLPMTATGKIIRRALRDT"
FT   gene            582569..582682
FT                   /locus_tag="BMA10247_0600"
FT   CDS_pept        582569..582682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0600"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04256"
FT                   /protein_id="ABO04256.1"
FT                   /translation="MGGVGQHRASPVVFSYAVSMHSTPNRRAYARALGSIL"
FT   gene            582748..582867
FT                   /locus_tag="BMA10247_0601"
FT   CDS_pept        582748..582867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0601"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04182"
FT                   /protein_id="ABO04182.1"
FT                   /translation="MDLLLIATGLSVIGIGALVAFARRVDPLSGRLHGRLRKR"
FT   gene            complement(582945..583835)
FT                   /locus_tag="BMA10247_0602"
FT   CDS_pept        complement(582945..583835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0602"
FT                   /product="putative peptidoglycan-binding LysM/M23B
FT                   peptidase"
FT                   /note="identified by similarity to SP:P33648; match to
FT                   protein family HMM PF01476; match to protein family HMM
FT                   PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05114"
FT                   /protein_id="ABO05114.2"
FT                   /translation="MSHGGSPLGRPPRSPRPTRAPPAARPPSAPPRPRNREPAAEPVKI
FT                   GRFCPAVAHRRDGALRGSMLLKTTRRLVVASLAALLAACGSAPVGPGFYRVERGDTLSK
FT                   IARSNRQSVANIARWNQITNPDAIEVGQVLRVAPPPGTASTSGTTGASRGPSRQAPSSS
FT                   ATSPASSVKPASSISLVWPAAGSVIRSFDGSKSKGIDIANTAGTPVIAAAAGTVVYAGN
FT                   GLRGYGNLLIVKHDADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDTDNDRVALHFELR
FT                   YGGRSIDPARYLPSR"
FT   gene            complement(583943..584644)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0603"
FT                   /note="aldose 1-epimerase, truncation; comparison of this
FT                   gene to its homologs suggests this gene has been truncated;
FT                   identified by similarity to GB:ABA50366.1; match to protein
FT                   family HMM PF01263"
FT   gene            584847..585110
FT                   /locus_tag="BMA10247_0604"
FT   CDS_pept        584847..585110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0604"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07176"
FT                   /protein_id="ABO07176.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            585134..585967
FT                   /locus_tag="BMA10247_0605"
FT   CDS_pept        585134..585967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0605"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04186"
FT                   /protein_id="ABO04186.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(586012..586443)
FT                   /locus_tag="BMA10247_0606"
FT   CDS_pept        complement(586012..586443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05145"
FT                   /protein_id="ABO05145.1"
FT                   /translation="MRALPRTGEKCKQCPPEQTGLPVRRYYRMNREPREYQGRVTSRPY
FT                   SIEEGWSEEWSWLGLDYDGFQASECLLQEAKGNFDQFFSRKTRRPMKWFSGFGKIDLQI
FT                   EARANIVRANPPTKLRYYFQTPLTASYFRERLARNGIAY"
FT   gene            complement(586478..586927)
FT                   /locus_tag="BMA10247_0607"
FT   CDS_pept        complement(586478..586927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0607"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04940"
FT                   /protein_id="ABO04940.1"
FT                   /translation="MAGLAQIDERGFVERVRQDLVKENPAFADDGGLSSRLWTAYRAAR
FT                   TFGIERDENVVAFLRLEAYAPGFYEKPATKAWLMRPGRSADARFHDYLRVIKWRIEHPD
FT                   GGLEHGGIGISGNRSGGGRAWADLGARWRRLVGRRDGGGNGESVG"
FT   gene            complement(586944..587450)
FT                   /locus_tag="BMA10247_0608"
FT   CDS_pept        complement(586944..587450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0608"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05882"
FT                   /protein_id="ABO05882.1"
FT                   /translation="MMTPPSINAHFEMRRQQITLPARLFAMVDALLFAEASDAPALRRA
FT                   NYSIALFDRTPDASLADHGPWLIDYALAPGPIRRVLAELAAGPIGMSWLISAYPFDRLA
FT                   AELREHLDVRLPDGRTALFRFYDARIMPDIARVMSDAQRSQFFVATYDWLVEIDGRLTG
FT                   VHPHA"
FT   gene            complement(587447..587872)
FT                   /locus_tag="BMA10247_0609"
FT   CDS_pept        complement(587447..587872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0609"
FT                   /product="PAAR motif family protein"
FT                   /note="identified by match to protein family HMM PF05488"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04647"
FT                   /protein_id="ABO04647.1"
FT                   /translation="MAKRAIICVGDTTTHGGKVLEGAPTFTLNGRNVAGVGHQVLCPRC
FT                   KGIFPILPDLLGRRYPHTIGERDTAVDGMRTACGAELIASQGTGTIDDVGAGERGDGGS
FT                   PGGSAAAAAAAVAPSPTLCLECLKAAAKKAATMVARG"
FT   gene            588696..590510
FT                   /locus_tag="BMA10247_0610"
FT   CDS_pept        588696..590510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0610"
FT                   /product="transcriptional regulator, MerR
FT                   family/methyltransferase, TIGR00027 family"
FT                   /note="identified by match to protein family HMM PF02409;
FT                   match to protein family HMM PF05583; match to protein
FT                   family HMM PF09278; match to protein family HMM TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03978"
FT                   /protein_id="ABO03978.1"
FT                   /translation="MLSPSQRTDGGARLYGRDDLIRLHRIEALKRFGYSLPAIQASLDG
FT                   PPAGAPLQILRRQIAALDAQAARAQRLSRHLQHLVAMVAAGGETAAIDWLNVLELMNMY
FT                   QKHLDDNELDTLLASGPDTVAPMDPSWVGLVDEVRDAMRRALPADSDAAQALAWRWSRL
FT                   MNRMTRNDPALAGKLMGIQLGEPRAQHIVGITPAMLTWIGEACAHARCTLFAKYLNPAQ
FT                   IAEVRRRQLADTHMHAWLALVAELRAHMEAGVDAGAAPVQAIVARWQQLFRDSFCGEEE
FT                   GLEAKVRDALMREPDLQLGGGFDEALLVYLNKAHIAGRDIASGDDGPKPSALMVAKQRA
FT                   AHQLLDRPLVLDDPIALSILGAAEEQALRADLDRFRYPASLGMRSSVVVRSRLADDMRA
FT                   EAIGRGVRQYVVLGAGLDTSAYRHPEAPGRLFEVDLPATQRWKQARLREAGIALPRSLR
FT                   FVPVDFEHVSLADGLARAGFDPGAPALFSWLGVTMYLDEAAVVETLRFIAGCAKGSAVL
FT                   FEYVTPLSGLPPMMRIAMEQLTAQLAARGEPWKCFFEPAALAEMLIGLGFGSIGAWSPD
FT                   ELNRRYLADRADGLHIGATPARLILATV"
FT   gene            complement(590577..592256)
FT                   /locus_tag="BMA10247_0611"
FT   CDS_pept        complement(590577..592256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0611"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05352"
FT                   /protein_id="ABO05352.2"
FT                   /translation="MWPRLAGNFGGGRPRAKRGASASARCDGAGGAHRRRSARKRREGA
FT                   RRGESRYDYRFDRYFPEGYVFVKTWGQFMVETLAGLFDFEMDPQSGVALTRQLRDQLRR
FT                   AIAAGSLASGRRLPSSRALALHLRVSRNTVCAAIEQLAMEGYLDVSRGRRPVVAPMPSA
FT                   GLVAIGSDRPVSDGRSGMSQWAQRIDRSDWPFISEGRPTPFAPCVADARAFPHAIWGRC
FT                   LRTATRYAVARTSTACNRPGLRRALLHHLVEYRGVNADAHQVFLMPTAQAAIALVARVL
FT                   LDPGDLAWVESPGYGGARAAFEAAGATVQGIALDQSGMAFETSTDTPRLIFVTPAHQHP
FT                   TGLLMPPARRQALLRFAARVGARIIEDDYDSEFHYEGRPVAALQGADDADSVFYVGTFS
FT                   KSLHADIRVGYVVVPGHFVDVFAKAQRHTGQIVGATLQDALAEFIDDGHYAAHIRKTTR
FT                   LYHARRDYLCDALKAVGSELTVSPPDGGMQVVARLGPLRDDREICRRLAEAGVTARPLS
FT                   PHYCAQTGAQGLFLGFAAWNECEIDAGVRILARVIREPEPSK"
FT   gene            592260..592637
FT                   /locus_tag="BMA10247_0612"
FT   CDS_pept        592260..592637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06460"
FT                   /protein_id="ABO06460.1"
FT                   /translation="MEIDAISRALQIYFDVMYECDLEKFDLVFHPTSSLFTMKDGELSV
FT                   RPFARYRSEIAARTPPKSVSQPRMDAILQIAVLSPEIAFAQVRVRLFGKVFIDNLNLLK
FT                   FDGRWMIVAKIFHHARTIAAV"
FT   gene            592751..593239
FT                   /locus_tag="BMA10247_0614"
FT   CDS_pept        592751..593239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04679"
FT                   /protein_id="ABO04679.1"
FT                   /translation="MVGSRLAGLSIPIPRIGANEAIEFAPRACEPEFAARRRGMNGAFH
FT                   RRRQYTGYMAGVSAEFKAFEEATSGAVMTKGFLWRNKIAAGFTNSGAHAGDKLSTLMQL
FT                   ALFAARYGMHWVNLGLPPANDSTAGSPAELNRLGFGLGAGAQSNTDQGPDAAPPEQPE"
FT   gene            complement(593200..593457)
FT                   /locus_tag="BMA10247_0613"
FT   CDS_pept        complement(593200..593457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06937"
FT                   /protein_id="ABO06937.1"
FT                   /translation="MSARAARTKRRDAAAPIIGPNRRVCAAGARACIRENKACIRENKY
FT                   CRRACASREVDRHAYAYLAYSAYSAYSAYSGCSGGAASGP"
FT   gene            complement(593454..596246)
FT                   /gene="treY"
FT                   /locus_tag="BMA10247_0615"
FT   CDS_pept        complement(593454..596246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treY"
FT                   /locus_tag="BMA10247_0615"
FT                   /product="(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM TIGR02401"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07048"
FT                   /protein_id="ABO07048.1"
FT                   /translation="MKPRATLRLQLHAGFTFDDAAAHVGYFARLGVSHLYLSPITAAEP
FT                   GSRHGYDVIDYSTVNPELGGEAAFVRLIDALRRRGMGAIVDIVPNHMGVGGSSNRWWND
FT                   VLEWGARSRFARHFDIDWHASDPALQRKVLLPCLGRPYGEALAAGDIALRADAAHGRFA
FT                   IACAGRTLPVQIGAYPDILRAANRSDLNALAERFDAPGARPSNHARLDAAHAALRDYAA
FT                   ARGPGALDAVLHGFDPRIARSREMLHRLLEQQHYRLAWWRTATDEINWRRFFDISTLAC
FT                   MRIEDAAVFDDVHALLWRLYAAGLVDGVRIDHVDGLADPRGYCRQLRGRLAALRDGEPY
FT                   IVVEKILAPDERLPEDWRVDGTTGYDFMNDVSALLHDAAGAAPLAALWADMTGAETTFA
FT                   REALDGKRRVLARQFAAEHERVARAMHRLARASRDARDFALNPIRRAVAELAIRLPVYR
FT                   LYPSAGAPQRTDRALLAGAWQAARSAIAPADRAALDYVAATLGLPGVARAVAGLGDPAR
FT                   LAARVGFAQLTAPLAAKGVEDTACYRYGRLLSRNEVGAHADALSLAPGAFHTRNRRRRR
FT                   TFPGALLATATHDHKRGEDARARLAVLSEAHRAWRAAALDWAAFNAPHHHGAPAAADRI
FT                   PGPAAEAMLYQTLVGAWPPALAPDDAPGLAALTDRVERWQLKALREAKRDTDWLEPNLG
FT                   YEAGCAAFLRAIMTPRGPDDFAHRLHRLVARIAPAGIVNSLSQAALRLLSPGVPDLYQG
FT                   AQTWDHTLVDPDNRADVPFARYAAQRIDAPVAAYLRDWADGRVKHALIGRLLALRAAHP
FT                   ETFAAGAYVPLHVRGTRRGHALAFARRDASTTIVVIATRLAYPLLGDAPARPCVEAACW
FT                   ADTAVGLAPGFAGPWRDMLNDGTLDAPSGMLPLAAALAHLPVAVLIREGGAADTPRRGA
FT                   "
FT   gene            complement(596243..598465)
FT                   /gene="malQ"
FT                   /locus_tag="BMA10247_0616"
FT   CDS_pept        complement(596243..598465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="BMA10247_0616"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="identified by match to protein family HMM PF02446;
FT                   match to protein family HMM TIGR00217"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06259"
FT                   /protein_id="ABO06259.1"
FT                   /translation="MTADPRHPSIVELADAAGLDAHWIDASGFARRVGDDMLAALLDAL
FT                   GYPCDTRAARAESAARLAAHAQAAPRLVTGDVDAPLTLPASLGRPGACYRVTLENGDAV
FT                   AGRFAQPAGAAVLPPLATPGYHVLDTGEQRTTLAIAPPSAWTPADAMRAAAAGGRERPP
FT                   PWGLAAQLYGLRREADGGIGDFTALAACARAAARRGAHALAISPTQAAFPALPEHDSPY
FT                   SPSSRLWRNAAYIDVETVLGAHAARAAIADAGLAAQWSALTRAPLVDWPGAVPAKLRVL
FT                   RLLFDRWRAQAPTGADAGPRAFARFRARHAGALDAHATFDALQACCIDNGIGADWRRWP
FT                   PAWRTPDAPDVAAFARAHAHDIAFHAFLQWQAARGLAAAQRAARGRGMAIGLIADLPVG
FT                   CDAAGSDAWRDGDAMLRGLSIGAPADPFNARGQAWGVTTWTPTALRARGFAPFVECLRA
FT                   GFAHAGGVRIDHVLGLARLWVVRDGAPPRDGAYLRYPRDDLLRLAALESFRHRAIVIGE
FT                   DLGTVPADFRARIAARGIVGLRALWFERDPAGAFRAPGDWDRHAAATSSTHDLPTVAGW
FT                   WRGVDLGWRWHAAASASACAPASSLSPASDAEAEANAPPARPGESEVAGPDALPPEVRD
FT                   MRRAERAALWRALQQAGVAARGQKMPPRDAPPVGAILAYVAQAPAPLAIFPLEDLLALE
FT                   GQPNVPGPPCGHPNWRRRMPRSVDALFDAPARTRIAAVRRARKRAR"
FT   gene            complement(598462..600204)
FT                   /locus_tag="BMA10247_0617"
FT   CDS_pept        complement(598462..600204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0617"
FT                   /product="putative maltooligosyl trehalose
FT                   trehalohydrolase"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02922; match to protein
FT                   family HMM TIGR02402"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05936"
FT                   /protein_id="ABO05936.1"
FT                   /translation="MNDSTATHAYALPFGATCVDARHTRFHLWAPACRSAAVERQDGET
FT                   VAMTPDGGGGFDAIVRCGPGTLYRYLLDGTLRVPDPASRFQPHGVHGPSEVVDPAAYRW
FT                   RHDDWRGRPWRETVLYEVHVGAFGGYARIARRLPALAALGITAIELMPVNAFPGARNWG
FT                   YDGVLPFAPDASYGPPDALKSLVDAAHGLGLQVLLDVVYNHFGPDGNLLPRYAPAFFRR
FT                   DRDTAWGPAIDFSCPQAGAFFLENALYWLDEYRFDGLRIDAAHAIGDDAWLAGLARRVR
FT                   AYAGDARHVHLVLENERNTASLLAGGRFDAQWNDDFHNSMHVLLTGEQAGYYRAYADAP
FT                   IRHLARVLGEGFAYQGEPSPLHGGAPRGEPSADLPPSAFVAFLQNHDQIGNRAFGERLR
FT                   ALVNDDALRAASALALLAPQIPLLFMGEECGTTQPFQFFTDHRGALAAAVREGRRREFA
FT                   AFPAFADPAHRDAIPDPNDPATFARSSLVARWRLGDGSTLAIALNLDARPAALAAPPDG
FT                   KIVFETPPRARDALADARLAAHACIAWRSGNVNGVARRGRAVDAKHMPAVKHANGVNGQ
FT                   DGAP"
FT   gene            complement(600231..602339)
FT                   /gene="glgX"
FT                   /locus_tag="BMA10247_0618"
FT   CDS_pept        complement(600231..602339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="BMA10247_0618"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02922; match to protein
FT                   family HMM TIGR02100"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05197"
FT                   /protein_id="ABO05197.1"
FT                   /translation="MPTPTPDRLEPGRSYPLGAHWDGLGVNFAVFSAHARRVQLCLFDP
FT                   TGRREIARLDLPECTDEIWHGYLPDAHPGTVYAFRADGAYEPQHGHRFNPHKLLLDPYA
FT                   RKLVGQFRWSDALFGYRLHSSRADLSIDRRDSAPAMPKCVVVDEAVDWSTDRRPCVPWR
FT                   DTVIYEAHVRGVSMRRAELRAPERGTFAALACPAFIDHLLALGVTSVELLPVHAFMHAR
FT                   ALVNLGLCNYWGYDTAAFFAPEPSYLATRRLDEMRIAIRQLHAAGIEVLLDVVYNHTCE
FT                   GNQLGPTICWRGLDNASYYRLAPDDPRRHIDETGCGNTLDLSHPRVLQMVMDSLRYWSN
FT                   AFNVDGFRFDLCATLGREAAGFDPGAGFFDALRQDPVLATRKLIAEPWDVGPGGYQLGR
FT                   HPAGFAEWNDRFRDTVRRFWRGDAGMRPELAARLAGSADLFNHHGRRTWSTVNFVAAHD
FT                   GFTLADLVSYAAKHNDANGEDNRDGRDDNCSANWGAEGPTEDRQVRAVRARVARSLLTT
FT                   LFAALGTPMLLGGDEFGRTQQGNNNAYCQDNELSWFDWSAAESADGRTMIHFVGRLAAL
FT                   RRAYPVLSEPRYPSGERDGAPGLHEIDWFDERGDALTVPAWHDRERRALTMRRVGNGRA
FT                   GRPEALLLMLNASSDAIVFHAPPPSLVYRILLDSAAPDAAPRLMPADGVEIAAHAAVIA
FT                   AASVPEAG"
FT   gene            complement(602392..604604)
FT                   /pseudo
FT                   /gene="glgB"
FT                   /locus_tag="BMA10247_0620"
FT                   /note="1,4-alpha-glucan branching enzyme, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF02922"
FT   gene            complement(604601..607996)
FT                   /gene="treS"
FT                   /locus_tag="BMA10247_0621"
FT   CDS_pept        complement(604601..607996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treS"
FT                   /locus_tag="BMA10247_0621"
FT                   /product="trehalose synthase/maltokinase"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM TIGR02456; match to protein
FT                   family HMM TIGR02457"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06288"
FT                   /protein_id="ABO06288.1"
FT                   /translation="MKPADTLEDVGRAQFVAHMARRPRRARRREAPGVADTPLWYKDAI
FT                   IYQLHVKSFFDANNDGVGDFAGLIAKLDYIAELGVDTVWLLPFYPSPRRDDGYDIADYR
FT                   GVHPDYGTLADVRRFIREAHARGLRVITELVINHTSDQHPWFQRARRAKRGSVHRDYYV
FT                   WSDTDLKYAGTRIIFLDTETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVLQIM
FT                   RFWLDLGIDGLRLDAVPYLVEREGTSNENLPQTHAILKLIRATIDAEYPNRMLLAEANQ
FT                   WPEDVQEYFGDEDECHMAFHFPLMPRIYMSIASEDRFPIIDIMRQTPALAPSNQWAVFL
FT                   RNHDELTLEMVTDSERDLLWQAYASERRARLNLGIRRRLAPLMERDRRRIELINSILLS
FT                   MPGTPVIYYGDELGMGDNLHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMGTLY
FT                   GYDAINVEAQTRDPHSLLNWTRRILSTRRATRVFGRGAIRFLRPGNRKILAYLRELDGE
FT                   TPVLCVANLSRASQAVELDLSEFAGCVPTEMTSDSPFPPIGQLPYLLTFPPYGFLWFAL
FT                   SEHGREPAWHQQYAEPLPEYLTLVMRRGETQPGAALLDTLAQDALPSWLARRRWFASKE
FT                   RRVDSARFDALTPIPGEPFQYAEARVAVDGREERYVVPLASAWGSETPQPLFAQLALAR
FT                   VRRGHTVGLLTDAFALPSFAHGVLRQLRAGAAVPVAGGGRLEFRPEPDLARLDPGDAPG
FT                   VRWFAAEQSNSSLVIGEAIVLKIVRKLATGVHPEAEMGRHLRRIGYRNVAPLVGEVVRI
FT                   GADGAPHTVAILQEYVDNQGDAWTRSCDFLKRAIEELALPAANDADAAAPSAEPEMIDG
FT                   YATFAGIVGKRLGELHAALAQPSDDAAFAPQRVSPARVDGWIGDALGWFERAASLLAER
FT                   LDTLEGQTRAAAELLVAQRAAVAEALRALVPRELDGCCIRIHGDFHLGQVLDVQGDALL
FT                   IDFEGEPARPLGQRRAQSHPLRDVAGFLRSLSYASAAAQFTIEKAPQQAAERKRALFER
FT                   FGQAAADRFVAQYREALSAASREFVEPRYADRLLALFLIEKASYELCYEAANRPDWLSV
FT                   PANGLAALVARLIGGAAPQQEDAR"
FT   gene            complement(607993..611340)
FT                   /locus_tag="BMA10247_0622"
FT   CDS_pept        complement(607993..611340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0622"
FT                   /product="alpha amylase family protein"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05547"
FT                   /protein_id="ABO05547.1"
FT                   /translation="MHAWPPLFERVAAWGFDHVLIGGLWAASRRGYPRHVADPDRPAES
FT                   FATSLDATSALARLSDSAREHGLRIAVEVVVDRVAREHPLHDAHRDWYVVDERDDALID
FT                   PRTAALAHDVAHANVGSAAALDALADWWRARLGALADAGAAAFLVDAPQRMPAHWWAAL
FT                   LRALRQARADLPVIAGVPGREREALAQLACAGFDAAFSSLRWWDLRAPWFVEEHRLLRR
FT                   VGAPIAFPDAFDGPRLAHDWRQAAPETIERAHRRALWTAAALGTGWLVPMGFERGVAVE
FT                   LMAREPRADAYRAALDSAPFDLSGAIAEANALRRAAPALRGNGEIAQLTGADAPATVLL
FT                   CGARTALEYDDEAALIAVNPDLAHPAAIAPCAALAGVPGGFTRFAPFADGRRPRMGALE
FT                   PFALAAGACTLLRAQRARPVTTAPAEDRRGNRPGTRASVTAALAGERIAIERIEPVVDD
FT                   GRFAVKRVIGERLAVRAAIFADGHARLAAAVQWRAADENGWHEARCAAEGNDAWRADIP
FT                   LERLGRHLFRVIAWRDDWATLVDEIGKKHAAGQAVALELEEARRLAADVLARAPEANPA
FT                   ALAVLREFAAALDAAPPDQRLALIGAPHVADAFAALRERAFATRDAPVFPVDVERRAAR
FT                   FASWYEMFPRSASDDVRRHGTFDDVVAHLPRIRDMGFDVLYFPPIHPIGTTARKGRNNS
FT                   LQAAPDDVGSPYAIGSPAGGHTAVHPQLGSLDAFRQLVAAARAHDLEIALDFAVQCSPD
FT                   HPWLTEHPGWFAWRPDGSLRYAENPPKRYQDIVNPDFYARDAMPALWIALRDVVLFWID
FT                   AGVRIFRVDNPHTKPLPFWAWMIADVRARHPDTVFLSEAFTRPSMMYRLAKLGFSQSYT
FT                   YFTWRESKREFIDYLTELADGPAREYFRPNFFVNTPDINPRHLQQAPRTQFVIRAALAA
FT                   TLSGLWGMYSGFELCESDALPDSEEYRDAEKYELRARDWRRPGHIGDEIARLNRARRDN
FT                   PALQTHLGIRFAHAPNDAVLVFSKATPAHDNVVVVAISLDPWHPQATDFTLDAALYRGW
FT                   GIADGERLVAVDQTADHVETWHGRRHYVALDPHVRPFAIWRVAPAAGVARGARDDARDV
FT                   PAQEVHER"
FT   gene            611335..611505
FT                   /locus_tag="BMA10247_0623"
FT   CDS_pept        611335..611505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0623"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05031"
FT                   /protein_id="ABO05031.1"
FT                   /translation="MQWPDETGIAEVKVRRERRTGFHGRDDVAATECLHGAITVPGMRA
FT                   GVPAPVGARPL"
FT   gene            611586..611918
FT                   /locus_tag="BMA10247_0625"
FT   CDS_pept        611586..611918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0625"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04676"
FT                   /protein_id="ABO04676.1"
FT                   /translation="MRRRFHRPCRAAAPPCRRAARRGARAVGRLPALAGDARRGFRAGS
FT                   DGVAPMRTRACRGSHGNATGRGREGEARDEGGFDGHRRGFAHARSASAAGRPMCRAPAH
FT                   GQSPMM"
FT   gene            complement(611894..613372)
FT                   /locus_tag="BMA10247_0624"
FT   CDS_pept        complement(611894..613372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0624"
FT                   /product="poly(3-hydroxybutyrate) depolymerase"
FT                   /EC_number="3.1.1.75"
FT                   /note="identified by similarity to SP:P12625; match to
FT                   protein family HMM PF00041; match to protein family HMM
FT                   TIGR01840"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05174"
FT                   /protein_id="ABO05174.1"
FT                   /translation="MTRNARRTWQWISGLLAICAAALAALPARADVAAGPGAWSSQQTW
FT                   GADTVNGGNLTGYFYWPATQPTTPNGKRALVLVLHGCLQSASGDVIDNSRGAGFNWKSV
FT                   ADRYGAIILAPNATGNVYGNHCWDYANTSPNRASGHVGVLLDLVSRFVGDAQYAIDPNQ
FT                   VYVAGLSSGGGMTMVLGCIAPDIFAGIGINAGPPPGTTTLQIGYVPSGYTAQTAANQCK
FT                   AWAGSKADQFSTQIAGAVWGTSDYTVAQAYGPLDTAAFRLIYGGTFAQGSKVSIAGGGT
FT                   NTPYSDSNGKVRTHEIVVSGMAHAWPAGAGGDNANYVDATHVNYPAFVMDYWVKNNLRA
FT                   NGAPVQAGTPPTGLTVTNATQTSISLAWNPVANASSYNVYRNGNKVGSSTSTAYTDAGL
FT                   IAGTAYSYTVTEIDPSLGESAPSPAVSATTQPSFACSATTATNYAHVQAGRAHDSLGIA
FT                   YATGSNQNMGLDNVFYTNTLAQTSAGYYIIGDCP"
FT   gene            complement(613555..613845)
FT                   /locus_tag="BMA10247_0626"
FT   CDS_pept        complement(613555..613845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06724"
FT                   /protein_id="ABO06724.1"
FT                   /translation="MSLARPAKHAAARARDIETTTGDTSAADTAVHACTRMHVRTGNRR
FT                   RAICRLEADGFPRARRNLPACHRGGARRYPARIFRLARRISPNGIKCIRYF"
FT   gene            613876..614001
FT                   /locus_tag="BMA10247_0627"
FT   CDS_pept        613876..614001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0627"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04400"
FT                   /protein_id="ABO04400.1"
FT                   /translation="MAIGLPNPAARLRQAARTWPGRAPAASTQFELNPLFQKCIL"
FT   gene            complement(614080..614298)
FT                   /locus_tag="BMA10247_0628"
FT   CDS_pept        complement(614080..614298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0628"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06914"
FT                   /protein_id="ABO06914.1"
FT                   /translation="MDRIFMTRTEALEFLLKAHQTAVDKVGHPFRKPTPADHAAVEALD
FT                   RLLLDVRARRIDTFQINASSAQVIVTD"
FT   gene            614540..614695
FT                   /pseudo
FT                   /locus_tag="BMA10247_0629"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(614794..615081)
FT                   /locus_tag="BMA10247_0630"
FT   CDS_pept        complement(614794..615081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0630"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05490"
FT                   /protein_id="ABO05490.1"
FT                   /translation="MLDEVLDEVLVEARDVVRDSDDDSDSDGDGNSHHDSDSDSESWHR
FT                   IRACQPARHAVDQRLRARHSTRAVAQFRSRLAAAAGDRSTGRSAHARIGA"
FT   gene            615264..615587
FT                   /locus_tag="BMA10247_0631"
FT   CDS_pept        615264..615587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0631"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04996"
FT                   /protein_id="ABO04996.1"
FT                   /translation="MRRSRSDARSGALSDLADSAARIANAAYIANRHMLRVPRCGRNRF
FT                   RMDIVDEPAARASRSAERKKRKKRDARRIPGAPRDRSSRGSRNGLDRLSDRVAGRAPSA
FT                   FVA"
FT   gene            615871..617295
FT                   /locus_tag="BMA10247_0632"
FT   CDS_pept        615871..617295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0632"
FT                   /product="putative liporotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04032"
FT                   /protein_id="ABO04032.1"
FT                   /translation="MKLGGGTVLGTLLAACGGGGGADAAAAAPQQSPPAGPSSSANVAM
FT                   TLPADAPRIARDFAGLSIEKAALSYPLLSGENGNMVGLFNRLGAGVLRIGGNSSDASGW
FT                   QRTGPDETSGVITPAAVDRLASFVRACRWRVIYGLNFVGNDPATIADEAAYAAQALGVQ
FT                   LAGFEIGNEPDLYAQHGLAPNANTYPGFVSRWTTFANAIRAAVPDAVFTGPATAWNYQR
FT                   YTVPFVSDAAGLVSLLTQHHYRNPDSATIEAMLSPDPSLAPMLQALQGAASARGIGFRL
FT                   AETNSYWGGGKPGVSDAHASALWVINFLFAVAQGGASGVNLHTGGGASYSAIKTNKTAG
FT                   TVAAIGPEYYGIYLFNQAAGGRLMQTRVDSAGTTLFAHAVAADGGGVRLILVNTDANSG
FT                   YDVAVDCSSVPNARAGIVTTLGGPSLGSLTGTQIDGATFALDGSGAPQGGRPVACVNGV
FT                   LGVHVASASALLVDFA"
FT   gene            617310..617459
FT                   /locus_tag="BMA10247_0633"
FT   CDS_pept        617310..617459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0633"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06967"
FT                   /protein_id="ABO06967.1"
FT                   /translation="MRRARANRDVSQPSLAHRRNAAGMLLRDKSGRRSRVAAGSGRQRA
FT                   SEDG"
FT   gene            617562..618539
FT                   /locus_tag="BMA10247_0634"
FT   CDS_pept        617562..618539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0634"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07342"
FT                   /protein_id="ABO07342.1"
FT                   /translation="MAAEWMGCDRFRANSMKVSLRHLRAFVAVAREGSFTAAAGALCLT
FT                   QSTLTKTIREFEQALGVHVFERNTRRIALTPYGAAFLVDAVRILNDLDLALDGVNQQLL
FT                   GNSGTVRVASGLAFASTVMPCVIRALHAQEPGIHVDLLDDTSGGVIRRIESGEVDVGIG
FT                   SYVGMAGNAPSVRRLLSARLGVLFPVGYPKIPSRPTLASLNEIPILRDSDESSIAAAFR
FT                   QQAPDLWERMRRKVSVTNLDLQLALVREGIGACIVSALAASHPSARGMPYRLLVEPEMT
FT                   RDVYVFTRRDVSLLPAAARFVDILMNVLPLIDFAEGVELACDGA"
FT   gene            618953..619735
FT                   /locus_tag="BMA10247_0635"
FT   CDS_pept        618953..619735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0635"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04618"
FT                   /protein_id="ABO04618.1"
FT                   /translation="MSAARKVLLVEDDEAQANWAKLVLTRGRFDVTHCQTGGQAIRAMT
FT                   KEVPDAVVLDMRLPDVHGLEVLVWIRRNFFDVPVIVLSNAMQEMQIVEAFSAGADDYVL
FT                   KPAREAEFLARIAAMMRRKGHAVSGTIEIGGIAIDLGWKAVRIDGEPVRMAPIEYEILE
FT                   MMARHLGSVVQREVLVNRIWGRSIDEAVSRSLDTHVYRIRHKLKVHGVSNVSLRSVYNL
FT                   GYRLEWCRGRALAGAAPERDDALRLAEGGGEAMLPSLL"
FT   gene            complement(619889..620023)
FT                   /locus_tag="BMA10247_0636"
FT   CDS_pept        complement(619889..620023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0636"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05747"
FT                   /protein_id="ABO05747.1"
FT                   /translation="MQAAECVDMAAACREARKADDARDERQTGWENELHGKPPCYPLA"
FT   gene            620018..620134
FT                   /locus_tag="BMA10247_0637"
FT   CDS_pept        620018..620134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0637"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05187"
FT                   /protein_id="ABO05187.1"
FT                   /translation="MHEPFGLLPLGWALTLLGGTGLLIGAAQAVVRRSARRR"
FT   gene            620145..620516
FT                   /locus_tag="BMA10247_0638"
FT   CDS_pept        620145..620516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0638"
FT                   /product="putative prophage protein"
FT                   /note="identified by match to protein family HMM PF05666"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06003"
FT                   /protein_id="ABO06003.1"
FT                   /translation="MKLSVLFVAALPLIAIAASAHAQPRHPAVYSPAAGVLCDRYVCAD
FT                   DQGISRALTERYLGKRVAAKAFSQGDFDPTEFTFANGVFCDVKERLCRDDRYYGADGKR
FT                   SGAVSRRYTELLFGRRSGG"
FT   gene            complement(620568..620903)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0639"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            620986..621144
FT                   /locus_tag="BMA10247_0640"
FT   CDS_pept        620986..621144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0640"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07072"
FT                   /protein_id="ABO07072.1"
FT                   /translation="MRDMQRPAKSSGMRMAFCEIDDARASPLRFDGGLSEYSALFRKVV
FT                   KFHDMTC"
FT   gene            621510..622205
FT                   /locus_tag="BMA10247_0641"
FT   CDS_pept        621510..622205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0641"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04752"
FT                   /protein_id="ABO04752.1"
FT                   /translation="MVLIYLIEDDEVQARCYAAILQHAGYSVRVLPDGERALREIQRAA
FT                   PDLIVLDRRLPDIDGLEIIAWVRERCAPLPILVLTNAVLETDLVEALEAGADDYLIKPP
FT                   REREFVARVNALRRRASISKQFEGTIEIGGYRIATVERAVYLAGERIPLSPKEYEIVEL
FT                   LARHVGQVVPRKTIISRVWGRAAEEEVSRSLDTHIYRIRRKMNLSRRNGAMLRVIYTHG
FT                   FRLDDFSHV"
FT   gene            622306..622461
FT                   /locus_tag="BMA10247_0642"
FT   CDS_pept        622306..622461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0642"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05523"
FT                   /protein_id="ABO05523.1"
FT                   /translation="MWKAARHERACAAERSAMRGGGLRDENARRNARRNARRNARRMAE
FT                   IKSAQI"
FT   gene            622497..625865
FT                   /locus_tag="BMA10247_0643"
FT   CDS_pept        622497..625865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0643"
FT                   /product="hemagglutinin family protein"
FT                   /note="identified by match to protein family HMM PF03895;
FT                   match to protein family HMM PF05658; match to protein
FT                   family HMM PF05662"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05845"
FT                   /protein_id="ABO05845.1"
FT                   /translation="MRFRNVQIRIVPRQINFNCSTKLFEAYLREDEMNKTYRVSWSASR
FT                   GAWMVAPETARRKGKGHSLTIVCAIASGLLLAAPAWADTVSPSGTDNVYGVDATDPGVS
FT                   TNQGNTAYGAQAGAKVTGSYNTAIGYQAGQNVNVIDTVSIGKQATASANDAIAIGTNTK
FT                   ASGPADIYMGLNAGAGAGSTTSPDGTVTLGIRNMGLGESAGSYVTGQNNTGIGYQSGMN
FT                   VTGDQNVGLGQQAGQFVTGTGNSAMGHLAGSTVSGSYNAAFGEYAGTNTSGGANAAFGF
FT                   YAGRYINGTNNTALGAYDLPVVNGTWYGSYVTGSNNLGAGHNSGAYVSGASNVGLGDGA
FT                   GTFVTGSNNVAIGTAAGSGAYTSGPSGATLNAALVASNTVSIGTRATASQSDAIAIGKG
FT                   ATASGAQSISIGTGNVVSGKGSGAIGDPSTVSGAGSYSIGNNNTVANSNTFVLGNGVTT
FT                   TQDNSVVLGNQSTDRAAVAVSSETINGTTYNYAGVASPANGVVSIGGVGTERQLINVAA
FT                   GQVSATSTDAINGSQLYATNQAVIAEDAKVNSLGGGVASALGGNAAYNATTGAITAPSY
FT                   AVYGTTQNSVGGAIDALQALAPLQYTSGPGVTTPNAPGSAPTNTVTLVGAGGPGANTTP
FT                   VTLTNVAPGKLSATSTDAVNGSQLYATNQQVANLVSSVNNGGVGPVQYSDPSAPTTPNG
FT                   GKPSQDLTLVGAASGPVALHNVAPGTASTDAVNVGQLGAVTTGLGGGAAIDPKTGAVTA
FT                   PSYTVYNADGTTSNVSNVGAAIDAINSTGIKYFHANSTKPDSQALGADSVAIGPNAVAN
FT                   NAGDVALGSGAVTSQAGGTLSETINGVTYSFAGTTPIGTVSVGAPGVERTITNVAAGRI
FT                   GQSSTDAINGSQLYGTNQSIEALTDKMNSLGNTVANTLGSGASYNPQTGAVNGPANSGG
FT                   VVTPTVIQEAANKWVSANPSTYVAPVATGTNGMAVGSGAVSTGQNSVALGTNASDGGRS
FT                   NVVSVGAPGAERQVTNVAAGTQATDAVNLGQMNGALAQQTDSFNQRLGAVQQDVDNVAR
FT                   AAYGGIAAATALTMIPEVDKDKTIAVGIGGGTYRGYQAVALGATARITENIKVRAGVGM
FT                   SSGGTTAGIGASMQW"
FT   gene            625946..626656
FT                   /locus_tag="BMA10247_0644"
FT   CDS_pept        625946..626656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0644"
FT                   /product="ompA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06693"
FT                   /protein_id="ABO06693.1"
FT                   /translation="MFKTIVLAACAAAVLGACTSATGPRFNAYVLSDAAGAKTYKVECH
FT                   GLFEGPGVCRDKAREICADKDVHVLTGVGPLGHDDDVRTLAFQCGEPAQPVAQQPQPAP
FT                   AAAPAAEPIRLNADAMFAFDRADAASMTEQGRQQLSQLAQRLTDRHAQTVSIVGYTDRL
FT                   GSDAYNRQLSQARAKTVGDYLIAAGVPADSVHAEGRGASDPLVQCDQRERAALIACLSP
FT                   NRRVEVVAAGLDGA"
FT   gene            626658..628187
FT                   /locus_tag="BMA10247_0645"
FT   CDS_pept        626658..628187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0645"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04164"
FT                   /protein_id="ABO04164.1"
FT                   /translation="MTAELDARVRALTLRAQQLFDDGRPEQGALLAAQALALAPDDALA
FT                   LKLVGVAECMRGDHAAGLVYLERACLSAPGDANLHYNVAVAHECTGSHERAALSYRHCL
FT                   RLQPDHADALWNYGEYLRLNGHFEAAARCFEALQAQACRYPSMHHRMAVVYTHLHRFDD
FT                   ARRHFALAMDENIDTRVTRWERAHLRLGTRDFARGWPDYDTRFDIGHLINVHCHPFPIR
FT                   LWQGEPLAGKTLLVHGEQGLGDEIMFASIVPDIVRQAARVVLACAPSLVSLFQRAFPSA
FT                   IVRAHRAGVAPARVDDLGAIDYQSPIGSLPRWLRASEASFGTGAPYLAADPARVAWFGA
FT                   RLRALAPRADRALKVGLTWGSNPAAAVPSAARRATRKSMPLRLLAPLARVPDVQYVSVQ
FT                   NAELGEQAATVPELDLIDFSSALRDFADTAALVANLDVVVSVDTSVAHLAGALGKTTYT
FT                   LLMRNCDWRYGFEGERCVWYESMTLLRQTTQDDWLPVVDRVIDALARYRKQ"
FT   gene            628204..628548
FT                   /locus_tag="BMA10247_0646"
FT   CDS_pept        628204..628548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0646"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04871"
FT                   /protein_id="ABO04871.1"
FT                   /translation="MDHDPQLTERWLEIHAEIEALRRKAKAAAIMQIELLMTQYGISPG
FT                   ELKGVDGAPAHRKPKARYWNPETGQTWSGRGRMPKWLVGRELASHLIDGESALKRMKLL
FT                   NRDAQGADEG"
FT   gene            complement(628971..629213)
FT                   /locus_tag="BMA10247_0647"
FT   CDS_pept        complement(628971..629213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0647"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05103"
FT                   /protein_id="ABO05103.1"
FT                   /translation="MQLRTLLLALAIVAIAVATTYYIVTVDTDTPFATTEPAASAASAA
FT                   GASEPTARLIAPGDGAPSTPIARDDAQSPLPDAWK"
FT   gene            complement(629259..629819)
FT                   /locus_tag="BMA10247_0648"
FT   CDS_pept        complement(629259..629819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0648"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07203"
FT                   /protein_id="ABO07203.1"
FT                   /translation="MLAGAALVSLPACAAESREIAHRPWGAIEPAEAAPDIEVSLADGT
FT                   RGRLVDLLRGKTSAIQFVFTGCSATCSLQGAIFQSLQAQLARHPIGGAQLLSISIDPAN
FT                   DTAVAMTAWLRRFGAQPGWQAAIPASGDLARLARLYRDERNPADSHIDQAFISSRSARF
FT                   VWKTDHLPTPESVHDALRYYASH"
FT   gene            complement(629854..630342)
FT                   /locus_tag="BMA10247_0649"
FT   CDS_pept        complement(629854..630342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0649"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04403"
FT                   /protein_id="ABO04403.1"
FT                   /translation="MSIASPVRPPRRRVARALVLAAFVALAALGGTARASPDDAPAARA
FT                   ARGARLFDGSDPMHGRLAGHAQVLPSTASRCANCHQPPAPRAAPALAPPLDASSLLAPQ
FT                   KRRGGPPSAYTADSFCATLRSGIDPAHVTLKAAMPRYDATDAQCADLWAFLIPIPTSR"
FT   gene            complement(630369..632771)
FT                   /locus_tag="BMA10247_0650"
FT   CDS_pept        complement(630369..632771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0650"
FT                   /product="galactose oxidase-related protein"
FT                   /note="identified by match to protein family HMM PF00652;
FT                   match to protein family HMM PF01344; match to protein
FT                   family HMM PF07646; match to protein family HMM PF09118"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05596"
FT                   /protein_id="ABO05596.1"
FT                   /translation="MASIDARLFIFGLLLFLSGLAHADTPSAAQPSPYGIVSVDIDGTR
FT                   LCMEVGGAAVAPLAGVDVGECRQSADQQWSLVPNGQNFQVVAKHSLQCLTIANAATSPG
FT                   APLVQYPCNGGSNQQWSVSPSRSGYKLVSAHDALCASAAGASPGSRMVQQRCDEHASQT
FT                   LYVSAPPELVGALIGMNGGLCIDGGAAGAQAVQRTCDDAPGQQWRIRPNGSAYKIHLAS
FT                   TNLCLGTRDASRGTGAAIESQRCANVASQLWTIRAASEVDGRNGYANGYWQFVSANSGQ
FT                   CIVVQNASTADGANLIQYPCGQGNAGSNTMWRVNRTSRSSWTGAIALPLVPSAAAHLPD
FT                   GKILMWSADSTISFGGGGVDGNTYTTVFDPIAQRATDAVLTSLGHDMFCPGLNLLADGK
FT                   IFVNGGVSSRKTSVYDPATHAWSPSNLMNIARGYQSSVTLSDGAVFTLGGSWNVATPDF
FT                   RLGDKYGEVWRPDSGWSILSNVPDIIGPDPAGAYRGDNHMWLVAARDRWVFYAGPDATL
FT                   RWIDTTGNGRIVEAGKRGDDAYSISGNAVMYDVGKILTVGGAPAYDNGVASASAYVIDI
FT                   SAGPQVPPVVRKVQPLAYSRGFVNSVVLPNGQIVAIGGQAVTIPFSDDQSVLVPELWDP
FT                   STEAFTRLAPMTVPRNYHSEALLLPDGRVMASGGGLCGSGCNTNHPNVQILTPPYLLNA
FT                   DGTAASRPVIAAAPEQAANGSTIAVSTDAPIRSFALVRMSSSTHSVNTDQRRIPLTFRQ
FT                   SSGGDGGYAYTVAIPADAGVAIPGQYMLFALNAGGVPSVAKTIRIGA"
FT   gene            complement(633024..633257)
FT                   /locus_tag="BMA10247_0651"
FT   CDS_pept        complement(633024..633257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0651"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05751"
FT                   /protein_id="ABO05751.1"
FT                   /translation="MRAAALVYPKNAPVRHRAIRFRHFSRRREPANDSRVASSIARMTH
FT                   ANSFSNAPRAASNRSRQAIRTRRRARFHSHRA"
FT   gene            633329..634138
FT                   /locus_tag="BMA10247_0652"
FT   CDS_pept        633329..634138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0652"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06739"
FT                   /protein_id="ABO06739.1"
FT                   /translation="MDRATLDRAYDNTRAVADFPAVLADFRRRSAQLYARVGGRREVRY
FT                   GERPRERFDWLSCGRAGAPRFVFIHGGYWQNCAKEDFAFVADGPLAAGFDVVLAEYTLA
FT                   PEASMTQIVGEIARLLDRLSADRDGLGGAGRPLCLSGHSAGGHLSAVHRGHACVTSTLA
FT                   ISPLVDLEPISLSWLNDKLRLSEHEIADYSPLFHVGKGAPTIVAVGAHELPELVRHADD
FT                   YAHACAAAGEPVRRVHVPGRTHFSVLEELAQPDGALTRLLGAFVGGA"
FT   gene            complement(634288..635097)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0653"
FT                   /note="outer membrane efflux protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            635107..635256
FT                   /locus_tag="BMA10247_0654"
FT   CDS_pept        635107..635256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0654"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04377"
FT                   /protein_id="ABO04377.1"
FT                   /translation="MRTAAMRVSPRIARPLAPPARAVSVLACDGRNRRASSDRPTGRGG
FT                   VDCS"
FT   gene            635665..637278
FT                   /pseudo
FT                   /locus_tag="BMA10247_0655"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF05947; match to
FT                   protein family HMM TIGR03359"
FT   gene            complement(637306..638721)
FT                   /locus_tag="BMA10247_0656"
FT   CDS_pept        complement(637306..638721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0656"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05841"
FT                   /protein_id="ABO05841.1"
FT                   /translation="MKQRAWLSKAAFVAAVFVVVWIATIAYWKATYHPPSATELLTHGI
FT                   ALPALLATGLAWARRAAGRLREASAATAQTAAPSAPQASIAQAADEAAMRTWTLALLDS
FT                   SVRFPTGATTADIDGAARDETVVGLHPALRRADGTGVFASGVASVSIDHFDERLLPPSA
FT                   DAALNDEHARALLLAADVLDELLERHAVLATDGASRPAEPLRLHLLLPERWQPMAGALA
FT                   AWLDTHVARERWMPGVERVQTRMVANPVQAWAVVDELIVSLHREPSNASHVVLACDSSL
FT                   SDATVHALDHAGKLYGHNRPNGRIPGEGACALLLAHPAAADAADAPRVHRLVAARAPTP
FT                   DGAPAKAPADTLAPLLEAARTQTAAAEIAPAGCGLVSDADQRGGSRTEIAAVAERNWPD
FT                   DARERCRHLGVANGESGAALALGAIAVAGWRASEEQMPMLAASIADPVARGVMLVAPAP
FT                   IAPVTASELAAAA"
FT   gene            complement(638745..639011)
FT                   /locus_tag="BMA10247_0657"
FT   CDS_pept        complement(638745..639011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0657"
FT                   /product="PAAR motif family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04945"
FT                   /protein_id="ABO04945.1"
FT                   /translation="MARPFIVLGDKHSHGGTVTTAAAASAIHGKGIARRNDRVSCPIHG
FT                   PNHIVEGDDTMIIDNEGVARDGYRTACGAVLIASQSSTGGDAA"
FT   gene            complement(639271..639414)
FT                   /locus_tag="BMA10247_0658"
FT   CDS_pept        complement(639271..639414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0658"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05310"
FT                   /protein_id="ABO05310.1"
FT                   /translation="MQRSQTPIARDSIRQAKSPGHTPASRLPDDKSPFIAHYFKLRRDA
FT                   RL"
FT   gene            639532..642339
FT                   /locus_tag="BMA10247_0659"
FT   CDS_pept        639532..642339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0659"
FT                   /product="Rhs element Vgr protein"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM TIGR01646; match to protein
FT                   family HMM TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06692"
FT                   /protein_id="ABO06692.1"
FT                   /translation="MSVITQFTSLFSAANCLYCLDGPGEIASLQIERWVGRETLSENFQ
FT                   WDVYALATDPGLDLDAMLGQRVTIRTALANGTSAVRSGLVAQAECIGYDAGLARYCLQL
FT                   VPWLAALAHGRDERTFVRQGVADVLGAVFAPYGAIARWRFTADANQRIAELGARDYRVQ
FT                   YRTHTHFDFVRHVLAEAGLGFCFVEEADAPAGHTMLIFDDSTQLPEDETSARMGGVPQR
FT                   LSGTATEPDDVIVGIGQSLSLTADRVTLISSDYRGNQSTSATASLGNPAGSRELYDDVG
FT                   PEAFDSLREADAAARRHADAIVSAARFWTGYGTLRTARAGRALRIAGATWRMSRGGAPA
FT                   PDAFVLTRVDQIGINNLPATVMERVERSLGPLPPANLDARVLAQAKAGGYANRFDAAPR
FT                   DQAWRPTLEDGTGQRLNPVPTALGAQTAIVVGPQGETRPGSTGPVHTDAQGRLRLRYHW
FT                   QADGDAGTYPTRAMQRLASEGHGLQQTPRIGHEVLVQFVNGLVHRPIVLGGLFNGRGEG
FT                   GEAPTPGGEAGQPLDESVYAQASDHAASAQGNLAGGHSPAWHGAGGGAKRHDHAGALSG
FT                   FKSQEFDGQGYNQLVADDTDRMGRMQMATTHAATQLNIGHLRHQADNYLGSFRGQGVEL
FT                   RSDAYGALRGARGVLISSYAPTGPSQPAGDASALQSLLAQQAALAKLLDKSADTHKTLP
FT                   FAAQRGAQRAGQSSMNGDAAPLDALGKSFATTVGADGYAQASADASRRATGNALPHTGD
FT                   AVLGVEAKGGQGLLAGQSLQWAAGETLTIGSGNDTNLAVNRTLRVHSGQGIGWLAGANG
FT                   ANGAQGVGMSVIAGKDDLALQAQHDLMALRARDDLRVASIGADVEIAAKQTVRLAVSGG
FT                   AHLTIEGGNVTFGCPGSLVVHAAQHTFVGPDQLAPALPQFPEKVCVECLKHAMQSGSAL
FT                   AGKAI"
FT   gene            642342..643175
FT                   /locus_tag="BMA10247_0660"
FT   CDS_pept        642342..643175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07249"
FT                   /protein_id="ABO07249.1"
FT                   /translation="MATERFDWIDSYPARTLPRLRQVLDAPLTHGRWYALVDMGFSPTL
FT                   REVLAALNPDGAVIALYEGVYDGDGLLEISPCVTPLPDDAAHRAEVCAGLLRETDGRPM
FT                   LSVLRAAHGLDALVAHLRGQMEARAADDEAFLVRLADTRCVPTWAGVLTPAQRARFFAG
FT                   IDAWWLFDRAASLVELDVAPAGSETATGADDGEPYRLDGEQIAALRHASKIDTLLFHVR
FT                   QRPESFGRLTATPSQAYACVSEAWAKEDVPPSAGARQALDALEAAGWLVPAEVSA"
FT   gene            complement(643409..644242)
FT                   /locus_tag="BMA10247_0661"
FT   CDS_pept        complement(643409..644242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0661"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04161"
FT                   /protein_id="ABO04161.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(644266..644529)
FT                   /locus_tag="BMA10247_0662"
FT   CDS_pept        complement(644266..644529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0662"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06601"
FT                   /protein_id="ABO06601.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            644651..645016
FT                   /locus_tag="BMA10247_0663"
FT   CDS_pept        644651..645016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0663"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06143"
FT                   /protein_id="ABO06143.1"
FT                   /translation="MELSVAPTLKNCLISAVGFTNATTPTKRILLSPFIGLFTLVRWLV
FT                   FKTCKEPQFPPEIEAECRVEPNDPNVWPIPASIGEFAATVPGFIERAREKAQRGQAQDN
FT                   ADRQPHPMRKRRRRRAQ"
FT   gene            complement(645075..645251)
FT                   /locus_tag="BMA10247_0664"
FT   CDS_pept        complement(645075..645251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0664"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06915"
FT                   /protein_id="ABO06915.1"
FT                   /translation="MAVILRIRGDRPSWPSTHVGQSDRGFAKVTFPWKVAGWPLAGRRK
FT                   RAWNRRTGMHSRM"
FT   gene            645276..646589
FT                   /locus_tag="BMA10247_0665"
FT   CDS_pept        645276..646589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0665"
FT                   /product="manganese/iron transporter, NRAMP family"
FT                   /note="identified by match to protein family HMM PF01566;
FT                   match to protein family HMM TIGR01197"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04014"
FT                   /protein_id="ABO04014.1"
FT                   /translation="MPLPTVPTAPFCPAEVKGSIAIDAGVSRLTKLRRFAGPGLLVAIG
FT                   YMDPGNWATDIQAGSQFGYALLWVVVFSSVAAIFLQTLAARLGLVAGRDLAQASYDRYG
FT                   PFGRIVQWITAEVSIIACDIAEVLGCALAFKLLLGVPLAWGIVLTALDTMIVLGLQGKG
FT                   FRQVEAIVFGLIGTMAFCFVAQVAMVPPDWRAVLHGLAPSVPGHDRKDAIVLALGIVGA
FT                   TIMPHNLYLHSSVVQTRRVVGGAGDAIKETLAMVRIDTWISLVVAMLVNAAILVLAGAA
FT                   FHATGQTGVADIEQAYRLITPIVGGAAAWLFGIALLASGQSSTLTGTIAGQVIMDGFLH
FT                   MKMPCYQRRLITRGLALAPALTGVLWLGDGALGQLLVWSQVLLSLQLPFAMWPLIRSVG
FT                   DRSIMREYAIGRGTKVVAWTLFVLVSITNLVLVTGFVG"
FT   gene            646653..646814
FT                   /locus_tag="BMA10247_0666"
FT   CDS_pept        646653..646814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0666"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04948"
FT                   /protein_id="ABO04948.1"
FT                   /translation="MRPSARTLALDRPFAYVRAALSSRFFHGRRALSLVAGVFAWRRER
FT                   GFESPLCA"
FT   gene            647484..647753
FT                   /locus_tag="BMA10247_0667"
FT   CDS_pept        647484..647753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0667"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04700"
FT                   /protein_id="ABO04700.1"
FT                   /translation="MASALLAALSACSSASDISATEKPNVYTVDSSSRGILLSWAGAHE
FT                   RAVNEATSYCAQRGMQASVKSESVERGSGTQGRAQLAFECHPAF"
FT   gene            complement(648006..648287)
FT                   /locus_tag="BMA10247_0668"
FT   CDS_pept        complement(648006..648287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0668"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05238"
FT                   /protein_id="ABO05238.1"
FT                   /translation="METYLDLLAEREALMIKLDAARMQARSAALSEVKRIVEEFELTTQ
FT                   EVFGRAGVLRRRGKLKPKYRDPKTGATWNGRGRPPSWIAGKDRAAFVA"
FT   gene            complement(648755..649747)
FT                   /locus_tag="BMA10247_0669"
FT   CDS_pept        complement(648755..649747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0669"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06056"
FT                   /protein_id="ABO06056.1"
FT                   /translation="MDQASNDPAVETTGRPFATRTHEARKAHEAREAREAHDKRAPLVD
FT                   AWYGSGAEPIEAVDSHAHVFLRSLPRIPSARHSPEYDATLESYVAHLSACGITHAVLVQ
FT                   PSFLGTDNHFFVDALARYPQRFRGIAVVNPCTAEDEFARLEATDVVGIRLNLVGLPIPD
FT                   FTAPRWRALLARANALGWHVEVHRRAADLPAIIPALLDQSCRVVVDHFGRPAPHLGTLD
FT                   PGFRFLLSIAGTGQVWVKLSAAYRNIGSGDGTAFGTRAARALLGAFAPNRLVWGSDWPH
FT                   TQHRDRTDYQTTRSALDDWVPDPSLRRIILCDSARALFRFDRQTPARDT"
FT   gene            complement(649792..650988)
FT                   /locus_tag="BMA10247_0670"
FT   CDS_pept        complement(649792..650988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0670"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06851"
FT                   /protein_id="ABO06851.1"
FT                   /translation="MFSLVIPALLTAWGIGKGQAGLIGGATLAAGAIGGLLAGMIADRF
FT                   GRVRALQITVCWFSLFTFLSAFAQNFEQLLVLKTLQGLGFGGEWTAGAVLLSETIRARH
FT                   RGKAMGIVQSAWGFGWGGAVLLYTLVFSWLPPEWAWRVLFAIGVLPALLVLYIRRAIPE
FT                   PPRDDARVAVSTSAAAAQTAPARASAKSIFDPSVLRMTIVGGLIGVGAHGGYHAITTWL
FT                   PTYLKTERHLSVLGTGAYLAVIIVAFIIGCMTSAYLQDRIGRRRNLMLFSACCVVTVNL
FT                   YVMLPLDNVAMLLLGFPLGFFAAGIPATLGALFNELYPRNVRGRGVGFCYNFGRVASAI
FT                   FPVLVGHMGTSMPLGVALGIDAGIAYGLVFVAVWFLPETRARDIQPSQPEARIREAAL"
FT   gene            651364..651492
FT                   /locus_tag="BMA10247_0672"
FT   CDS_pept        651364..651492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0672"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04285"
FT                   /protein_id="ABO04285.1"
FT                   /translation="MKILDPHSSIWGERGMKACIRQSARRFGGAAASVEKQSHCAE"
FT   gene            651495..652388
FT                   /locus_tag="BMA10247_0673"
FT   CDS_pept        651495..652388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0673"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06476"
FT                   /protein_id="ABO06476.1"
FT                   /translation="MESKHLRYFLAIADTGSLTHAAIRLGVAQPALSHALTKMERELGV
FT                   KLFDRSRRGATLTTAGEAIVDDIRLSLARMDAAARRASEIGAQRAGRLSIGFVSAALFD
FT                   TLPSAVCALRAASPRVDLVMREMSNAEQVVALERGEIDIGILHTPVAIGGPVHEKLIRR
FT                   DPLIAVIPKSFPRQPDGSITLRELSRAGLIWFPHEQLPSIRAAILSAFRLAGHPIEVVQ
FT                   DANRTLTVIACVAAGCGVSLLPSSIRTLTFEGVDFSPVSDGHALPEFPLTAIWPKRSRR
FT                   TLADRFAELLPRFQPN"
FT   gene            652453..652572
FT                   /locus_tag="BMA10247_0674"
FT   CDS_pept        652453..652572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0674"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06505"
FT                   /protein_id="ABO06505.1"
FT                   /translation="MRRCRHAARPDAERAALRSAARRMIIRYSKQYAQACKKR"
FT   gene            652594..652947
FT                   /locus_tag="BMA10247_0676"
FT   CDS_pept        652594..652947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0676"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03979"
FT                   /protein_id="ABO03979.1"
FT                   /translation="MNQSGVSRAARAEIAGLRSTAIAGPSHGRNGGISLFLSVIAVPIL
FT                   PFGLARRCVRAARMADLVTPFAHGARVRARFPKTFKHCQIFRNSDYSDSNNYVGHSSSI
FT                   QLYFRCNRGAILK"
FT   gene            complement(652901..653065)
FT                   /locus_tag="BMA10247_0675"
FT   CDS_pept        complement(652901..653065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0675"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07309"
FT                   /protein_id="ABO07309.1"
FT                   /translation="MGERQRIARRHRGRQSRNSDSVDPVFNWLKSTRLVYSIATISESR
FT                   PDYIENIIE"
FT   gene            653247..653750
FT                   /locus_tag="BMA10247_0677"
FT   CDS_pept        653247..653750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0677"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05229"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05764"
FT                   /protein_id="ABO05764.1"
FT                   /translation="MLFFAAASAGQLTGTMQVNLQVSRGCEVAGVAASGDLGRLDFGAQ
FT                   GPLWSDYLTADGRATSSGAVRVVCSPDVNGFLVSIDGGRNGDQSTRYLVKRGANGRVAG
FT                   RIPYNVYRDAARSVPYVPLMPQSFLVDGGRDDVTLPVYGVVNGMTRAVPSGTYEDFLGI
FT                   TLDW"
FT   gene            653803..654363
FT                   /locus_tag="BMA10247_0678"
FT   CDS_pept        653803..654363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0678"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05229"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06969"
FT                   /protein_id="ABO06969.1"
FT                   /translation="MKAHWKVWAALACVSACAGVQAQTSPLTGTVNSQLVLTTGCAVDT
FT                   GGGSVNSANFGTLDFGTQPSGFTGRLTSAAKGGGSTSTQVTCSPDVTSIQVTIDGGQNA
FT                   SKGAAVGTGTRALANGASFVPYEVYADAGHSQQYVSGTAQSVAVPTPGAAFELPLYGVV
FT                   NKTNASALAAGTYTDVLNVTLGW"
FT   gene            654458..654964
FT                   /locus_tag="BMA10247_0679"
FT   CDS_pept        654458..654964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0679"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05229"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04190"
FT                   /protein_id="ABO04190.1"
FT                   /translation="MLFLLGVAAWPAAGRADTLLPRTQAFTVSAQIVAGCGVAGGGPAS
FT                   GLNFGTLDFGAHPAVATGQVSAAVGGGALQIECSPGSTLKMTIDGGANASAGNTQRNLA
FT                   SGGARVAYRLYSDPARTQAIAVGQAVSLPVSGTITLPIYGALTLPGGGAPAGTYTDTAQ
FT                   VTLSY"
FT   gene            654982..655821
FT                   /locus_tag="BMA10247_0680"
FT   CDS_pept        654982..655821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0680"
FT                   /product="putative fimbrial assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05345"
FT                   /protein_id="ABO05345.1"
FT                   /translation="MKVSRSPGAPARAARALRCALLGAAAAAPFVAQHAHAAASVMIWP
FT                   IDPVIESGDRAAALWLENRDRRPVTLQVRVLGWREANGEDVYDEDQPRVAGSPPMATVE
FT                   PGKRQLIRLTRLADTAPGTEQAYRVLIDEIPQPDDDAQPAASGTSLGVKFQMHYSVPLF
FT                   VYGDGLWTKEHPDRRRDSATAGRPALRWRVEHDGGKRWLVVSNRGPVHARITHAAFEAS
FT                   GARADFARGLLGYVLPGARMRWALPETLKLHSNSKLIATVNGVADLAIDVDGAASNR"
FT   gene            656614..658278
FT                   /pseudo
FT                   /locus_tag="BMA10247_0681"
FT                   /note="fimbrial usher protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00577"
FT   gene            658294..659259
FT                   /locus_tag="BMA10247_0683"
FT   CDS_pept        658294..659259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0683"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05229"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04007"
FT                   /protein_id="ABO04007.1"
FT                   /translation="MTPFRLFFVRIAATLALGLFSALHAHATCSVVSAAAASFGTVTSF
FT                   AVARQPQSTSTTSSGLSCSGALLGLFVIGDQINASITSANGGKLVGPTGDAVPYTVFAD
FT                   QNYSIKLDLGVTYNWASGQLLNLLGIFGGPAQTLPMYFRTVQGSNVAAGTYTDTLTIAW
FT                   NWDYCSGIGVLGICLGRDRGSGTAVVPVTITVTNDCMIAAPDVNFGAAPTVASFAPVTG
FT                   SVSLTCTKGMVYTVGLSSGANPHASGRRQMANGANRLQYDIFGPGAAAVWGQSANRAGS
FT                   GAAADGRSAQQFPYTARLYPDQPTPAVGTYTDSVVVDVRY"
FT   gene            complement(659256..659822)
FT                   /locus_tag="BMA10247_0682"
FT   CDS_pept        complement(659256..659822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0682"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06929"
FT                   /protein_id="ABO06929.1"
FT                   /translation="MRPLAGLSRDQHALLHPVGQLRQRQERERRCAETYEYASTEFASA
FT                   KAVAFHTFIPYGTSPEYASLPFPEKTRTSFFCGVPLMGTVVYPIVRALSPIPRFDGAQS
FT                   RAAASALEPPRVRAGRPASESRRSTHAHRDILAPDLAISGFAPRQIYASSENEKTDSAF
FT                   PFTSVSPVRFGSHARNDCRIAPIFG"
FT   gene            659787..661751
FT                   /locus_tag="BMA10247_0684"
FT   CDS_pept        659787..661751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0684"
FT                   /product="sensor histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06349"
FT                   /protein_id="ABO06349.1"
FT                   /translation="MLIATEPCKWTHVYPVLWGSHVLVALLSYGWAHRDLKRLQAALRA
FT                   SRGSLATASHELRAPVNGMLALVELVRQGLLAPEQQRLLGLVQDSGQSLARVLNDILDH
FT                   ASIEAGQFAIEKTRVDVRELVDSVSAMLAVHAHRKGLRLRLHVDANVPAAVLTDGNRLR
FT                   QILVNLIGNGIKYTERGSVSVRVRAADDVDGMVELVATIVDTGIGIAADELRRLFTPFA
FT                   RATRGARRMESGTGLGLAIARKLARLLGGDVTLTSDEGRGTTATARIRCAVAARGYAND
FT                   ALAGRVVSIDVGDAALAATLAAYARAAGVRVAARGAPDVEAVLCDDARVDASRTQLGWV
FT                   GVTDAPALAGWTDSGTHVRLSSNPLGWRAFIDGLRAALDARDARDAACAHTAARAEPGA
FT                   YRVLVVDDQEMNRIVLRYQLDALGHHARLCASGDEALRALGTAAYDVVLTDCRMPGMDG
FT                   IALTAAIRAHPDARVRATPIVGVTALVSDAEHARCVDAGMTLCIGKPTTLDALERALVE
FT                   AIEPVPALRFDPSRIDAARLFAGFGASSAPGAARDAILRACGRALERDRDTLTRHLRDG
FT                   LSERELRAWCHTARGTYSLFGQAHVDALLDEFHHLLTAGDARAIRGATRDILAMVNHLL
FT                   RCVAHSAQSRDRGDPKGGR"
FT   gene            661752..662384
FT                   /gene="rcsB"
FT                   /locus_tag="BMA10247_0685"
FT   CDS_pept        661752..662384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsB"
FT                   /locus_tag="BMA10247_0685"
FT                   /product="capsular synthesis regulator component B"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196; match to protein
FT                   family HMM PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05494"
FT                   /protein_id="ABO05494.1"
FT                   /translation="MSVQVLIADDHPLVLLGVRHMLAGMGDVSIVGEAHDPAGLLALLA
FT                   ATPCDIVITDFAMPEQPAADGLAMLTAIRDGYPSVRVIVLTMLDNPVLMHTMRQAGALA
FT                   VLSKRGDLDELPRALAAVYQGRPFVGTHAGAAGGGAMRGTDAPRQLSPREIEVVRLCAT
FT                   GMTMTDIANRYGRSIKTVSTHKHNAMGKLGLKSDVDLFMYATENGLV"
FT   gene            complement(662688..662849)
FT                   /locus_tag="BMA10247_0686"
FT   CDS_pept        complement(662688..662849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0686"
FT                   /product="TrpC"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04438"
FT                   /protein_id="ABO04438.1"
FT                   /translation="MQGSLQLTTDLVSLYKALGGGWQPVPAAQTPAPAALDAPTQDTPL
FT                   GATAPARR"
FT   gene            complement(662828..664372)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0687"
FT                   /note="TrpC; this gene contains a frame shift which may be
FT                   the result of a sequencing error; identified by match to
FT                   protein family HMM PF02321; match to protein family HMM
FT                   TIGR01845"
FT   gene            complement(664374..665993)
FT                   /locus_tag="BMA10247_0688"
FT   CDS_pept        complement(664374..665993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0688"
FT                   /product="drug:H+ antiporter-2 (DHA2) family protein"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05100"
FT                   /protein_id="ABO05100.1"
FT                   /translation="MNGSTPTPPAAPRRDRNGNGDGTWRPAANPWLIAVVVTLAAFMEV
FT                   LDTTIVNVALPHIAGTMSASYDEATWTLTSYLVANGIVLPISGFLGRLLGRKRYFVLCI
FT                   VAFTICSFLCGIATDLGQLIVFRVLQGLFGGGLQPNQQSIILDTFPPEQRNRAFSISAV
FT                   AIVVAPVLGPTLGGWITDNFSWRWVFLLNVPIGVLTSLAVIQLVEDPPWKRGRARGLSI
FT                   DYIGITLIAIGLGCLQVMLDRGEDEDWFASTFIRTFAGLTAAGLVGATFWLLYAKKPVV
FT                   DLSCLKDRNFTLGCVTIATFAVVLYGSAVLVPQLAQQRLGYTAMLAGLVLSPGALLITL
FT                   EIPIVSKLMPYVQTRFLVCFGFLLLAASLVYSHTLVPDIDYPNLLKIRSAQSLAIGFLF
FT                   VPITTLAYLTVPRRLNDDASALFTMFRNVAGSIGISLSTALIRERAQARMAHLSTHLSP
FT                   LSQNFDDTLRQNAQTIASLSGMPPPAALQTASGQLYETFVSQATILAYLDVFAMLAIFC
FT                   FVCTPLTLLFSPVKAAGGPGGH"
FT   gene            complement(665990..666169)
FT                   /locus_tag="BMA10247_0689"
FT   CDS_pept        complement(665990..666169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0689"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04006"
FT                   /protein_id="ABO04006.1"
FT                   /translation="MTMTSITATAKTRDHAPTEPGAARDARHRIHPVRRAAAPERARLA
FT                   AVGGAASSLLAPCR"
FT   gene            complement(666166..667353)
FT                   /locus_tag="BMA10247_0690"
FT   CDS_pept        complement(666166..667353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0690"
FT                   /product="putative multidrug resistance protein"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07377"
FT                   /protein_id="ABO07377.1"
FT                   /translation="MPDPNDAAERGNDERSEHDEPGRERARERREEADAHARDARPGDA
FT                   PSGERKRPGKKPLVVLAIIVVLLLVGAFVWWFATRNQVSTDDAYTDGNAITIAPKVSGY
FT                   VVALAIDDNVYVHRGDLLLVIDQRDYQAQVDAARAQLGLAQAQLDAAQVQLDIAHVQFP
FT                   AQYRQAQAQIEAAQASFRQALAAYERQHAVDARATSQQAIDVADAQRLTADANVATARA
FT                   QARTASLVPQQIRQAQTAVEQRRQQVLQAQAQLEAAQLALSYCEVRAPSDGWITRRNVQ
FT                   LGSFLQAGAALFAIVTPQLWVTANFKESQLERMRAGDRVSVSVDAYPNLELHGHVDSIQ
FT                   LGSGSRFSAFPPENATGNFVKIVQRVPVKIAIDGGLPRDPPLGIGLSVVPKVYLK"
FT   gene            complement(667593..667913)
FT                   /locus_tag="BMA10247_0691"
FT   CDS_pept        complement(667593..667913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0691"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06348"
FT                   /protein_id="ABO06348.1"
FT                   /translation="MRRDGAGRAPWRDVLEIRDALPARTPRIGPNGRHVPPRHRRSPAF
FT                   TRARPVAARSTSRGRRRATRKRAARFAPPPPPCSKASYPTVRAIGREPVRRRPAVHNYI
FT                   GL"
FT   gene            complement(667972..669165)
FT                   /locus_tag="BMA10247_0692"
FT   CDS_pept        complement(667972..669165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0692"
FT                   /product="alcohol dehydrogenase, short-chain family"
FT                   /note="identified by match to protein family HMM PF07055"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05362"
FT                   /db_xref="GOA:A3MJ23"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MJ23"
FT                   /protein_id="ABO05362.1"
FT                   /translation="MIIKPRVRGFICVTTHPAGCAASVREQIAYVARRGPIERGPKKVL
FT                   VIGASTGYGLAARIAAAFGVGAATLGVFFERAPADAKPGTAGWYNSAAFHDEAAARGLQ
FT                   ATSVNGDAFSDEIKHKTIDAIRRDLGQVDLVVYSVAAPRRTHPKTGVTHQSTLKPIGHA
FT                   VRLRGIDTDNEAIKETLLQPATPDEIADTVAVMGGEDWRMWIDALDAAGVLADGAKTTA
FT                   FTYLGEQVTHDIYWNGSIGEAKKDLDRTVLALRGKLAARGGDARVSVLKAVVTQASSAI
FT                   PMMPLYLSLLFKVMKARSTHEGCIEQVDGLLRDSLYSAQPHVDAEGRLRADRLELDPAV
FT                   QARVLELWDQVTDDNLYTLTDFAGYKAEFLRLFGFGIDGVDYDAPVEPNVRIPNLIE"
FT   gene            complement(669363..670946)
FT                   /locus_tag="BMA10247_0693"
FT   CDS_pept        complement(669363..670946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0693"
FT                   /product="acid phosphatase"
FT                   /note="identified by similarity to GB:AAF77194.1; match to
FT                   protein family HMM PF04185; match to protein family HMM
FT                   TIGR03397"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04447"
FT                   /protein_id="ABO04447.1"
FT                   /translation="MNKHWIRVSPIALAAAIGLTACGGDDVTSPGLSAVKNVVVIYAEN
FT                   RSFDNLYGNFPGANGLQNVTAASAAQVDRDGTPLATLPKIWGGLTAAGVTPAVTEAMTA
FT                   NLPNAPFAIDDPNGFNTPMSVTTRDLVHRFYENQMQIDGGKNDKYAAWSDAGGLVMGHY
FT                   TADPSKLPLWKLAQQYTLADNFFMGTFGGSFLNHQYLICACAPFYPNADKSPAASQISV
FT                   VNPDGVTLTTASNSPASALSGPPKFVKSGGLTPDFYAVNTMQPPYQPSANAAPTGGDPN
FT                   LADPANPSTLPPQTQQNIGDLLTSAGVSWAWYAGAWGAALQAAQSGTSGVIYGPNMTSP
FT                   NFQPHHQPFNYYANQAPGSANRAQHLLDAGSNGAALIQAIDAGKLPQVTFYKPQGNLNE
FT                   HPGYTDVASGDQHIADVIAHLQKSPQWNNMVVIVTYDENGGFWDHVAPPKGDRWGPGTR
FT                   IPAFVISPFAKQGFVDHTQYDTASILRFITRRFALPKLAGLKQRDDALVANGFKPMGDL
FT                   TNALTLSTGN"
FT   gene            671180..672595
FT                   /locus_tag="BMA10247_0694"
FT   CDS_pept        671180..672595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0694"
FT                   /product="di-heme cytochrome c peroxidase family protein"
FT                   /note="identified by match to protein family HMM PF03150"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06472"
FT                   /protein_id="ABO06472.1"
FT                   /translation="MMRRLPRYARQHRSFFVAPRAFAAAAALAAGVAACDANGPGASAA
FT                   AAVAPAVPAASAASAASAASAARPAPLAQPAAPAVVDSQPQTRAQVYEAVKQMTALGRQ
FT                   LFFDPSLSGSGKLACASCHSPQHAFGPPNALPAQFGGDDLRQQGFRAVPTLKYLQKVPA
FT                   FSEHYHESDDEGDESVDAGPTGGLTWDGRVDSGAEQARVPLTSPFEMNGTPEKVARAVR
FT                   AAPYAPAFRAAFGARVLDDDRATFEAVLQALGTFEQAPDVFYPYTSKYDAYLAGRARLT
FT                   RAELHGLQVFNDEKKGNCASCHVSRRGLDGSPPQFSDFGLIALGVPRNRALAVNRNPNF
FT                   YDLGACGPERRDLKGRDEFCGLFRTPTLRNVALKKTFFHNGVYHSLDDVLRFYAERDTH
FT                   PEKFYPVKRGVVQKFDDLPKRYWKNLNDEPPFERKRGDPPAMTDAEIRDVIAFLGTLTD
FT                   GYDPRAKPAGGAR"
FT   gene            complement(672639..673499)
FT                   /locus_tag="BMA10247_0695"
FT   CDS_pept        complement(672639..673499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0695"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05759"
FT                   /protein_id="ABO05759.1"
FT                   /translation="MINMRFLPRTFTPIRQCAQHSTVLFMLLSIFGAAGAQAEIRRITA
FT                   AQCAAMHAESVISDDSPVQCERLRNVSFDYVNFDGRIQPGEIVVLDALAERVQTIFRTL
FT                   YDMRFPLSKAAPIERYHGDDDASMRDDNTSAFNARRMTGRAEWSMHAYGVAIDVNPVQN
FT                   PYVSFGEDGEARVLPASAAKTSMNRLDERPGKPARPGMAERVVDVFADNGLLRWGGYWD
FT                   DPIDYQHFEVGSPALVARMVDAPPDDARRMFEQYIASYADCLARAPHASHAAARAACVA
FT                   DALRE"
FT   gene            complement(673496..673675)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0696"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            674286..675689
FT                   /pseudo
FT                   /locus_tag="BMA10247_0698"
FT                   /note="glycosyl hydrolase, family 3; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00933; match to
FT                   protein family HMM PF01915"
FT   gene            complement(675659..675856)
FT                   /locus_tag="BMA10247_0697"
FT   CDS_pept        complement(675659..675856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0697"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04244"
FT                   /protein_id="ABO04244.1"
FT                   /translation="MRADIAGISPPASGDETGTRGRVTRGDRPRRRSPPARAACRSTPR
FT                   RQRRGVAGVRPQYCNPNPRA"
FT   gene            675977..676363
FT                   /locus_tag="BMA10247_0699"
FT   CDS_pept        675977..676363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0699"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06100"
FT                   /protein_id="ABO06100.1"
FT                   /translation="MTTRARVSILPRVLVGAACAAAALGAHAQNNLNFLNDTPISYFSK
FT                   ADTASLAKAVQKVRDEGKDGETVDWVNDGRGTKLAAKLTPSTTEQEGRTCREIKTEIEA
FT                   KGQSMTLRPLYCKTAAGKWQLQKR"
FT   gene            676382..676864
FT                   /locus_tag="BMA10247_0700"
FT   CDS_pept        676382..676864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0700"
FT                   /product="NUDIX domain protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07168"
FT                   /protein_id="ABO07168.1"
FT                   /translation="MSAMKPPGRTRARTVSCGVVLLDSGGCVLLAHATDTTHWDIPKGQ
FT                   GEPGETAQQAALRELAEETGIVLDPARLVDLGLFAYRRDKDLHLFAARAAAGETDLSRC
FT                   TCTSMFPSRRDGTMIPEMDAFRWTAPADVDAYASRSLARLFGTTLSLAALHRTLAG"
FT   gene            complement(677196..678905)
FT                   /gene="glnS"
FT                   /locus_tag="BMA10247_0701"
FT   CDS_pept        complement(677196..678905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="BMA10247_0701"
FT                   /product="glutamine--tRNA ligase"
FT                   /EC_number="6.1.1.18"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM PF03950; match to protein
FT                   family HMM TIGR00440"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04646"
FT                   /protein_id="ABO04646.1"
FT                   /translation="MSTERNDATAPSNFIRNIIDDDNRTGKWSGRVETRFPPEPNGYLH
FT                   IGHAKSICLNFSVARDYGGVCHLRFDDTNPEKESVEYVNSIVDAVRWLGFDWQKAGVDH
FT                   QYFASDYYDKLYEFAELLIQRGCAYVDSQSADEMRTNRGSLTEPGTPSPFRDRSPDENL
FT                   ALFRRMKAGEFAEGEHVLRAKIDMSSPNMNMRDPVIYRIRYAHHYRTGDKWCVYPMYDY
FT                   THCISDALEGITHSLCTLEFEDHRPLYDWVLNQLADAGVFARPLPQQIEFSRLNLTYAI
FT                   TSKRKLLQLVTEGHVDDWDDPRMPTIVGVRRRGFTPESIQLFCERIGVTKVDSWIDMSV
FT                   FEGALRDDLDDKAPRTVAVLDPLKLVIDNYPQGQSEECTAPVHPHHPERGQRTFPISRE
FT                   LWIEREDFSEHPPKGYFRLFPGNKVRLRYGYVIECTGADKDEHGNVTAVHCNYYPDSKS
FT                   GTEGANNYKVKGNIHWVSAAHACPAEVRIYDRLFKEPHPDAGGRNFLEALNPDSKKIVQ
FT                   AYLEPGARDALPEARYQFERHGYFVADRVDSKPGQPVFNRIVGLRDSWGKPA"
FT   gene            679153..679392
FT                   /locus_tag="BMA10247_0702"
FT   CDS_pept        679153..679392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0702"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05642"
FT                   /protein_id="ABO05642.1"
FT                   /translation="MRGNALEDSIMMKKTHFLVRATVIAVVLASLGACAMNRTQRNAGI
FT                   GAAAGGALGYLITGGPIGTVAGAAAGGLVGAGVR"
FT   gene            679473..679586
FT                   /locus_tag="BMA10247_0703"
FT   CDS_pept        679473..679586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04865"
FT                   /protein_id="ABO04865.1"
FT                   /translation="MSERRAGRSRAGDVSVTFFDASTYAGSRADSARRSAR"
FT   gene            complement(679716..680936)
FT                   /locus_tag="BMA10247_0704"
FT   CDS_pept        complement(679716..680936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0704"
FT                   /product="CAIB/BAIF family protein"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06527"
FT                   /protein_id="ABO06527.1"
FT                   /translation="MGALSHIRVLDLSRVLAGPWCAQTLADLGADVIKVERPECGDDTR
FT                   HWGPPYLKTPDGADTREAAYYLAANRNKRSVTVDIATPEGQRIIRELAAQCDVVLENYK
FT                   VGQLAKYGLDYASLAAVKPGLVYCSVTGFGQTGPYAHRAGYDFIIQGMGGFMSITGERD
FT                   GLPGGGPQKAGVAIADLATGLYSTIAILAALAHRDRTGEGQHIDMALLDVQVALLANMN
FT                   TNFLASGKPPVRWGNAHPNIVPYQTFETSDGWIIVAVGNDGQFRKFVEAGGRPELADDE
FT                   RFATNPARVRHRDTLVPIVAAMTKTRTKREWLDALEALGVPCGPINDLAEVFDDEQVRA
FT                   RGMQVDLPHPSGASAKLVRNPIRMSATPPDARSAPPLLGEHTDAVLRDLLGYGDAAIAA
FT                   LRDKRVV"
FT   gene            681595..684219
FT                   /gene="alaS"
FT                   /locus_tag="BMA10247_0705"
FT   CDS_pept        681595..684219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="BMA10247_0705"
FT                   /product="alanine--tRNA ligase"
FT                   /EC_number="6.1.1.7"
FT                   /note="identified by match to protein family HMM PF01411;
FT                   match to protein family HMM PF02272; match to protein
FT                   family HMM PF07973; match to protein family HMM TIGR00344"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05351"
FT                   /db_xref="GOA:A3MJ36"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MJ36"
FT                   /protein_id="ABO05351.1"
FT                   /translation="MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQF
FT                   KDVFLGAETRPYSRATTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRD
FT                   AIHYAWELLTSVYKLPADKLWVTVYHDDDEAYDIWAKEVGVPAERIIRIGDNKGARYAS
FT                   DNFWQMGDTGPCGPCSEIFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGN
FT                   MTRLPKPCVDTGMGLERIAAVLQHVHSNYEIDLFQQLIKASARETGVADLANNSLKVIA
FT                   DHIRACSFLIVDGVIPGNEGRGYVLRRIVRRAIRHGYKLGRKAPFFHKLVADLVAEMGA
FT                   AYPELKEAEPRVTDVLRQEEERFFETIEHGMSILEAALAELDAAGGKTLDGELAFKLHD
FT                   TYGFPLDLTADVCRERGVTVDEPAFDDAMARQREQARAAGKFKATQGLEYTGAKTTFHG
FT                   YEEIAFDDAKVVALYVEGASVGEVKAGESAVVVLDHTPFYAESGGQVGDQGVLANAATR
FT                   FAVGDTLKVQADVIGHHGELEQGTLKVGDVVRAEIDAARRARTARNHSATHLMHKALRD
FT                   VLGSHVQQKGSLVDADKTRFDFAHNAPLTDDEIRRVEAIVNEQVLANAPGIVRVMPYDD
FT                   AVKGGAMALFGEKYGDEVRVLDLGFSRELCGGTHVHRTGDIGLFKIVAEGGVAAGIRRV
FT                   EAITGDNAVRYVQALDARVNAAAAALKAQPSELLQRIGQVQDQVKSLEKELGALKSKLA
FT                   SSQGDELAQQAVEVGGVHVLAATLDGADAKTLRETVDKLKDKLKSAAIVLAAVDGGKVS
FT                   LIAGVTADASKKVKAGELVNFVAQQVGGKGGGRPDMAQAGGTEPAKLPAALAGVKGWVE
FT                   ARL"
FT   gene            complement(684723..685748)
FT                   /locus_tag="BMA10247_0706"
FT   CDS_pept        complement(684723..685748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0706"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06521"
FT                   /protein_id="ABO06521.1"
FT                   /translation="MTDHSRKMNNSDSIHPTERIMDLAALAIFRAVVRENGVTRAAAKL
FT                   NRVQSNVTTRIKQLEEQLGAPLFVRDGRRLVLTPAGETLLPYAERLLALADEARHAVTE
FT                   NRPHGRLRLGAMESTAASRLPALLARYHQAWPDVTLELVTGTTGKLIGLVRDFELDAAL
FT                   VATPAGSEALGEPFETASAFTEELVLLTPRGHPRVRTPRDVRLPTLVAFERGCAYRGCV
FT                   ERWYAAEGLKPERVLELGSYHAIVACVAAGAGVAVAPRSVLAVQREPDSLGVHPIDGMP
FT                   PIDTMLVWRQGHFSAALAALRDALRDAAAAANATDVAAHEAAKVAPRRTRRGAARETLP
FT                   A"
FT   gene            685835..686551
FT                   /locus_tag="BMA10247_0707"
FT   CDS_pept        685835..686551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0707"
FT                   /product="conserved hypothetical protein, truncation"
FT                   /note="identified by match to protein family HMM PF06779"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05330"
FT                   /protein_id="ABO05330.1"
FT                   /translation="MSSLPSFLAAASGSRGPSHDQRAACRAALAGAVALAVALGVGRFA
FT                   FTPLLPLMLAGGELDIRHGGWLASANYAGYFVGAMTCARIAVDPARMVRAGLAATVLLT
FT                   FAMGLASPFWVWALVRFVGGAVSAWTFVFASQWGLRRVVEHGAPAWGGVIYTGPGIGIV
FT                   ATGLIGFALAGRHAALGWIGFAAASAVLTAFVWRAFGAAGAGTDGGQSRGGAKRAGDGV
FT                   GVADVTCPLQTGPAGV"
FT   gene            686582..686845
FT                   /locus_tag="BMA10247_0708"
FT   CDS_pept        686582..686845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0708"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04989"
FT                   /protein_id="ABO04989.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            686869..687702
FT                   /locus_tag="BMA10247_0709"
FT   CDS_pept        686869..687702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0709"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07328"
FT                   /protein_id="ABO07328.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            687774..688331
FT                   /pseudo
FT                   /locus_tag="BMA10247_0710"
FT                   /note="putative membrane protein, truncation; comparison of
FT                   this gene to its homologs suggests this gene has been
FT                   truncated"
FT   gene            688353..688562
FT                   /locus_tag="BMA10247_0711"
FT   CDS_pept        688353..688562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0711"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05801"
FT                   /protein_id="ABO05801.1"
FT                   /translation="MARRRSGHASASGRCGARSRGASPAPSHIRRIRPTFGTQPEYIRR
FT                   TLVPRRDGRAFRESPDFRSPGAMQ"
FT   gene            688695..690335
FT                   /pseudo
FT                   /locus_tag="BMA10247_0712"
FT                   /note="peptidase S1 and S6, chymotrypsin/Hap; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00089"
FT   gene            complement(690408..691085)
FT                   /locus_tag="BMA10247_0713"
FT   CDS_pept        complement(690408..691085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0713"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04441"
FT                   /protein_id="ABO04441.1"
FT                   /translation="MTDRRSHHDDDLLSLIDELEAESRAIDARMSHLDALVSWHDSLIF
FT                   EAENLAKLQRSLADIREQSGQIPHAPHDVRRFRLGLLWMGAVAAYEGAMHELFVNTLRV
FT                   ESLRAKALDRLRQLIRDGASPHRDIKTADAQSVTRWFTLTTIADPLVAAKRFDTLYGIA
FT                   TITPDPAWCRRVLGIRNAFAHRNGIGVDIREEALHELIDRLDDLASEFHSAFLHEAGKL
FT                   TET"
FT   gene            691299..691928
FT                   /locus_tag="BMA10247_0714"
FT   CDS_pept        691299..691928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0714"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05096"
FT                   /protein_id="ABO05096.1"
FT                   /translation="MRDHDPPNGRPAVAGAFGGSPYSPSTMTTADYRFCPRCARALAER
FT                   ADPVDEGGRLRRACPDATCGYVHWNNPVPVVAAIVEYEGRILLARNAAWPEGMFALITG
FT                   FLEHGETPEAGIAREVREETSLEAESVTLVGVYEFIRKNELIIAYHVRASGTIRLSPEL
FT                   LEYRLIEAPKLRPWRAGTGQAVADWMRARGLEFEFVDFPGAVANPG"
FT   gene            complement(692028..692363)
FT                   /locus_tag="BMA10247_0715"
FT   CDS_pept        complement(692028..692363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0715"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01906"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04306"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MJ45"
FT                   /protein_id="ABO04306.1"
FT                   /translation="MADPQLITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQT
FT                   LFGGNISLYTSLCERARQDAYERMIDEARRMGGNAIVGMRYDATEIASGVTEVLCYGTA
FT                   VQAVRAG"
FT   gene            692407..692550
FT                   /locus_tag="BMA10247_0716"
FT   CDS_pept        692407..692550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0716"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06745"
FT                   /protein_id="ABO06745.1"
FT                   /translation="MEFAAIYAFLCGTPRAAAPGVACSPGRRLLVQRRAARRPRFRRRP
FT                   AV"
FT   gene            692579..693727
FT                   /locus_tag="BMA10247_0717"
FT   CDS_pept        692579..693727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0717"
FT                   /product="alcohol dehydrogenase, iron-containing family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06223"
FT                   /protein_id="ABO06223.1"
FT                   /translation="MAYIYYLTHIHLGDDALAMLGAECARSGIARPLVVTDKGVAAAGL
FT                   VDRALEALGLGALPVFDDTPSNPTEAAVLAAAQRYRDEGCDGLVAVGGGSAIDLAKGVA
FT                   IAATHPAPLTRYATIEGGSERITAAAAPLIAVPTTSGTGSEVARGAILILADGRKLGFH
FT                   SWHLLPKAAICDPSLTLGLPPGLTAATGMDAIAHCIETFLAPAFNPPADGIALDGLERA
FT                   WAHIERATHDGGDRAARLAMMSASMQGAMAFQKGLGCVHSLSHPLGGVKVDGKTSLHHG
FT                   TLNAVVLPAVLRFNESAPSVVAERRYARMRRVMNLPERADLSQALHDMTARLGLPTGLR
FT                   QMGVDEQAFDHVIEGALADHCHKTNPRIASADDYRRMLVESL"
FT   gene            693724..694068
FT                   /pseudo
FT                   /locus_tag="BMA10247_0718"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            693969..694418
FT                   /locus_tag="BMA10247_0719"
FT   CDS_pept        693969..694418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0719"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04493"
FT                   /protein_id="ABO04493.1"
FT                   /translation="MSSTKPVPLPRSAYRHFLPITTRWMDNDVYGHVNNVVYYSYFDTV
FT                   VNEYLIRRGALDVERGATIGLVVETQCNYFAPLVFPQRVEAGLRVARLGSSSVRYEIGL
FT                   FAHGEASAAAQGHFVHVYVDRATRRPVPLPEPLRAALAPLVAPAA"
FT   gene            694423..695358
FT                   /locus_tag="BMA10247_0720"
FT   CDS_pept        694423..695358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0720"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07289"
FT                   /protein_id="ABO07289.1"
FT                   /translation="MQSVVLDLLNGLSYGLLLFMLCAGLTLIFGMLGVLNFAHASFYML
FT                   GAYAGYAIAARTSFWVALVAAPLAVGALGALCERTLLRRVRASGHLDELLLTFGLAYLI
FT                   AEGVKLVWGLAPLAAPVPAALDGAAFTVYGAVFSRYRAFMMLVSIAMLGALWAVLRASR
FT                   TGLVVRAALTRRAAVEALGHDVPRVMTLVFAAGTALAALAGVIGAPLAVIEPAMAQTLG
FT                   SVVFAVIVIGGLGSLAGALVASLVLGCAQTFAAASRASLSDAAQLAGIALPDAWRALTL
FT                   AQFAPLIPYLLLIVVLACRARGLFGERADV"
FT   gene            695387..697627
FT                   /locus_tag="BMA10247_0721"
FT   CDS_pept        695387..697627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0721"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06016"
FT                   /protein_id="ABO06016.1"
FT                   /translation="MPEALAWLAFVALLVVPALAWPRGWMLGYLAQTAAMIVLALSYNL
FT                   LLGTTGLLSFGHAAFAGLGAFVAAHSFNRYGLLLPLVPLAGGAAGAAFGALFGFVATRR
FT                   AGTAFAMITLGIGELVAAAAWSVPEWFGGAGGVSIDRAAGPALAGWEFGKPMHAYALIA
FT                   AWCVVAAVAMRVLVRTRLARLANAVRDNPARVAALGTDPCRVRFAMAIAAAFFAGVAGA
FT                   LTLIDVEVATAESVGMLRSGAVLFATVIGGTTAFFGPVVGAVLLTFFSVFVASVSRAWL
FT                   LYLGLLFVAVVLAAPGGASGRWRAWRDARRHGGARFDARRALPGAGAALAGGVAIVFAA
FT                   ELAYALQFAQNDARRAVIGPWRFDAGAPLGWGIAALAAALGMGLAHAARRWGRGAPRTN
FT                   GPAFADAIDTCGAACGSAELKARDAGDVDGSTNAASAANETNAVSIASTTSMTSMTSAT
FT                   SATSATSARRAARVSDNAPSPVFEVAAEPVGGGVHAASAPPALRMADVSKSFGATPVLV
FT                   GIDLTIRPGERHALIGPNGAGKSTLFNLIAGALAPTRGRIALNGIELGRRRPHAVARLG
FT                   LARSFQQTSVFARMSVYDNLRCAALHAPRARRRWRREPAAAAAIDRAADAALASIGLAA
FT                   HRDALAGSLSYAQQRALDVGLALASGASVFLFDEPTAGMSREQARRTIELIRRATAGKT
FT                   VLMIEHDMDAVFGFADRVSVLVRGELVATGSPAAIRANAAVRAAYFGEAFER"
FT   gene            697624..698328
FT                   /locus_tag="BMA10247_0722"
FT   CDS_pept        697624..698328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0722"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05242"
FT                   /protein_id="ABO05242.1"
FT                   /translation="MSALLELRGVRAGYGALPVLDGVDLRIAAGEAVALVGRNGSGRST
FT                   LAKAIMGMVRVEGTVRIGGVDVAGAPTFAIARHRVGYVDEHRDVFALLSVEDNLRLGLR
FT                   GASGAAARAALADARERYPMLAERWRTKAGVLSGGEQQMLALACALIGAPRVLIVDEPA
FT                   EGLAPLAVEQVRACLAGAKAQGVALLLIEQRMQLAPALTSRVAVMGRGRIVYDGAAKAL
FT                   DAGIVERWLSVG"
FT   gene            complement(698445..699248)
FT                   /gene="iolB"
FT                   /locus_tag="BMA10247_0723"
FT   CDS_pept        complement(698445..699248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolB"
FT                   /locus_tag="BMA10247_0723"
FT                   /product="myo-inositol catabolism protein IolB"
FT                   /note="identified by match to protein family HMM PF06845"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03994"
FT                   /protein_id="ABO03994.1"
FT                   /translation="MSLLVKGAGDGMSIARVTPESAHWKHVGFAAYRLKAGEAIALAEA
FT                   AREMCIVVLTGTVDIEAGDGTCWTALGSRDSVFDGVAPYALYLPPKLSVIVRASRDAEL
FT                   GVASAPAAGRYPARLIKPSQMRRSVRGSGANTRYVCDILPQTEPAEALLVVEVRTPSGH
FT                   SSSYPPHKHDTDNVPVESSLEETYYHRVHPPQGFVFQRVYTDSRDLDESMAAGDHDVVL
FT                   VPRGYHPVVVPYGYESYYLNVMAGPTRVWHFKNDPAHEWMLNGGR"
FT   gene            complement(699248..700168)
FT                   /locus_tag="BMA10247_0724"
FT   CDS_pept        complement(699248..700168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0724"
FT                   /product="AP endonuclease, family 2"
FT                   /note="identified by match to protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05560"
FT                   /protein_id="ABO05560.1"
FT                   /translation="MSAPDIRIGINPLSWMNDDLPSLGGETPLAVALTEGREIGYEGFE
FT                   LGNKFPREPQALKALLAQYDLSLVSGWYSGRLAERGVQEEIDAVGPHLELLAKNGATVM
FT                   VYGEVAGTIQGSPAPLYQRPRFVDDAQWDAYAERVDAFARYTRAQGVRLGYHHHMGAYV
FT                   ESPADVDRLMASTSDAVGLLFDAGHMTFGGGDPVAELAKHIGRVCHVHCKDVRPAVIRL
FT                   ARNRNWSFLDAVIAGAFTVPGDGSIDFPTIVDMLKRHGYRGWLVVEAEQDPAVAPSYAY
FT                   AQKGYRTLRALVDAPLPPVGHKEAA"
FT   gene            complement(700165..702105)
FT                   /gene="iolD"
FT                   /locus_tag="BMA10247_0725"
FT   CDS_pept        complement(700165..702105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolD"
FT                   /locus_tag="BMA10247_0725"
FT                   /product="iolD protein"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05067"
FT                   /protein_id="ABO05067.1"
FT                   /translation="MNDFIDDPAASVQRTVRLTAAQALVRYLAAQRVATGDGDAPLFGG
FT                   VFAIFGHGNVAGLGEALHQYRDALPTYRAHNEQAMAHSAIAYAKAHLRRRMMAVTTSIG
FT                   PGATNLVTAAALAHVNRLPVLLLPGDVFVSRAPDPVLQQIEDFHDGAISANDAFKAVSR
FT                   YFDRIVHPAQLLTALPRALRVLTDAALCGPVTLALPQDVQTMAYDYPAEFFAPRAVTFH
FT                   APAPVEAELDAALAPLRASARPFIVAGGGALYSEGGAAALAAFAERHGIPVGETQAGKS
FT                   ALPWDHPLNAGAIGVTGSPAANALAHDADCVIAVGTRLQDFTTGSNTLFARARVIGINA
FT                   NAFDALKHRATIVQADARLALEALGARLEGWRADAAWTARAHARANAWRDAVAAVTHAP
FT                   PRARALPYDADVIGAVQRSAPDSAARDIAVCAAGTLPAELHKLWRAAAPGGYHVEYGYS
FT                   CMGYEIAGGLGAKLAKPEREVIVMVGDGSYLMMNSEIATSVMLGAKLIVVVLDNRGYGC
FT                   INRLQQACGGAPFNNLFDDCVQGPLGAPRIDFAAHARALGARAEHVADIAALEAAMARA
FT                   RASDRTYVICIDTDPARTTPDGGWWWEVAVPEVSPRDAVRDARADYERHLAARAGAPAS
FT                   RSTPSTPESST"
FT   gene            complement(702161..704161)
FT                   /locus_tag="BMA10247_0726"
FT   CDS_pept        complement(702161..704161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0726"
FT                   /product="iolC protein"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07369"
FT                   /protein_id="ABO07369.1"
FT                   /translation="MTSPTLSFAQNRPLDVICVGRVAVDLYAQQIGARLEDASSFAKYL
FT                   GGSSGNIAFGCARLGLKSAMLSRVGHDHMGRFVRETLAREGCDTSRLRTDTERLTALVL
FT                   LGLKDRDTFPLIFHRENCADMALDEDDFDEAFIASSKALLITGTHFSTEQVMRASRRAL
FT                   DYARRNQVRTVLDIDYRPVLWGLTGKADGETRFIANEGVTAHLQRILPLFDVVIGTEEE
FT                   FRIAGGKDALLDALAMVRAVTSAALVVKRGPLGCSIVDGDVPATLDALPVIRGVEVDVM
FT                   NVLGAGDAFASGFLSQWLRGRPFADAARAANACGALVVSRHGCSPAMPTPAELAYFLAE
FT                   AKRDPARMRRPDLDATLARLHRVTPARTPRDEVLGFAFDHRNQFFELARQTGASVARID
FT                   ALKRLFVEAVAQTEAQLGLAGRIGVLIDDRYGQDALNDATGRGWWVGRPVELPGSLPLE
FT                   FDHGRSIGTTLASWPLEHVAKCLVQYHPDEAAEPRIEQETQLRALYDAVQASGHELLLE
FT                   VIPPRRADLPQAADTVYRALKRLYNLGIHPEWWKLAPLDAAQWQAIDALIAERDPYCRG
FT                   VVLLGLSAGVDELVGGFGAAAASATCRGFTVGRTIFHEPSRAWLAGEIDDAELIARVRR
FT                   TFETLIGAWRAARTDARARGRHAGAAPRVAA"
FT   gene            complement(704175..704975)
FT                   /locus_tag="BMA10247_0727"
FT   CDS_pept        complement(704175..704975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0727"
FT                   /product="ABC transporter, carbohydrate uptake
FT                   transporter-2 (CUT2) family, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05553"
FT                   /protein_id="ABO05553.1"
FT                   /translation="MSTPASHDTILALENVSKYFGKVIALSGVTLRVKRGEVHCLLGDN
FT                   GAGKSTLIKTLAGVHPPSDGQYLVDGKPVLFDSPKDALDLGIATVYQDLALVPLLSVAR
FT                   NFFMGREPQKKLFGLFNVMDLDSSARIARAKLAEMGINVRDAHQPIGTMSGGERQCLAI
FT                   ARAIHFGARVLILDEPTAALGVKQSLNVLKLIHAARAKGISVIFITHNVHHAYPIGDSF
FT                   TLLNRGRSLGTFTKDTISKNEVLDMMAGGAEMQKMIAELDGATI"
FT   gene            complement(704988..706133)
FT                   /locus_tag="BMA10247_0728"
FT   CDS_pept        complement(704988..706133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0728"
FT                   /product="ABC transporter, carbohydrate uptake
FT                   transporter-2 (CUT2) family, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06098"
FT                   /protein_id="ABO06098.1"
FT                   /translation="MGVVGKHMSAHAHEKPQPGAASDERLRGEAWFQRFLNRPEFAAIS
FT                   GAVLVFAVFAFGAGGSGMFNLDGIMNWSQVAAYLGILAVGACLLMVAGEFDLSIGSMIG
FT                   FAGMMVAIPTVYFHWPIWLAVLFAFAGSMALGALNGYLVMRTKLPSFIVTLAFLFILRG
FT                   LTLALSIMFADRTIVSGLGDYAHADPVVHFLFQGVAFHELFRSLAHAGVGRLLDNGEPL
FT                   VPGVPKVLLWWLAVTAVGAFVLAKTRYGNWILAAGGDAHAAKNVGVPVRRVKISLFVLT
FT                   AFCACLFAVLQVADIGSAAADRGLQKEFEAIIAAVIGGTLLTGGYGSVIGAAFGALIFG
FT                   VVQIGITYTNISSDWFRVFLGVMLLVAVLFNHYVRRRVSQS"
FT   gene            complement(706234..707283)
FT                   /locus_tag="BMA10247_0729"
FT   CDS_pept        complement(706234..707283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0729"
FT                   /product="ABC transporter, carbohydrate uptake
FT                   transporter-2 (CUT2) family, periplasmic sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06698"
FT                   /protein_id="ABO06698.1"
FT                   /translation="MRLCTGKAVLRACVAAIAVAAGVGGAAPAAQAAGARFALVSHAPD
FT                   SDSWWNTIKNAIKQADEDFDVTTDYRNPPNGDIADMARLIEQSAARDYDGVITTIADYD
FT                   VLKNSLKKVTAKKIPLVTINSGTEEQSAQLGAIMHVGQPEYVAGHAAGEKAKAAGVKRF
FT                   LCVNHIATNSVSFDRCRGFADAIGADYKSSTIDSGQDPTEIQSKVSAYLRNHPNTQAIL
FT                   TLGPVPAAASLKAVQQMGLANKLFFATFDFSDDIAKAIQSGAIKFAIDQQPYLQGYIPV
FT                   AVLAIAKQNKTTDPAKIRQILEANPKFQARLSTYGLQPSYGPKNIRSGPGFITKENLEK
FT                   VIKYAGQYR"
FT   gene            707528..708409
FT                   /locus_tag="BMA10247_0730"
FT   CDS_pept        707528..708409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0730"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04578"
FT                   /protein_id="ABO04578.1"
FT                   /translation="MDDTTPPETPAVDDLLQRIAGAYDTLPRQLKRIASYIDEHRSSVM
FT                   MDRTSDIAQRCGVHPSAVVRFAQRFGFSGFSDLQAVFKDAYTGQNPTVQSYQQRIRSLI
FT                   DGEAGPMTGGAVARQFIDASRAGLDELAAGLDDDQFDAAVTMLERAENIYVVGVRRSFP
FT                   VASYIVYALQHTAKRVHLVSGLGGMYREQIRSVKKGDVVIAISFAPYGKETQYCLRAAR
FT                   HNHAQTLVVTDSRLSPLARDASAHLLVKEGSAFAFRSLTSTICLCQALFIALAYRLELN
FT                   VEEVKDIGGYDD"
FT   gene            708402..709421
FT                   /locus_tag="BMA10247_0731"
FT   CDS_pept        708402..709421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0731"
FT                   /product="myo-inositol dehydrogenase"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04005"
FT                   /protein_id="ABO04005.1"
FT                   /translation="MTNAAPTIDVAVFGAGRIGRIHAGNLARRPGVRLKYVVDVNRDAA
FT                   AALAAQYGAQAADVDGALGDASIGASVICSSTDTHAELIVGAARAGKHVFCEKPVDLTL
FT                   ERARACEAAVARAGVVCMIGFQRRFDPTFEALKRRIDAGEIGTPEMLVVTSRDPGAPPV
FT                   DYIKHSGGIFKDMLIHDFDIFRWILDDDADTLHATGSCLTDPAIAGAGDIDSAAVTIRT
FT                   KRGRLCQINTSRRAAYGYDQRFEVLGSAGMLQAGNVRPTEVTGYSARAVSTDLPEAFFL
FT                   ERYRAAYAREIAHFFAAVTSGEPVRTTVADGVKALELAEAATLSWREARAVTLGERAA"
FT   gene            709434..710471
FT                   /locus_tag="BMA10247_0732"
FT   CDS_pept        709434..710471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0732"
FT                   /product="oxidoreductase family protein"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894; match to protein
FT                   family HMM PF03447"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04962"
FT                   /protein_id="ABO04962.1"
FT                   /translation="MIVSHSAAAVRIGIAGLGRLGRRHAENLARRVAGARLAAACSPLA
FT                   DECAWARETLAVPRVYEDFDALAADPELDALWLVTPSALHADQIVAALRAGKHVFCEKP
FT                   LSLDLGECERVLAEARARPHLVATIGFMRRFDPSYRDAYARVAAGEIGRPFLVRSQTCD
FT                   RNDPEGFFVRFVPSSGGIFLDCTVHDIDVARWLLGAPRATRVYAAGAVALHEGLRACGD
FT                   VDNGVAICEFEGGRLAMFYASRTMAHGNDTHSEVIGTAGALAIGRNPRANRVEIYDAAG
FT                   IRNTCTPTFFDRFEDAFLIEAQAFVAAVRGEGAAGGATLADALEATRIGHALRESLQTG
FT                   RAIEL"
FT   gene            710478..710672
FT                   /locus_tag="BMA10247_0733"
FT   CDS_pept        710478..710672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0733"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07134"
FT                   /protein_id="ABO07134.1"
FT                   /translation="MRAPHGGQRGRARTPAPPAPAFARARGARASACGRIWRSDSAATA
FT                   RHSKVESRCSFTRKWTRAG"
FT   gene            710636..710866
FT                   /locus_tag="BMA10247_0734"
FT   CDS_pept        710636..710866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0734"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01206"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05797"
FT                   /protein_id="ABO05797.1"
FT                   /translation="MLIHKEVDARGLNCPLPILRAKKALADMESGQILKVLATDPGSQR
FT                   DFAAFAKQTGNEIVESSTTQDKTFVFLMRRR"
FT   gene            711142..711528
FT                   /locus_tag="BMA10247_0735"
FT   CDS_pept        711142..711528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0735"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06163"
FT                   /protein_id="ABO06163.1"
FT                   /translation="MLFRSGTIRIPFEPNDKARERERPIQRVELDPEHDRHARAALEAY
FT                   ADSSAHEMPWLAEWMREALGSPQPELTRCAQTVERVFDLAHAWAAGQPDYAGAAWEHVR
FT                   GRLLEALQHAPRAIAPDALETDPA"
FT   gene            711832..712560
FT                   /locus_tag="BMA10247_0736"
FT   CDS_pept        711832..712560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0736"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05639"
FT                   /protein_id="ABO05639.1"
FT                   /translation="MDFVLRGAMRIAVLDDDQAQTDFVSQTLTAAGHTCYAFKEGKALK
FT                   KRLQRETFDLLVLDWNVPDMSGEEVLKWVRANQVEHRLPIIFMTSRDDEAGITQILNAG
FT                   ADDYVVKPVSGPILRARIGSLLRRAYPVNAESSIREFDNYKFDANLKQAYVGDKPVSLT
FT                   QKEFELALLLFQHLDRPLSRAHILDLVWKQATDIPSRTMDTHISMLRTKLGLRPENGYR
FT                   LAPIYGYGYRLERVMQGDAE"
FT   gene            712575..713921
FT                   /locus_tag="BMA10247_0737"
FT   CDS_pept        712575..713921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0737"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06810"
FT                   /protein_id="ABO06810.1"
FT                   /translation="MTKYVLTACCAAATALAAQHAAAQSAKNRSVATVDYTTRSGDTLY
FT                   DVSARYLQGTDDWPLVAQLNDVPVPKHLQPGVVLKLPAARLRKERLSARVIAAHGTVES
FT                   AGRGSAQFAPVAVDATLTEGDRLRTGSNAFVTLELSDGTHLSLPPDSQIDLATLRRTVL
FT                   TGTLERVIDLRRGSVDSEVTHLKKKDDRFQIRSPSVVAGVRGTRFRVNYDKDGRASTTV
FT                   EVLDGTVGVAPSAKRSADTLVHANFGNVTSASGVVGSPIALLDAPQLANPAKIQDDPQV
FT                   AFDLVPLGGAQSYHVQIARDAGLYDLFKEVQVSAPRATFADVPDGTYFVRIAAIDSHGL
FT                   EGQPRIYAFERRRFGVDASAAPADGGYAFRWSTTQDGAAAGATRFRFVLSRSKDLSNPI
FT                   VDQVDAQGGRIAVSNLTPGDYYWSVIAERYEGGRFHEKASAVNAFTIAR"
FT   gene            713932..716325
FT                   /locus_tag="BMA10247_0738"
FT   CDS_pept        713932..716325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0738"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF05226"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06089"
FT                   /protein_id="ABO06089.1"
FT                   /translation="MRFDRTQRRRLLGRRFLVEWIAIGCLGVAVILAGVAGRMTASVDR
FT                   IIYDRLLTLRKLPIESNIVIVEIDNRSLDTLGRWPWQRSVHAEFLGALAKTHPAAVVYD
FT                   VLFTEPSADDRALAKVLDLVPTFLPVLLSPEEPDGTRTVNPPVPVLAQHVAGAGHINLE
FT                   VDPDGIVRSVALFESDGLHRWPQLMVPVFHALENGQFKLAQPAPIARRAHDIAQDDNGE
FT                   SRYFVPFSRASQNYPAISFVDVLAGRVNADELRGKIVIVGATASGLYDRFATPISGEFG
FT                   PLPGVYIHASVLDTLMTGRAISPVSGWLVFSASLLPLVVLLAGFLMLSPWRSLLLTLSL
FT                   AALAVASSAALLYEARLWLSPAPAIFGLIAAYPIWNWRRLEMTMSYLRYELQRLADEPH
FT                   LLPEAPRERNEFGGDVLERQMALMAQAAQRVQDMKRFVWDSLDSMPEPVVVTDLAGTVL
FT                   IANHAAKRYCARLDAPAPEGRPLRVAFGELSFVKTVDGNAEQDVAIRTHWPAALDPTRD
FT                   YENDVMERGIEVRDRSGLDHLLRYAPCTNAQGNVTGWIAGLVDVTALHAAERQREEALH
FT                   LLSHDMRSPQSSILALVEIERQRAESEHTRGLLARIERYAQRALMLADEFVQLARAESQ
FT                   TYQLEAVSFADLLIDASDEVWPQAQAKRIRIDTSFGDEPCWIGADRSLMTRALVNLLNN
FT                   AVKYSPTDTVITCTLSVEPGAKRMHCTIRDQGYGISLEDQRHLFERFKRFHANERPEVA
FT                   GSGLGMAFVKTVVVRHGGCIGVDSTPGIGTAITVSLPLLDEPAA"
FT   gene            716414..717031
FT                   /locus_tag="BMA10247_0739"
FT   CDS_pept        716414..717031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0739"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05423"
FT                   /protein_id="ABO05423.1"
FT                   /translation="MKVLWTGAALAAALLSGCASVTTGVSASAAPGALAGARTYDFART
FT                   ATQAGNADYRRVETLVRGELAQRGFEEAAGTQARYRVTIAYATQPASVALTMPGCGGAQ
FT                   QPACVAVDGPAPFGLPFAGTVYRHVLTLRFIERSSGGDAYRVSAAVQDRHPDALLAAPV
FT                   LVRSALARVPFADGGGWLVETKKRDADDAMPGVVSVKPARSN"
FT   gene            complement(717092..717973)
FT                   /gene="galU-1"
FT                   /locus_tag="BMA10247_0740"
FT   CDS_pept        complement(717092..717973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU-1"
FT                   /locus_tag="BMA10247_0740"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01099"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06656"
FT                   /protein_id="ABO06656.1"
FT                   /translation="MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEA
FT                   IAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLDLVRSIKPSHVDCFYVR
FT                   QPEALGLGHAVLCAEKLVADNPFAVILADDLLDGDPPVMKQMVDVFDHYHSSVIGVEEI
FT                   PPEDTKSYGIVDGKEWEDSIIKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALK
FT                   PGAGGELQLTDAIQALLADEQVLAYKYRGTRFDCGSKLGYLKATVEFALRHPEVKTEFE
FT                   TYLRSRSETQHG"
FT   gene            complement(718060..720927)
FT                   /gene="valS"
FT                   /locus_tag="BMA10247_0741"
FT   CDS_pept        complement(718060..720927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="BMA10247_0741"
FT                   /product="valine--tRNA ligase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05661"
FT                   /protein_id="ABO05661.1"
FT                   /translation="MSDTTLAKSFEPQTIESQWGPEWEKRGYATPALDPSRPDFSIQLP
FT                   PPNVTGTLHMGHAFNQTIMDGLVRYHRMLGHNTLWVPGTDHAGIATQIVVERQLDAQGV
FT                   SRHDLGREKFVERVWEWKERSGSTITGQVRRIGASPDWSREYFTMNDKMSEAVREVFVR
FT                   LYEQGLIYRGKRLVNWDPVLLTAVSDLEVVSEEENGHLWHIRYPLADGSGHLSVATTRP
FT                   ETMLGDVAVMVHPEDERYRHLVGRHVKLPLCEREIPIIADDYVDREFGTGVVKVTPAHD
FT                   FNDYQVGLRHALAPIEILTLDAKINDNAPAAYRGLDRFDARKAIVDELDAQGLLESVKP
FT                   HKLMVPRGDRTGVVIEPMLTDQWFVAMTKPAPQGTFHPGKSITEVSLEVVRRGEIKFVP
FT                   ENWTTTYYQWLENIQDWCISRQLWWGHQIPAWYGENGEIFVARNEEDARAQAAAKGYTG
FT                   ALKRDDDVLDTWFSSALVPFSSLGWPNETPEMKHFLPSSVLVTGFDIIFFWVARMVMMT
FT                   THFTGKVPFGTVYVHGLVRDAEGQKMSKSKGNTLDPIDIVDGIGLDALVAKRTTGLMNP
FT                   RQAATIEKKTRKEFPDGIPAFGTDALRFTMASMATLGRNVNFDLARCEGYRNFCNKLWN
FT                   ATRFVLMNCEGHDCGFDKPEVCGAGDCGPGGYLDFSPADRWIVSLMQRVEADIAKGFAD
FT                   YRFDNIANAIYKFVWDEYCDWYLELAKVQIQNGTSEQQRATRRTLLRVLETVLRLAHPI
FT                   IPFITEALWQKVAPLAGRYPAGKAEGEASLMVQAYPVAEPKKLDEACEQWAAELKAVVD
FT                   ACRNLRGEMNLSPATKVPLLAAGDAAQLQAFAPYVQALARLSEVRVLPDEAALDADAHG
FT                   APIAIVGGNKLVLKVEIDVAAERERLSKEIARLEGEIVKCNAKLGNEAFVAKAPPAVVA
FT                   QEQKRLAEFQSTLTKLGAQLARLPA"
FT   gene            721067..723430
FT                   /gene="uvrD"
FT                   /locus_tag="BMA10247_0742"
FT   CDS_pept        721067..723430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="BMA10247_0742"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05204"
FT                   /protein_id="ABO05204.1"
FT                   /translation="MPDLLANLNPEQLAAVTLPNEPALILAGAGSGKTRVLITRIAWLI
FT                   RQGYAAPATVLAVTFTNKAAREMMARLAAMMPIDTRGMWIGTFHGLCNRMLRAHYRDAG
FT                   LPQTFQILDTADQLSAIKRLMKAANVDDEKYPPKNVQYFINNAKEQGLRPEKVDATDSF
FT                   NRKFVELYQAYEQQCQREGVVDFPELLLRCYELLAHNPPLRAHYQARFKHILVDEFQDT
FT                   NKLQYAWLKLLAGGHNAIFAVGDDDQSIYAFRGANVGNMRDFEHEFRVRNLIKLEQNYR
FT                   SHGNILDAANHLIANNAHRLGKNLRTDAGHGEPVRVYEAATDAQEAAWIVEEIRSLVNA
FT                   GLARSEVAVLYRSNAQSRSIEHTLMTAGIAYRVYGGLRFFERQEVKHALAYLRLIDNPN
FT                   DDTAFARVVNFPTRGIGARSIEQLADAARLYDCSMAAAIPYVAGKAGSSLASFANLIAK
FT                   MRAETAQMSLPETVEHVVRASGLADFYQGEREGQDRLENLQELVNAATAFVSEEGYGLD
FT                   TPARSIPLHARASAAPELAAGGADPADAVLAPANLADPAQNPDAMTPLAGFLSHASLEA
FT                   GDNQAQAGQDAVQLMTVHAAKGLEFTAVFITGLEEGLFPHENSALESDGLEEERRLMYV
FT                   AITRAKERLYLSFAQSRMLHGQTRYNIRSRFFDELPQHVLKWLTPKVEAGARWGGRSDN
FT                   AGWGRDWFARPGGGARQGVVDAAVSAPLPAFANQQREAQNGLRIGQQVFHTKFGEGTVT
FT                   ALEGSGTDAKAQVKFKRHGEKWLALAVAKLQAVE"
FT   gene            723427..724215
FT                   /gene="mtnN"
FT                   /locus_tag="BMA10247_0743"
FT   CDS_pept        723427..724215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="BMA10247_0743"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="identified by match to protein family HMM PF01048;
FT                   match to protein family HMM TIGR01704"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05165"
FT                   /protein_id="ABO05165.1"
FT                   /translation="MNQQTFFDRPLGILAALPEELGDLVAAMRDDGPVDTVTLGRRDYH
FT                   VGVAHGVRCVVTLARVGKVAAAATASALIHRFDVRAIVFTGVAGGVASDVSVGDVVVAD
FT                   ALLQHDLDASPLFPRFEVPLLGLTRFAADAALAAQLKAACARFVDDEGETLNARFRLHG
FT                   ARVHAGLIVSGDRFVSSEREVSALRDALPDALAVEMEGAALAQVCHEYGVPCAIVRTIS
FT                   DTADDHASTSFTTFLTDIAGAYSSGILKRFLAAHARANAA"
FT   gene            complement(724545..725795)
FT                   /locus_tag="BMA10247_0744"
FT   CDS_pept        complement(724545..725795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0744"
FT                   /product="fosmidomycin resistance protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07329"
FT                   /protein_id="ABO07329.1"
FT                   /translation="METSLDNRPSVARAAASPAPAAVSRTVYPVLGAISFSHLLNDMIQ
FT                   SLILAIYPMLKSEFSLSFAQIGLITLTYQITASLLQPVIGLYTDKRPQPFSLPVGMGFT
FT                   LTGLLLMAFAPTFPFLLVAAALVGCGSSVFHPESSRVARMASGGRHGLAQSLFQVGGNA
FT                   GSSLGPLLAALIVIPHGQRSIAWFSAAALVAIFVLVQIGRWYRRHPAAKKKAAHAAHPT
FT                   LSRQQVGLALGVLVMLVFSKYFYLASINSYFTFYLIDKFHLSVQAAQIHLFVFLAAVAA
FT                   GTIIGGPVGDRIGRKYVIWTSILGVAPFTLMLPYANLFWTTVLTIVIGVVLASAFAAII
FT                   VYGQELIPGKVGTVAGLFFGLSFGLGGVGAAVLGQLADATSIAFVYKVCSFLPLIGVLT
FT                   VFLPNVEGRTTLDKQRA"
FT   gene            726147..727823
FT                   /locus_tag="BMA10247_0745"
FT   CDS_pept        726147..727823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0745"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06339"
FT                   /protein_id="ABO06339.1"
FT                   /translation="MKGVSLHGKHFLPDDATGNRGRTPKPGKPRRARRAWSVKTTLRAA
FT                   FALLLVGTLAVGLFSLAQISRLNSSIRSVYEQGHVASRAAEEVRASVLRASRAQKMLIT
FT                   ATTAKERDELGADIDKGLAAIGAELATLQRHADGAADDAARLKAFGAAVLAWSAHLRDF
FT                   VKLVREQPLDLSQMSWQVGSQDVSLLVETGKLEKLVDGLVDARGDASKATLDASGAIFR
FT                   ESFAMLAAMTAALVVLAFVIAAWVVRRLGAQLGGEPAYAKEIAVSISRGDLSNVIRLDT
FT                   RDHDSMLHALRDMQEGLAGTVREISASAEAIASAAGEIAMGNLDLSQRTEQQAVALERT
FT                   ATSMGQLTSTVHQNAENARQASTLAANASSVAEAGGTVVGRVVSTMNEIDESAKSIRDI
FT                   IGVIESIAFQTNILALNAAVEAARAGEEGRGFSVVASEVRSLAQRSASAAKEIKALIGA
FT                   SVERVANGAVLAQDAGRTMDEVVRAVKRVTDIMGEISAASSEQSAGIDAIERAVTQMDA
FT                   GTQQNAALVEEAAAAARSLDEQAQMLKEMVGRFHLPAHAAG"
FT   gene            complement(728171..729052)
FT                   /locus_tag="BMA10247_0746"
FT   CDS_pept        complement(728171..729052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0746"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05397"
FT                   /protein_id="ABO05397.1"
FT                   /translation="MFLRKLFGFVATAVILIVAILIGRTLWVHYMDEPWTRDGRVRAEI
FT                   VNVAPDVSGAVVELPVRDNQFVKQGDLVMQIDPSHFRIAVEQAQAAVAARRAELQMRRA
FT                   DAARRADLDALVVSKESRENSAQTASSAEAQYQQALAALDAAKLNLERTRVVAPVDGYV
FT                   TNLQVFRGDYASAGQAKLAIVDSHSFWVYGYFEETKLPRVKIGAKAEMRLMSGGVLKGH
FT                   VESISRGIYDRDNPQSRDLVADVNPTFNWVRLAQRVPVRIHIDEVPKDLVLSAGTTCTV
FT                   IVEPDGGGKRKS"
FT   gene            complement(729066..729269)
FT                   /locus_tag="BMA10247_0747"
FT   CDS_pept        complement(729066..729269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0747"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07869"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05411"
FT                   /protein_id="ABO05411.1"
FT                   /translation="MMPRDLAILDAYVPTVVLMFVIGAFATWLIDRLLAYTGLYRVVWH
FT                   PSLFRASLLVCICGGLSLAVYR"
FT   gene            complement(729266..731467)
FT                   /locus_tag="BMA10247_0748"
FT   CDS_pept        complement(729266..731467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0748"
FT                   /product="putative fusaric acid resistance protein"
FT                   /note="identified by match to protein family HMM PF04632"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04601"
FT                   /protein_id="ABO04601.1"
FT                   /translation="MSAASPPSAATPQSAGAAFVASMSDWARTDGAAWLYLAKALAAAF
FT                   LALGVSMVLDLPAPKTAMTTVFIVMQPQSGAVFAKSFYRLIGTFVGLTATLALVGLFPQ
FT                   QPVLFLLAVALWVAACTAGAARNRNFRSYGFLLAGYTAALIGLPASQAPNGAFMTAMTR
FT                   VSEISVGILSAGIVSALIFPQYTGEQMRTTVRRRFGAFVDYVAAALAGALDRSKIESVH
FT                   TRFVADVVGFEAARSMAVFENPDTRMRSGRLSRLNSEFMTASSRFHSLHQLMNRLHATS
FT                   AQAVDALEPYFREIAPLLSNDGDHVRTSADAARAAEQLLAYRDALPRRIRATRAEHETQ
FT                   PAFPLLDFDTASELLYRFITDLHAYAATYASLAASTHARERWIERYEPRTNATAALIAG
FT                   IRTASVMLLLSVFWIYSAWPSGVMLVLNAAAVCALASSSPQPTRMAAQMALGTAFAVAT
FT                   GFVLMFGVYPHIDGFVLLCAALAPFLAPGVLMSLKPKYAGCGAGYLIFFCTLAGPENLT
FT                   HYDPIGFMNDALALVLSMIVSAIAFAVLFPPSAPWLKKRLFADLRHQAVAACHARLPGL
FT                   RTRFESGARDLMFQAHGLSADQPDAQRDALRWMFAVLETGNAVIDLRHELAALPRDPRY
FT                   AATMPWRRKIEAARDALAALFDKPAPARFDAALAAAVDAIAATQQALVAFAPPREERHQ
FT                   MQRILSQLHFVRTALLDPESPLAALNGARTPTDRPGVSS"
FT   gene            complement(731484..733232)
FT                   /locus_tag="BMA10247_0749"
FT   CDS_pept        complement(731484..733232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0749"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family protein"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07332"
FT                   /protein_id="ABO07332.1"
FT                   /translation="MRGTLALAVLAISLIMAGCASMGDVAPQDKQVDPASLDAGAAIAA
FT                   AERDAGWPAADWWRAYRDPQLDSWIVASLAGNPSLAAAQARVREAQSLARIAHAEELPQ
FT                   LNGNLSLMRQHWPDNVYYGPGPLANADTWNNTGTLSLSYHLDLWGKDKHNAERALDAAR
FT                   ARAADARAAQLELEANVVRAYVDFAKNYALLDIAHATYERQNALAELARKRLRAGIGTQ
FT                   LEVSQAEAPLPDYSRQIDSYEEAIQLGRHQLAALAGKGPGAGASLARPKLALDANAALP
FT                   SALPAELLGRRPDIVAARWMVDAQARGIDVAKAAFYPNVDLIASLGGFAVSAPFATFLR
FT                   AMNGGWSAGPALTLPIFEGGRLRAQLGVASAGYDQAVEHYNQTIVGALKDIADNVVRLH
FT                   SLDSQQKDAARAVSLTRRSYDLSHAGFSRGLTDYVNVLIAQSQLLTAQENQTRIEAARL
FT                   AAHASLMVALGGGLETGRDAPHDAPAGDARRTGASGASGASGASGASGASSTAGASATA
FT                   SASAAGHAPAGAAAPASPAGIRAAASARASMPAPAAAATAPAFASPVAGASTPMPAATA
FT                   AARAAR"
FT   gene            733405..734346
FT                   /locus_tag="BMA10247_0750"
FT   CDS_pept        733405..734346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0750"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05814"
FT                   /protein_id="ABO05814.1"
FT                   /translation="MDTLQNMRVFVRVVDAGSFTAAAQQLNSTTAYASRAVSDLEAHLR
FT                   TRLLNRTTRRIALTEAGERYLQRCEQILAYVEQAEAEASDAHARPSGKLKVHCMTSLGQ
FT                   HYTVPAVSRYRQRYPEVQVDLTLAQRLPDLLDEGFDVSLVVGRELPDSGLVSQRLGETF
FT                   SVVCASRGYIEQHGAPQRPQDLAGHVCLGMVAPGLYWDEWKLVGPQGEQSVTLAPPPFR
FT                   VNVAEALAAGIREGMGIGVLPLYSAIAGLRNGDFVRVMPEYRSHVMNIYALYASRQYLD
FT                   AKIRTWVDFLRDELPSILEADEAALERFTVQT"
FT   gene            734497..734658
FT                   /locus_tag="BMA10247_0751"
FT   CDS_pept        734497..734658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0751"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04080"
FT                   /protein_id="ABO04080.1"
FT                   /translation="MLMGFGALALFGAIGIAASRELLRAIDAQQRRAPVPVRVRTRRPH
FT                   RDGRRTVL"
FT   gene            complement(734690..735673)
FT                   /locus_tag="BMA10247_0752"
FT   CDS_pept        complement(734690..735673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0752"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06756"
FT                   /protein_id="ABO06756.1"
FT                   /translation="MKVRVLSDLHLECNEPEAIAHAQADLVVLAGDIHNHAEGLRWAAQ
FT                   TFDPAVPVVYVPGNHEYYDGEFGALETAMRDAAAALDHVHYLNNDVYVDPAGRFRVLGT
FT                   TLWTDFELFGNDAAALSQSIAACERVMLDFKGLIQVDWPGGADASSGESSGASREALRE
FT                   ALRDAAAECAPNASPEESAPRRAMQTPAGASAPAATADAPAPGPRHFAPRDALALHRTA
FT                   RAWLERELAKPWPGATIVVTHHAPLRASLAPRYADDLASAGFISDLATLVRPPVSLWIH
FT                   GHTHTSFDYTTAQGTRVVCNPHGYIRRRTGERENPSFEWGKVVTLA"
FT   gene            complement(735705..737126)
FT                   /locus_tag="BMA10247_0753"
FT   CDS_pept        complement(735705..737126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0753"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06067"
FT                   /protein_id="ABO06067.1"
FT                   /translation="MTSTSAFVDACRHAIGADHVLTDSHDTAPFLTDWRRRYQGAACAV
FT                   LRPANTEEVAALVKLALEHRVALVPQGGNTGLAGGATPDAGGKQAVLSLARLNRVRALD
FT                   PHNNTITVEAGVILADAQARARDADRLFALSLAAEGSCTIGGNLATNAGGTAVLRYGNA
FT                   RELCLGLEVVTAQGEVWDGLRGLRKDNTGYDLRDLFIGAEGTLGIITAAVMKLHPLPAA
FT                   KVTALAALESPHAALDFLALAQRAAGPLLTGFELMSDFCMKLVGKHYPQLRYPFDAAHP
FT                   QTVLLELSDNESEAHARALFETMMEQAFEAGLVVDAVVAENLAQSRAFWDLREHIPLAQ
FT                   ADEGLNIKHDIAVPISAIAHFIDETDAAIQAAAPGARMVTFGHLGDGNLHYNVQMPEGG
FT                   DPKAFLAEHQAPINRIVYDNVHKHRGTISAEHGIGQLKIDDAQRYKAAVEIRLMRALKA
FT                   ALDPLNLMNPGKVLH"
FT   gene            complement(737161..737610)
FT                   /locus_tag="BMA10247_0754"
FT   CDS_pept        complement(737161..737610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0754"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07243"
FT                   /protein_id="ABO07243.1"
FT                   /translation="MSAPVAAKPLAAHAAALCLVALIALGVAWEAWLAPLRPGGSALIL
FT                   KAVPLALALPGVWRRSVYTLQWASMLILIYLAEGIVRGMTDGGLSARLGWLEAALALGF
FT                   FGAALAYVAPYKRAAKQAARRAAKRAEQPEKHAPARARASDRTRP"
FT   gene            complement(737607..738215)
FT                   /locus_tag="BMA10247_0755"
FT   CDS_pept        complement(737607..738215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0755"
FT                   /product="flavodoxin"
FT                   /note="identified by match to protein family HMM PF00258;
FT                   match to protein family HMM PF03358; match to protein
FT                   family HMM TIGR01755"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05459"
FT                   /protein_id="ABO05459.1"
FT                   /translation="MKDILVLYYSRHGATRELALAIAAGIDSVPGMQARIRTVPPVSTV
FT                   CEATQPDIPDDGPPYAEPRDLDECAGLALGSPTRFGNMAAPLKYFLDGTTPQWLSGALA
FT                   GKPACVFTSTGSLHGGQESTLLSMMLPLLHHGMLIVGIPYTETALSVTQTGGTPYGASH
FT                   FARVADPARERISADEKTLAHALGARLARTASQLGAAAA"
FT   gene            738321..739631
FT                   /gene="rbn"
FT                   /locus_tag="BMA10247_0756"
FT   CDS_pept        738321..739631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="BMA10247_0756"
FT                   /product="tRNA-processing ribonuclease BN"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF03631;
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04705"
FT                   /protein_id="ABO04705.1"
FT                   /translation="MPKLSVDLDTIKRLARFAAKRSAEDRIPQVAGSLTFTTMLALVPL
FT                   VTVAFALFTAFPMFASFQNSLQGFLADHLMPAQFNSQIFKYLNQFASKAKGLTTAGLIV
FT                   LVFTAVMMMTIESAFNLIWRVRKPRPFAQRVLAYWALITLGPLLFGVSLSMSSYLFTKS
FT                   LAFAGSTSTPPVFEWLLAAASLPLTVLAFTLLYVYLPNCTVAWRDAVVGGVCAALAFEL
FT                   AKRGFGYYVRRIPTYTAVYGAFATVPMFLLWLYLSWFVTLAGAMIASALPAIRVGQFHR
FT                   IHYPGSDLLDSLELLARLADAQQAGKPGHTAARLALMARCDMETAQRLLSTLEEREWVA
FT                   RLQSGNDAAPRYVMLANPERLTVANLFDVLVIDRSELVYQAQRGRTEVDCATLVDAFTS
FT                   EKLDLSLAELIARRRQGASRDAPGAAHSTSALPPRTA"
FT   gene            complement(739803..740123)
FT                   /locus_tag="BMA10247_0757"
FT   CDS_pept        complement(739803..740123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0757"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04157"
FT                   /protein_id="ABO04157.1"
FT                   /translation="MAHSAHTEHFASFAEFYPFYLDEHRHLVSRRLHFVGSLGVIGCLA
FT                   MALATGLWWWLPAAVVCGYGFAWIGHFFFEKNRPATFRHPIYSLMGDWVMFKDICTGKI
FT                   SI"
FT   gene            740106..740297
FT                   /locus_tag="BMA10247_0758"
FT   CDS_pept        740106..740297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0758"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06835"
FT                   /protein_id="ABO06835.1"
FT                   /translation="MRGMCHDSLLERLRRPRGASRVSLCGGAPLAATASAAAVAASAAA
FT                   RAVAAVERRKLSFCGAFR"
FT   gene            740340..740804
FT                   /locus_tag="BMA10247_0759"
FT   CDS_pept        740340..740804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0759"
FT                   /product="CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06998"
FT                   /protein_id="ABO06998.1"
FT                   /translation="MRVSDILKVKGNTLFTVTPDTPLRSAVDTMAEHDIGSLVVMEYGD
FT                   LVGILTFREIILRLKANGGSIGEVLVRTVMDEPLTCTPETDIDEVRRMMLERHARYMPV
FT                   LDKKVLMGVISFYDVAKTVVEAQSFENRMLKAYIRDWPEPDSEERKPLAS"
FT   gene            740904..742718
FT                   /pseudo
FT                   /locus_tag="BMA10247_0760"
FT                   /note="acyltransferase family protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01553; match to
FT                   protein family HMM PF07690"
FT   gene            742715..742834
FT                   /pseudo
FT                   /locus_tag="BMA10247_0761"
FT                   /note="acyltransferase family protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            743016..744308
FT                   /gene="aroC"
FT                   /locus_tag="BMA10247_0762"
FT   CDS_pept        743016..744308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="BMA10247_0762"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="identified by match to protein family HMM PF01264;
FT                   match to protein family HMM TIGR00033"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04534"
FT                   /db_xref="GOA:A3MJ92"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MJ92"
FT                   /protein_id="ABO04534.1"
FT                   /translation="MRPPFRAARAKPARDIGRRAARMLGRARSRGAARSRAISPHCPKR
FT                   AGIMTVSPTDFLLDGPMSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALTEADVQL
FT                   ELDRRKPGTSRHVTQRQEPDQVEILSGVFEGVTTGAPIALLIRNTDQRSKDYGNIAETF
FT                   RPGHADYTYWQKYGVRDYRGGGRSSARLTAPVVGAGAIAKKWLRERFGVEVRGYMSALG
FT                   EIEIPFVDWSHVRENPFFAPNADIVPQLEDYMDALRKDGDSIGARIDVVASGVPVGWGE
FT                   PLFDRLDADIAHAMMGINAVKGVEIGAGFASVAQRGSVHGDELTPDGFVGNHAGGVLGG
FT                   ISTGQDITVSIAIKPTSSIRTPRRSITRAGEPAVVETFGRHDPCVGIRATPIAESMLAL
FT                   VLIDHALRHRAQCGDVSSATPRIAARAPDAQ"
FT   gene            745016..745420
FT                   /locus_tag="BMA10247_0763"
FT   CDS_pept        745016..745420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0763"
FT                   /product="isrso11-transposase orfb protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06537"
FT                   /protein_id="ABO06537.1"
FT                   /translation="MRQHHPLSILLNVAGLARSTFYYQQKVLLAGDRYAALKQRIRAIY
FT                   ESHRGRYGYRRITAVIRQAGTPVNHKLVRRLMLQLGLKSLVRAKKYRSWRGMVGCVAPN
FT                   LLNRQFKAERLNQKWVTDVTEFNVKGQKLY"
FT   gene            complement(745465..746298)
FT                   /locus_tag="BMA10247_0764"
FT   CDS_pept        complement(745465..746298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0764"
FT                   /product="A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07123"
FT                   /protein_id="ABO07123.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(746322..746585)
FT                   /locus_tag="BMA10247_0765"
FT   CDS_pept        complement(746322..746585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0765"
FT                   /product="transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04112"
FT                   /protein_id="ABO04112.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   gene            complement(746782..747441)
FT                   /locus_tag="BMA10247_0766"
FT   CDS_pept        complement(746782..747441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0766"
FT                   /product="cystine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05511"
FT                   /protein_id="ABO05511.1"
FT                   /translation="MPITSLLAQSLPVLLQGALLTVKFAVLSMLFGLVGAVALALMGIG
FT                   RSRVLAGLARAYVSVMRGTPLLVQIFVVYYGLPSLGVSLDPTPAGVIALSANVAAYMSE
FT                   SMRGAINGIDKGQWLAAYSLGLSWRQTLRYVIGPQALRIAVPSLSNSLISLIKDTSLVS
FT                   VITVTELLRSAQEIIASTYQPLPLYLAAAAVYWVLCQILEWVQRWYERRLALPSRH"
FT   gene            complement(747571..748365)
FT                   /locus_tag="BMA10247_0767"
FT   CDS_pept        complement(747571..748365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0767"
FT                   /product="cystine ABC transporter, periplasmic
FT                   cystine-binding protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06838"
FT                   /protein_id="ABO06838.1"
FT                   /translation="MKIASLKKLLVTGLIGASFAAATAHAADLLDEVKQRGTLRIGLEG
FT                   TFPPFNSKNPQGELVGFDVDIAKAIAAKLGVKPEFVTTEWSGIIAGLQAGKFDVIVNQV
FT                   GITDPRKQTLDFSPAYTFSSAQLIQRKDDARQFKSLEDLKGKKLGVALGTNYMDMAKSV
FT                   PGIDVKTYPGAPEYLRDLAAGRLDAALNDRLMLAYLTKNAQLPLRPGANVGSANPSGIP
FT                   FKKGNPKFAKAIADAMTQLEADGTFTKISDKWFGIDVTKPVK"
FT   gene            complement(748476..749513)
FT                   /gene="pyrD"
FT                   /locus_tag="BMA10247_0768"
FT   CDS_pept        complement(748476..749513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="BMA10247_0768"
FT                   /product="dihydroorotate oxidase"
FT                   /EC_number="1.3.98.1"
FT                   /note="identified by match to protein family HMM PF01180;
FT                   match to protein family HMM TIGR01036"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04279"
FT                   /db_xref="GOA:A3MJ98"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MJ98"
FT                   /protein_id="ABO04279.1"
FT                   /translation="MFSSLYPLARASLFKMDAEDAHHLTLRMLGAAGRTGLACALSPRV
FT                   PDAPRTVMGLSFRNPVGLAAGLDKDGAAIDGFAALGFGFIEVGTVTPRAQPGNPRPRMF
FT                   RLPEADAIINRMGFNNSGVDQFVKNVQAARYRGVLGLNIGKNADTPIERAADDYLYCLE
FT                   RVYPFASYVTINISSPNTKNLRQLQGAGELDALLAALKDKQRRLADLHGKLVPLALKIA
FT                   PDLDDEQVKEIAATLLRHDIEGVIATNTTLSREAVKGLPHADEAGGLSGRPVFDASNAV
FT                   IRKLRAELGDAVPIIGVGGIFSGEDARAKLAAGAALVQLYTGFIYRGPALVAECVKAIA
FT                   RGEAR"
FT   gene            complement(749618..750448)
FT                   /locus_tag="BMA10247_0769"
FT   CDS_pept        complement(749618..750448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0769"
FT                   /product="putative arginine-tRNA-protein transferase"
FT                   /note="identified by match to protein family HMM PF04376;
FT                   match to protein family HMM PF04377"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06132"
FT                   /db_xref="GOA:A3MJ99"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MJ99"
FT                   /protein_id="ABO06132.1"
FT                   /translation="MTHPTELPLSPLSALQFYATAPYPCSYLDGRVARSQVATPSHLIN
FT                   SDIYTELVKAGFRRSGVFTYRPYCDGCRACVPVRVPVDAFAPNRTQRRTWKRHRALVAT
FT                   VAALHYDEEHYALYMRYQSARHAGGGMDRDSRDQYEQFLLQSRINSRLVEFRDLDPAEN
FT                   GASTLRMVSMIDILGDGLSSVYTFFDPDESHASYGTYNILWQIEQAKSLRLPYVYLGYW
FT                   IRESPKMAYKANFHPLEGLVDGRWKVLDPTLADLPPVDAALARAPLPGGHSGTR"
FT   gene            complement(750482..751081)
FT                   /gene="aat"
FT                   /locus_tag="BMA10247_0770"
FT   CDS_pept        complement(750482..751081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aat"
FT                   /locus_tag="BMA10247_0770"
FT                   /product="leucyltransferase"
FT                   /EC_number="2.3.2.6"
FT                   /note="identified by match to protein family HMM PF03588;
FT                   match to protein family HMM TIGR00667"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06029"
FT                   /protein_id="ABO06029.1"
FT                   /translation="MLWWSPDPRMILVPAEFRISATFRKTLKRVLREPRWEIRVDYDFA
FT                   GVMRACAQAPRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRM
FT                   FFGESMYAHASDASKIALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKTFVAHV
FT                   RRAVAEPPIPWRFDKRVVAGLLGQAASATAADAFDR"
FT   gene            complement(751258..751803)
FT                   /locus_tag="BMA10247_0771"
FT   CDS_pept        complement(751258..751803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0771"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07261"
FT                   /protein_id="ABO07261.1"
FT                   /translation="MKFCSVCGHEVIARIPPGDNRERFVCDQCGTIHYQNPRNVVGTIP
FT                   VWGDQVLLCRRAIEPRYGYWTLPAGFMEMGETTAEAAARETLEEAGARVEVQNLFTLLN
FT                   VPHVHQVHLFYLARLVDPSFEAGEESLEVRLFDEADIPWDEIAFPTVSQTLRFFFADRE
FT                   AGDYGVHTGDIFRSLRNG"
FT   gene            complement(752175..752251)
FT                   /locus_tag="BMA10247_0772"
FT   tRNA            complement(752175..752251)
FT                   /locus_tag="BMA10247_0772"
FT                   /product="tRNA-Met"
FT   gene            752450..753019
FT                   /locus_tag="BMA10247_0773"
FT   CDS_pept        752450..753019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0773"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P29953; match to
FT                   protein family HMM PF03928"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04074"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR010371"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MJA2"
FT                   /protein_id="ABO04074.2"
FT                   /translation="MRAPLRGGARFALPYFRFRSPIRFMDIALDLQSIAVQEKTLVFPQ
FT                   FDAARAWALGSQLREFALARGHAVAIDVRTFGQPLFFALVDGATPDNVDWARRKGNVVA
FT                   HFRRSSYAIGLRLQQAGATLADKHGLPAAEYASHGGAFPIAVAGAGVIGSVTVSGLPQR
FT                   GDHELVVEALCAQLGHAYATLALTGN"
FT   gene            753024..753362
FT                   /gene="emrE"
FT                   /locus_tag="BMA10247_0774"
FT   CDS_pept        753024..753362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrE"
FT                   /locus_tag="BMA10247_0774"
FT                   /product="multidrug transporter EmrE"
FT                   /note="identified by similarity to SP:P23895; match to
FT                   protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05313"
FT                   /protein_id="ABO05313.1"
FT                   /translation="MQLPGYAWLAIAIVAEVVGTSALRAAEGFTRLWPTLVVALGYGTA
FT                   FYCLSLTLKSMPVGIVYAIWSGAGIVLITLVALVLYRQVPDWPAVVGLALIVAGVVVLN
FT                   LFSKMQAH"
FT   gene            753359..754534
FT                   /locus_tag="BMA10247_0775"
FT   CDS_pept        753359..754534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0775"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05710"
FT                   /protein_id="ABO05710.1"
FT                   /translation="MTGRARPLSIVMNAFHSDSPSADVRAHVANRIGFLELNRPQALNA
FT                   LSTDMIRALHRALDAWRDDADVLAVVIHSPHPRAFCAGGDVRFFHDAHRRGDQASIDTF
FT                   FIEEYALNHAIFTYPKPYIALMHGVVMGGGMGISQAARRTGGLRVVTDSTKMAMPETRI
FT                   GLFPDVGMSWFLARTPGALGRYLAVTGATLDAASALYAGLADAYLPDAALPALLDALRT
FT                   ERLDDGAAVTARVAAEAARHAPTPAPDGSALACARASIDRHFAQPDVAAIAASLDAERD
FT                   DAVRAAWADKARDAMRGGALSPLSMAVSLEVVERARGATMADCLRRDLDLTRSTFARGD
FT                   VIEGVRAVIVDKDHAPKWRYPAIADVTAQAVAAMFESPWRAHEHPLRKLRD"
FT   gene            754659..754784
FT                   /locus_tag="BMA10247_0776"
FT   CDS_pept        754659..754784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0776"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06250"
FT                   /protein_id="ABO06250.1"
FT                   /translation="MGAARRTEGGIAPFERRETDMSGGEQGVGAIASSDRLRSIR"
FT   gene            754872..755117
FT                   /pseudo
FT                   /locus_tag="BMA10247_0778"
FT                   /note="hypothetical protein; this gene contains a premature
FT                   stop which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(755114..755437)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0777"
FT                   /note="hypothetical protein; this gene contains a premature
FT                   stop which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            755791..756948
FT                   /gene="ssuD"
FT                   /locus_tag="BMA10247_0779"
FT   CDS_pept        755791..756948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuD"
FT                   /locus_tag="BMA10247_0779"
FT                   /product="alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.-"
FT                   /note="identified by match to protein family HMM PF00296;
FT                   match to protein family HMM TIGR03565"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05162"
FT                   /protein_id="ABO05162.1"
FT                   /translation="MNVFWFIPTHGDSRYLGTAEGARAADYDYFRQVAVAADTLGYDGV
FT                   LLPTGRSCEDAWVVASSLIPATKRLKFLVAIRPGLSSPGLSARMASTFDRLSDGRLLIN
FT                   VVTGGDSAELEGDGLFADHDTRYAITDDFLHIWRGLLAESHENGGIDFDGEHLSAKGGK
FT                   LLYPPVQRPHPPLWFGGSSPAAHAIAADHIDTYLSWGEPPAAVEKKIADIRARAAARGR
FT                   EIKFGIRLHVIVRETQEEAWRDADRLISRLDDDTIARAQQAFAKMDSEGQRRMAALHGG
FT                   KRGSRQELEIYPNLWAGVGLVRGGAGTALVGNPEQIAARMREYAALGIETFILSGYPHL
FT                   EESYRFAELVFPLVKGGGNTRRAGPLSGPFGEVVGNQYLPKASQS"
FT   gene            756966..757787
FT                   /gene="ssuC"
FT                   /locus_tag="BMA10247_0780"
FT   CDS_pept        756966..757787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuC"
FT                   /locus_tag="BMA10247_0780"
FT                   /product="aliphatic sulfonate ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04196"
FT                   /protein_id="ABO04196.1"
FT                   /translation="MTTTHSRAHFAARRAAGRAARAVAPWLVPLVLVLAWEFAARAGAL
FT                   SSRVLPEPLAVVRAAWALVESGDMWANVKVSTWRALVGFAIGGGVGLALGLATGLSKAA
FT                   EVALDSTIQMIRNIPALAMIPLVILWFGIDEKAKLFLVALGVFFPVYINTYHGIRSVDA
FT                   GLVEMARSYGVRGFALYRDVILPGALPSILVGVRFALGLMWVMLIVAETISAQSGIGYM
FT                   TMNAREFLQTDVVVVGILLYAVLGKLADVLAKWLERATLRWLPAHQPGAHA"
FT   gene            757784..758791
FT                   /gene="ssuB"
FT                   /locus_tag="BMA10247_0781"
FT   CDS_pept        757784..758791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB"
FT                   /locus_tag="BMA10247_0781"
FT                   /product="aliphatic sulfonate ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05146"
FT                   /protein_id="ABO05146.1"
FT                   /translation="MTGTTLAATYGPISGADLEAELAQPRIADGDAQDAAVYERDGGAR
FT                   ALPFASGGAPPDGDRADVRRAAGAGDASVRLTRVSKRYGERAVLADVDLSIGRGSFVSI
FT                   VGRSGCGKSTLLRLVAELETPSAGTLVKRGDGGGALDTRIMYQEARLLPWKTVLQNVML
FT                   GLGRRAKDDARAVLDEVGLLARANDWPAQLSGGQRQRVALARALVHRPQLLLLDEPLGA
FT                   LDALTRIEMHALIERLWREHRFTALLVTHDVQEAVALADRVLLIEAGRIAFDQRVPLDR
FT                   PRARASAAFAALEDRVLQRVLTGSDAAPAAPNAAGPEGASRGRAAPASGLRWAV"
FT   gene            758880..759095
FT                   /locus_tag="BMA10247_0782"
FT   CDS_pept        758880..759095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0782"
FT                   /product="putative molybdenum-pterin binding protein"
FT                   /note="identified by match to protein family HMM PF03459;
FT                   match to protein family HMM TIGR00638"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05672"
FT                   /protein_id="ABO05672.1"
FT                   /translation="MSITAINVRNQFRGKVKEIIRGPVVSEVDVDTPFGIVTSVITTRS
FT                   VDELELKVGAEVVALVKSTEVSIARL"
FT   gene            759225..759422
FT                   /locus_tag="BMA10247_0783"
FT   CDS_pept        759225..759422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0783"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06429"
FT                   /protein_id="ABO06429.1"
FT                   /translation="MFPTLSPEAIEALKWIDQFGSGRPLPVGFRLALEELLNDGFVYQS
FT                   GPDRVDITDDGKAYLSEAYD"
FT   gene            759496..759750
FT                   /locus_tag="BMA10247_0784"
FT   CDS_pept        759496..759750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0784"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07234"
FT                   /protein_id="ABO07234.1"
FT                   /translation="MEPKGRDISDFGEPYKGYDIEVKTEQVWAGEKAHYRVLQGGAVMI
FT                   DWRLVHIDGLLLSERRVIEQTLAVARSAVDRELLGAGVV"
FT   gene            complement(760078..760473)
FT                   /locus_tag="BMA10247_0785"
FT   CDS_pept        complement(760078..760473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0785"
FT                   /product="isrso15-transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04125"
FT                   /protein_id="ABO04125.1"
FT                   /translation="MLLRNRHNLKPEQAVHLKELLAANQSLLCVYVLRDELKRLWFYRK
FT                   PACAEKAWGQWFEQAQQSGIAALQKFAQRLQGYWHGIVARCRHPLNTSVVEGINNTIKV
FT                   IKRRAYGYRDEQYFFLKIRAAFPGIPR"
FT   gene            760604..760867
FT                   /locus_tag="BMA10247_0786"
FT   CDS_pept        760604..760867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0786"
FT                   /product="transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07251"
FT                   /protein_id="ABO07251.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            760891..761724
FT                   /locus_tag="BMA10247_0787"
FT   CDS_pept        760891..761724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0787"
FT                   /product="A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05663"
FT                   /protein_id="ABO05663.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            complement(761769..762536)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0788"
FT                   /note="ISBma1, transposase, interruption-N; this gene model
FT                   represents a disrupted reading frame with multiple genetic
FT                   anomalies; identified by match to protein family HMM
FT                   PF01610"
FT   gene            complement(763114..763191)
FT                   /locus_tag="BMA10247_0789"
FT   tRNA            complement(763114..763191)
FT                   /locus_tag="BMA10247_0789"
FT                   /product="tRNA-His"
FT   gene            complement(763263..764282)
FT                   /gene="dusA"
FT                   /locus_tag="BMA10247_0790"
FT   CDS_pept        complement(763263..764282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="BMA10247_0790"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF01207;
FT                   match to protein family HMM TIGR00742"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05115"
FT                   /protein_id="ABO05115.1"
FT                   /translation="MSASPALSPRRVSVAPMMDWTDRHCRSFHRTISRHAWLYTEMVTT
FT                   GALIHGDVARHLAFTPDEAPVALQLGGSEPADLAHSAKLGERWGYDEINLNCGCPSERV
FT                   QRGAFGACLMNEPQLVADCVKAMRDAVSIPVTVKHRIGVDAVEDYAFVRDFVGTVAAAG
FT                   CDVFVVHARNAILKGLSPKENREIPPLKYDYAYRLKRDFPQIEIVINGGVTTLDEVEQH
FT                   LRHVDGVMLGREAYHNPYVLAGIDARFYGASAPAPTREEVEAKLVEYCAAELARGTYLG
FT                   AIVRHALGLYRGVAGARGWRRVLSDNKRLGRGDLSIFDEARTHLPRPEEFFEKKALQS"
FT   gene            764365..764820
FT                   /locus_tag="BMA10247_0791"
FT   CDS_pept        764365..764820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0791"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04169"
FT                   /protein_id="ABO04169.1"
FT                   /translation="MRLFARAGEIMRKEMAPRAGTAFARFGRAGAEVRIRTIREARGPC
FT                   LARCRRAARLRFSRRCGALEAFEGGACMIPVHDAGAATRPPPTKKAAGERRRWAGGGPP
FT                   AWGGRCRRRAGFALAMAACLFGNGGAPAGENLLARAERVRASALPRG"
FT   gene            complement(764871..766178)
FT                   /locus_tag="BMA10247_0792"
FT   CDS_pept        complement(764871..766178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0792"
FT                   /product="transporter, dicarboxylate/amino acid:cation (Na+
FT                   or H+) symporter (DAACS) family"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06310"
FT                   /protein_id="ABO06310.1"
FT                   /translation="MKKRRNITSYIVIAMILGIAVGYGCHSAFPDPAIAKEIAGYVSLL
FT                   SDVFLRLIKMIIAPLVFATLTVGIAHMGDTGAVGRVGVKALGWFFIASFTSLLLGLLAA
FT                   TLLQPGSHLSLPLPATDAAVNLKTSAFTLKDFVIHLVPKSIAEAMANNEILQIVVFSIF
FT                   FGTALSALGDAGKRLTGVIEDLAQVMLKVTGAVMWFAPVAVFAALASTITTEGLGILLT
FT                   FAKFMGSFYIALALLWGVLTLAGLVFLGKRTFTLIRLIREPFLLSFATASSEAAYPKLL
FT                   DALDRFGVNRKISSFVLPIGYSFNLDGSMMYCTFAVLFIAQVYGVHLPLGTQITMLLLL
FT                   MLTSKGMAGVPRASLVVIAATLNQFHLPEAGLLLIMGVDMFLDMGRSATNAVGNSIAAA
FT                   VVAKWEGQLDAPRDDADSDSDGGDASRGSPRITQRV"
FT   gene            766417..766812
FT                   /locus_tag="BMA10247_0793"
FT   CDS_pept        766417..766812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0793"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05274"
FT                   /protein_id="ABO05274.1"
FT                   /translation="MPHGRRRARLARHRGRPRGTPGFGGLRARSATGGLAEAASMGDVR
FT                   SFSSAVEACAFGRVSSSCARRGMRCARGLVDSRIASASASNGDARDARAFGRANPFARR
FT                   NLTSREPRRSVAHDLRDREGARWTIAG"
FT   gene            complement(766915..767139)
FT                   /locus_tag="BMA10247_0794"
FT   CDS_pept        complement(766915..767139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0794"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05149"
FT                   /protein_id="ABO05149.1"
FT                   /translation="MPAKALARIRRIALAEPYMRSRQRLMQPDAFGIRMAATSTAPDAR
FT                   RVRHIGCAANSSHERQGGRAAASALLPPA"
FT   gene            complement(767361..767837)
FT                   /locus_tag="BMA10247_0795"
FT   CDS_pept        complement(767361..767837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0795"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01638"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05702"
FT                   /protein_id="ABO05702.1"
FT                   /translation="MKWDDVGSMPCSVARTLAVLGDRWTMLILRNAFLGHRRFEAFQTQ
FT                   LGLTRHVLAERLARLVDEGIFTKRAYQDRPPRFEYRLSQKGLDLYPVLLALAAWGDRWK
FT                   DDGNGPPVVLRHRRCAHVMHPVMVCSECGEPIDPREVEPMPGPGWTKQQADKVD"
FT   gene            768019..768456
FT                   /locus_tag="BMA10247_0796"
FT   CDS_pept        768019..768456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0796"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00369"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06212"
FT                   /protein_id="ABO06212.1"
FT                   /translation="MNPLSMSGLELLRAAAAGDLPAASIAETIPMRPESVELGYVKMIA
FT                   RADGRHLNPLGGVHGGFAATVLDSVTGCAVHTMLDPGVGYGTVDLHVKMLRPVPRDVDL
FT                   VAEGRVIHLSRNLGVAEGTLKTPDDKVVAHASATCFIQRPA"
FT   gene            768732..769784
FT                   /locus_tag="BMA10247_0797"
FT   CDS_pept        768732..769784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0797"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04149"
FT                   /protein_id="ABO04149.1"
FT                   /translation="MEYRTLGDSGVKVSLIGLGTMTWGEQNTESDAHAQLDYAIDQGVT
FT                   LIDTAEMYPVPPKAQTQGRTETYLGTWLAKHPALREKLTIATKIAGPARQPHNPTHIRG
FT                   AGNQFDRKNLTEALDGSLARLRTDYVDLYQLHWPDRSTTTFGRPAYPWIDDPYTVPIEE
FT                   TLAVLGDFVKAGKVRHVGVSNETPWGVAQFLRAAEKLGLPRIVSIQNPYSLLNRTFENG
FT                   LSEFSHRERIGLLAYSPLAFGSLSGKYEGGARPEGARITRFERFQRYSKPHAVQATSRY
FT                   VALAKRHGLSPAQLALAFVNSRPFVTSNLIGATSLAQLRENVASVDVKLAPEILAEIDA
FT                   LHEQQPNPAP"
FT   gene            770140..771201
FT                   /locus_tag="BMA10247_0798"
FT   CDS_pept        770140..771201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0798"
FT                   /product="putative transporter"
FT                   /note="identified by match to protein family HMM PF03773"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06866"
FT                   /protein_id="ABO06866.1"
FT                   /translation="MSSSRSYTPHPALGLATFVVLAVAGLFYVKWFPYYHKAFAAAEHH
FT                   SIGQSILMGAAAHAPQPSLQAALDYAWAYGKAIWQAMVLGLLLGSAVQALLPAHWVARA
FT                   LGGTGFGSVAAGGLLALPGMMCTCCAAPVVAGLRERDASPGGALAFWLSNTVLNPAALV
FT                   FMGFVLGWHWSALRLVLGVAMVFGVGYLVNRLAGAQPRVVDDALRAKLVAEQAAVGNAF
FT                   VRWMKIFARMTVRLVPEYLVLVLLLGAARAWLFPHIGPDIGNGVGWIVAFAIAGMLFVI
FT                   PTAGEVPIIQAMLSLGMGVGPAGALLMTLPPVSVPSLAMLARSFKPATLALVAALVVAF
FT                   GVVGGLAAVALGF"
FT   gene            771516..771938
FT                   /locus_tag="BMA10247_0799"
FT   CDS_pept        771516..771938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0799"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05918"
FT                   /protein_id="ABO05918.1"
FT                   /translation="MTQHKVHPRLEQALTRGDLAIRQVNSTRATAVLNALGKMIVEASA
FT                   TIGVEASIDIAQGERVYDPVNGVWPQKMLVSFDGPVEDADPEELRTVYLLADDPGTMFR
FT                   VEWHRADGKLGRQEGGPLATVAFLTDVEMPWSDDDE"
FT   gene            complement(772017..772853)
FT                   /gene="nodJ"
FT                   /locus_tag="BMA10247_0800"
FT   CDS_pept        complement(772017..772853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodJ"
FT                   /locus_tag="BMA10247_0800"
FT                   /product="ABC transporter, permease NodJ"
FT                   /note="identified by match to protein family HMM PF01061;
FT                   match to protein family HMM TIGR01291"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05372"
FT                   /protein_id="ABO05372.1"
FT                   /translation="MDTRHYTPSPTLAARRRESAFALALPANATNWIAVWRRNYLVWQK
FT                   LAIASMFGNLADPMIYLFGLGLGLGLMVGHVEGVSYIAFLAAGTVGSSVMISASFESMY
FT                   SGFSRMHVQRTWEAIMHTPLSLGDIVLGEIVWAASKAMLSGAAIMLVAGVLGYAKFPSM
FT                   LVALPVIALAGIAFASLAMIVTALAPSYDFFMFYQTLALTPMLLLSGVFFPLAQLPEFA
FT                   QHIAHALPLSNAVDLIRPAMLDRPATDVARHVAILAAYALGGFFVCARLFRRRMMR"
FT   gene            complement(772858..773772)
FT                   /gene="nodI"
FT                   /locus_tag="BMA10247_0801"
FT   CDS_pept        complement(772858..773772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodI"
FT                   /locus_tag="BMA10247_0801"
FT                   /product="nodulation ABC transporter NodI"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01288"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04378"
FT                   /protein_id="ABO04378.1"
FT                   /translation="MSVAPIDFQQVEKRYDDKLVVDGLSFHVQPGECFGLLGPNGAGKT
FT                   TTLKMLLGITHPDAGSISLCGEPVPSRARHARQRVGVVPQFDNLDPDFTVRENLLVFAR
FT                   YFGLTAHAARALVPPLLEFAKLESKADAKVGELSGGMKRRLTLARALVNDPDVLVLDEP
FT                   TTGLDPQARHLMWERLRSLLARGKTILLTTHFMEEAERLCHRLCVIEEGRKIAEGAPRM
FT                   LIEAEIGCDVIEIYGPDPVQLRDELAPFAERTEISGETLFCYVDNPEPIHARLKGRAGL
FT                   RYLHRPANLEDVFLRLTGREMLD"
FT   gene            774002..774493
FT                   /locus_tag="BMA10247_0802"
FT   CDS_pept        774002..774493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0802"
FT                   /product="universal stress family protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07351"
FT                   /protein_id="ABO07351.1"
FT                   /translation="MASYKKILLCYDGTLEGRKALRCGADLALELKAETHLLSVVDMRS
FT                   SIAQSAGLLTDVACSRFEETAREILQEGVNWLTERGVHAQGHFAFGYPIDEIANLATKL
FT                   NVDLVVVGHRCRSGLSRWWMGAGNTQLLDRVSCSILVACASPAEQKAESAKEGAATIGH
FT                   "
FT   gene            complement(774911..775645)
FT                   /locus_tag="BMA10247_0803"
FT   CDS_pept        complement(774911..775645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0803"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06380"
FT                   /protein_id="ABO06380.1"
FT                   /translation="MNSIARPRGRFLKPVAIGIALIVVAAVALYAYASPYLALRQMKQA
FT                   IDARDAQAISVHVDFPALRISLKQQLTDELMRRIDAQKRDNPLAILGAMIGSALVDPLV
FT                   DAYATPDGVAALMSGLPPHARPGQRPPELNPPSDPASAAAAGTGAPPSNAGVPGSASGA
FT                   AKQTASAAAASTSGASGTSGTPPGAPSATPGPSPQTSAGYRGFDEFVVTYRSDDGSARY
FT                   AAVFRRSGIFGWKLSAIDLHDD"
FT   gene            complement(775679..776005)
FT                   /locus_tag="BMA10247_0804"
FT   CDS_pept        complement(775679..776005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0804"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05278"
FT                   /protein_id="ABO05278.1"
FT                   /translation="MERLARLLPFRQFGRLRHLRGRTPCAPLVAAHSRDHADTQPSLLP
FT                   SALPAFARVSLNGSLHHAEPARRAPVRVYHGPSRFIMVGTVDAICRMIDRCIAEERSLT
FT                   QQGL"
FT   gene            complement(776068..776715)
FT                   /gene="lexA"
FT                   /locus_tag="BMA10247_0805"
FT   CDS_pept        complement(776068..776715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="BMA10247_0805"
FT                   /product="repressor LexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="identified by similarity to SP:P0A7C2; match to
FT                   protein family HMM PF00717; match to protein family HMM
FT                   PF01726; match to protein family HMM TIGR00498"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04489"
FT                   /db_xref="GOA:A3MJD2"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MJD2"
FT                   /protein_id="ABO04489.1"
FT                   /translation="MIKLTARQQQVFDLIRRAIERSGFPPTRAEIAAELGFSSPNAAEE
FT                   HLRALARKGVIELAAGASRGIRLLGIDDAPHQLTLPHAALMQLSLPLVGRVAAGSPILA
FT                   QEHISQHYACDPALFSSKPDYLLKVRGLSMRDAGILDGDLLAVQKRTEAKDGQIIVARL
FT                   GDDVTVKRLKRRPGGVELIAENPDYENIFVKAGSAEFALEGIAVGLIRPGEF"
FT   gene            777018..778055
FT                   /gene="sbp"
FT                   /locus_tag="BMA10247_0806"
FT   CDS_pept        777018..778055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="BMA10247_0806"
FT                   /product="sulfate/thiosulfate ABC transporter,
FT                   sulfate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04464"
FT                   /protein_id="ABO04464.1"
FT                   /translation="MVKRNTGLAGGARRLIASLALGAAAALGALTPALADTTFLNVSYD
FT                   PTRELYQDVNQAFGKEWKARTGETVNFKQSHGGSGAQARSVLDGLQADVVTLALAYDID
FT                   ALANKGLVSKDWQKRLPDNASPYTSTIVFLVRKGNPKGIKDWDDLVKPGVSIVTPNPKT
FT                   SGGARWNYLAAWAYAQHQPGGTAQTAKDFVTKLYRNAGVLDSDARGATTSFVQRGIGDV
FT                   LIAWENEAFLSIKEFGADKFEIVVPSASILAEPPVAVVDKVVDKKGTRKLADAYLNFLY
FT                   SRQGQEIAARNYYRPRSRDVPAALTKQFPKLKLYTVDDTFGGWTQAQKTHFADGGVFDS
FT                   IYKPQ"
FT   gene            778188..779081
FT                   /gene="cysT"
FT                   /locus_tag="BMA10247_0807"
FT   CDS_pept        778188..779081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="BMA10247_0807"
FT                   /product="sulfate/thiosulfate ABC transporter, permease
FT                   protein CysT"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00969; match to protein
FT                   family HMM TIGR02139"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07326"
FT                   /protein_id="ABO07326.1"
FT                   /translation="MTTFTFRKPSALPGFGVTLGITLAYLSLVVLIPLAATFLKTATLT
FT                   WDQFVAATTSPRVLASYRLTFSAALGGALVNAVFGFLVAWVLVRYTFPLKRLVDAIVDL
FT                   PFALPTSVAGISLAAVYAQNGWIGRYLAPLGIKVAFTPFGVLVALTFIGLPFVVRTVQP
FT                   VLEDFEREQEEAAACLGASRWLTFRRVVLPAVTPALLTGFALAFARALGEYGSVIFIAG
FT                   NVPMKSEITSLLIITKLEQYDYAGATALAVVMLVVSFVMLLLINTLQWYLQRRTSRGAS
FT                   GPTPAAHAATALGGAQ"
FT   gene            779078..780136
FT                   /gene="cysW"
FT                   /locus_tag="BMA10247_0808"
FT   CDS_pept        779078..780136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="BMA10247_0808"
FT                   /product="sulfate/thiosulfate ABC transporter, permease
FT                   protein CysW"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00969; match to protein
FT                   family HMM TIGR02140"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06367"
FT                   /protein_id="ABO06367.1"
FT                   /translation="MSRDTARSRAGAARADAGPEFGARFGLESGLESGLESGLESGDDA
FT                   RRAARAPARARRLDPVSEPRAVRWLLTGAALAFLALFLVVPLAAVFFEALRKGVDFYLE
FT                   SLADPDAWSAIKLTLVVAAIAVPLNLVFGVCASWAIAKFEFKGKAVLTTLIDLPFSVSP
FT                   VISGLVYVLLFGAQGWLGPWLQAHDVQIIFAVPGIVLAAIFVTFPFVARELIPLMQAQG
FT                   ADEEEAARVLGASGWQIFRRVTLPNVKWGLLYGVILCNARAMGEFGAVSVVSGHIRGQT
FT                   DTMPLHVEILYNEYNFAAAFAVASVLALLALVTLALKLFAERRLSAELAHGRDDASAPA
FT                   AHPGAAVTSSIS"
FT   gene            780150..781205
FT                   /gene="cysA"
FT                   /locus_tag="BMA10247_0809"
FT   CDS_pept        780150..781205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="BMA10247_0809"
FT                   /product="sulfate/thiosulfate ABC transporter, ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.25"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF03459; match to protein
FT                   family HMM PF08402; match to protein family HMM TIGR00968"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05809"
FT                   /protein_id="ABO05809.1"
FT                   /translation="MGITVRNLHKRFGEFAALDDVSLDFPAGELVALLGPSGCGKTTLL
FT                   RVIAGLEHADSGQVVLQGLDVASVGARERQVGFVFQHYALFRHMTVFENVAFGLRVKPR
FT                   RERPSEAAIRAKVHELLSLVQLDWLAQRYPSELSGGQRQRIALARALAVEPKVLLLDEP
FT                   FGALDAKVRKELRGWLRRLHDDLHISTIFVTHDQEEALEVADRIVVLNHGRVEQVGSPQ
FT                   AVYDHPRSAFVYEFLGAANRLDGTVSGNGFVAHGAAQAIAVDADFAGPARAYVRPHDLE
FT                   LAAPHARAQGIAADVRRVVPLGGSVRVELAARSGEVLEAELDRNAWRALALDVGDALTA
FT                   VPRAVRVFPAR"
FT   gene            781275..782201
FT                   /locus_tag="BMA10247_0810"
FT   CDS_pept        781275..782201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0810"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04820"
FT                   /protein_id="ABO04820.1"
FT                   /translation="MNFQQLRFVREAVRQNMNLTEVANVLYTSQSGVSKQIKDLEDELG
FT                   VDIFIRRGKRLTGLTEPGKAVHQLIERMLLDAENLRRVARQFADQDSGHLVVATTHTQA
FT                   RYALPKVIRQFTEVYPKVHLALRQGSPQQIAQMILNGEADLGISTEALDRFPDIVTFPC
FT                   YSWHHVVVVPKGHPLVGRENVTLDDIAEYPIITYDQDFTGRSHIDQAFANAGAVPDVVL
FT                   TAIDADVIKTYVELGMGIGVVAAMAYDAQRDTGLVALDTQHLFEASTTRVGLRRGAFLR
FT                   AYAYRLIEMFAPHLSEGEIAGQLREAA"
FT   gene            782316..782465
FT                   /locus_tag="BMA10247_0811"
FT   CDS_pept        782316..782465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0811"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04263"
FT                   /protein_id="ABO04263.1"
FT                   /translation="MPESALRNAQKKLTIGAPDIKKKDRDAQFVRPTVRRQFLPTYSLR
FT                   GADV"
FT   gene            782638..782901
FT                   /locus_tag="BMA10247_0812"
FT   CDS_pept        782638..782901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0812"
FT                   /product="IS407A, transposase OrfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06748"
FT                   /protein_id="ABO06748.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKGLEVENARLKKLLTEAMLDMEALKVVVKGKP"
FT   gene            782925..783758
FT                   /locus_tag="BMA10247_0813"
FT   CDS_pept        782925..783758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0813"
FT                   /product="IS407A, transposase OrfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06197"
FT                   /protein_id="ABO06197.1"
FT                   /translation="MLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVK
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   gene            783963..785885
FT                   /locus_tag="BMA10247_0814"
FT   CDS_pept        783963..785885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0814"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF06798;
FT                   match to protein family HMM PF08298"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04101"
FT                   /protein_id="ABO04101.1"
FT                   /translation="MDIYSSFANRFEKTREEEFSLEEYLALCKNDPSAYAAAGERMLEA
FT                   IGEPEQIDTRNDPRLSRIFANKVIKVYPAFREFYGMEEVIEQVVAYFRHAAQGLEEKKQ
FT                   ILYLLGPVGGGKSSIAERLKQLMERVPFYALKGSPVNESPLGLFDYDEDGPILEEQYGI
FT                   PRRYLKSILSPWAVKRLHEYNGDIRRFRVVRRYPSILRQIGIAKTEPGDENNQDISSLV
FT                   GKVDIRKLEQYAQDDADAYSYSGGLCLANQGLLEFVEMFKAPIKVLHPLLTATQEGNFK
FT                   GTEGFGAIPFDGIILAHSNESEWKAFRNNRNNEALLDRIFVVKVPYCLRVSEEIKIYEK
FT                   LIRNSSLAEAVCAPGTLKMMAQLSVLTRLHEPENSSLFSKMQVYDGENLKDTDPKAKSY
FT                   QEYRDYAGVDEGMTGVSTRFAFKILSRVFNFDSTEVAANPVHLMYVLEQQIEREQFPPE
FT                   TEQKYLSFVKDLLASRYAEFIGKEIQTAYLESYSEYGQNIFDRYVTYADFWIQDQEFRD
FT                   HDTGESFDRAALNAELEKIEKPAGISNPKDFRNEIVNFVLRARAANGGKNPAWVSYEKL
FT                   RVVIEKKMFSNTEELLPVISFNAKGSAEEQRKHEDFVNRMVAKGYTPKQVRLLCDWYLR
FT                   VRKSS"
FT   gene            786009..787274
FT                   /locus_tag="BMA10247_0815"
FT   CDS_pept        786009..787274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0815"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04285"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05626"
FT                   /protein_id="ABO05626.1"
FT                   /translation="MLHQIIDRRLAGKNKSIANRERFLRRVKNYIRRAVSDAVRDRSIK
FT                   DIQSTQSITIPRKDIAEPTFRHGPGGKRELVHPGNADYVRGDKIPRPPGGAGGGGSQAS
FT                   NEGEGQDDFVFELSREEFMQYFFDDLELPRLVKTHLLTVPSWKNVRAGWAAEGTPNNID
FT                   VVRSLRSALGRRIALGSPFVNELRELEEKLVALKDEPGDHRVEIAQLEDAIHHLKGRIW
FT                   RIPFIDPFDLRYVNRVKMPQPSSQAVMFCLMDVSGSMDEQRKDLAKRFFILLYLFLKRN
FT                   YERIEVVFIRHHTRAEEVDEDTFFHSTESGGTVVSSALELMRKVMEERYSPTEWNIYGA
FT                   QASDGDNWTDDSPKCRKILDEDILTKVRYFAYIQVTPEEQNLWLEYAQLALSQPHLAMK
FT                   KVESAADIYPVFRELFEKHVET"
FT   gene            787274..788956
FT                   /locus_tag="BMA10247_0816"
FT   CDS_pept        787274..788956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0816"
FT                   /product="SpoVR like family protein"
FT                   /note="identified by match to protein family HMM PF04293"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07037"
FT                   /protein_id="ABO07037.1"
FT                   /translation="MTTRHLHNEARGYEPRRRSDEASGAAAHERDASPEAAAQHPEAPA
FT                   SGLKEARMNVADRKPLPCPSDWTFELIEEYDTHISQVAEQYELDIYPIQLELISAEQMM
FT                   DAYASVGMPVNYRHWSFGKHFLSTEKSYRRGQMGLAYEIVINSNPCIAYLMEENTMTMQ
FT                   ALVIAHAAYGHNSFFKGNYLFRLWTDAHAIIDYLVYAKNYVAECEERYGLDRVEELLDS
FT                   CHALMNYGVDRYKRPQKPSLAKESELRREREAYLQSQVNELWRTLPAKKPEFADEEQEE
FT                   RYPPEPQENLLYFAEKNAPFLEPWEREVIRIVRKIGQYFYPQRQTQVMNEGWATFWHYT
FT                   LLNTMYNQGKLADGFMMEFLHSHSNVIYQPPVTKPYYSGINPYALGFSMMSDIRRICEA
FT                   PTEEDHKWFPELAGSPWLPALHYAMRNFKDESFIAQYLSPHLIREMRLFSVLDDDMRDA
FT                   LEVSAIHDDSGYQYVRQALSRQYDIHHREPNIQVWSVNTRGDRSLTLRHFMTDNRHLSN
FT                   DSEEVLKHMARLWQFDVYLESVDETGTVRKRYECRYTAPEIRL"
FT   gene            789426..790730
FT                   /locus_tag="BMA10247_0817"
FT   CDS_pept        789426..790730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0817"
FT                   /product="dicarboxylic acid transporter PcaT"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00883"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0817"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06202"
FT                   /protein_id="ABO06202.1"
FT                   /translation="MNDQTAVAAAARQDVRRRVLAIVGASSGNLVEWFDFYIYSFCALY
FT                   FAPAFFPSGNTTTQLLNTAGVFAAGFLMRPIGGWLFGRIADKHGRRAAMMISVLMMCGG
FT                   SLVIAVLPTYAQIGALAPLLLLVARLFQGLSVGGEYGTSATYMSEVALQGRRGFFASFQ
FT                   YVTLIGGQLCALLVLVILQQTLSSDALKAWGWRIPFVVGAAAALISLYLRKSLDETSTS
FT                   ESRKAKDAGTIRGVWQHKGAFLTVVGFTAGGSLIFYTFTTYMQKYLVNTAGMHAKTASN
FT                   VMTAALFVYMLMQPVFGALSDKIGRRMSMILFGTGAVIGTVPLMHALGGVTSPLVAFGL
FT                   IVVALAIVSFYTSISGLIKAEMFPPEVRAMGVGLSYAVANAIFGGSAEYVALWFKSVGS
FT                   ESSFYWYVTVLCAISLLVSWRMRDPSREGYLRNEP"
FT   gene            790983..792029
FT                   /locus_tag="BMA10247_0818"
FT   CDS_pept        790983..792029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0818"
FT                   /product="ABC transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05924"
FT                   /protein_id="ABO05924.1"
FT                   /translation="MTRASSLGRRSLSLTAALAVLVAALAAASLVAAPAARAEGRIRVA
FT                   EQFGIVYLLLNVARDRHLIEQAGRAEGIAIDVDWVKLSGGAAINDALLSGSIDIAGAGV
FT                   GPLLTIWDRTRGRQNVKGVASLGNLPYYLVSNDPRVKTIADFTARERIAVPAVTVSVQS
FT                   RLLQFAAAQRWGDRAYDRLDKLTQAVAHPDAAAAIIAGRTELTAHFGNPPFQEQELAAN
FT                   PNAHIVLSSYDVLGGPSSATVLYATERFRRDNPKTYRAFVAALGQAARYVQTNPEGAVD
FT                   AYLRVNGSKADRALLLKIVRNPQVQFRIAPQNTFALAAFMHRVGAIRHEPKTWRDYFFD
FT                   DPATAQGS"
FT   gene            792081..792485
FT                   /locus_tag="BMA10247_0819"
FT   CDS_pept        792081..792485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0819"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05184"
FT                   /protein_id="ABO05184.1"
FT                   /translation="MHGMHGIHGIHGIHGIHGIHGIHGIHGIHGIHGIHGIHGIHGIHG
FT                   IHGIHGIHGIHGIHGIHGIHGIHGMRWTRGRRGSSARHDMATRAAAPAVDAATRRDDDV
FT                   APMRRQCGAHDIDIENASLCRAATHLNLDP"
FT   gene            792580..793410
FT                   /locus_tag="BMA10247_0820"
FT   CDS_pept        792580..793410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0820"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0820"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04657"
FT                   /protein_id="ABO04657.1"
FT                   /translation="MAAEPSTLFSNPADAHACATSGKLVRVDRVTLEYRHRERVVRATQ
FT                   QVSFDVYGADRFVLLGPSGCGKSTLLKAIAGFVAPVEGAITLAGEPVRGPGADRIVVFQ
FT                   EFDQLAPWKTVRENVAFALRAARRLSRRDAAERSRAALDKVGLAAFADAYPHTLSGGMK
FT                   QRVAIARALAMEPRVLLMDEPFAALDALTRRRMQHELLRLWDDARFTLLFVTHSIEEAL
FT                   VIGNRVLLLSPHPGRVRAELNSHHFDERSVGRADFQRTAERIQRLLFDESGARA"
FT   gene            793437..794378
FT                   /locus_tag="BMA10247_0821"
FT   CDS_pept        793437..794378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0821"
FT                   /product="permease"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0821"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06550"
FT                   /protein_id="ABO06550.1"
FT                   /translation="MRDEYELALAPAASIDAIAPAAGIAAARAGDPAAGAGECGRAAPL
FT                   ARLYARLGVRRLRDAQWLRKTALALALIAAWEIVARVVDDDLLLPSFGATALAFAHGVA
FT                   NGELPAKIAVSLSMLLRGYALGVALAFALTALAATTRLGRDLLTMLTAMFNPLPSIALL
FT                   PLALLWFGLGTGSLLFVLVHAVLWPLALSTFAGFQAVPATLRMVGRNYGLTGVRHVVAI
FT                   LVPAALPSILAGLKVAWAFAWRTLIAAELVFGASAGGGGLGWYIFQNRNELYTDRVFAG
FT                   LAAVIAIGLVVEHGVFDALERVSVKRWGAHTL"
FT   gene            794954..795145
FT                   /locus_tag="BMA10247_0822"
FT   CDS_pept        794954..795145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0822"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF04964"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0822"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06166"
FT                   /protein_id="ABO06166.1"
FT                   /translation="MLRFIQSLWRDERGVSALEYSVLAGIVVVAVAAAGAIFGGGSGLP
FT                   ELFQNMITKVTSVQTNGH"
FT   gene            795210..795689
FT                   /locus_tag="BMA10247_0823"
FT   CDS_pept        795210..795689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0823"
FT                   /product="putative fimbriae assembly-related protein"
FT                   /note="identified by match to protein family HMM PF01478"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0823"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05582"
FT                   /protein_id="ABO05582.1"
FT                   /translation="MILPLKLVASWTLASLALADLRTRRLATFAVALVGALYAALALVG
FT                   APGDGGFASHAALGAAAFALGAAMFRAGWIAGGDVKLAAVVFLWAGPAHAWPVAFAIGV
FT                   GGLAVGAVCIAAGRAPRVLAWFAPARGVPYGVALAAGGLLAVWAPAACRLPGCLG"
FT   gene            795702..796754
FT                   /gene="cpaB"
FT                   /locus_tag="BMA10247_0824"
FT   CDS_pept        795702..796754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaB"
FT                   /locus_tag="BMA10247_0824"
FT                   /product="Flp pilus assembly protein CpaB"
FT                   /note="identified by match to protein family HMM PF08666;
FT                   match to protein family HMM TIGR03177"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0824"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05586"
FT                   /protein_id="ABO05586.1"
FT                   /translation="MSHFLKLAGLMLVAVVGAFLFRALYVAASQPRPAAPPQQVRVRVA
FT                   AADLPAGLLLRDADLGWKTMARSAAPAGALIEGDARGDGKAAGAANDASAAAAGEPKTD
FT                   LKGDLLRHPVRAGAPLGPADVISPSAPGFLAAALKPGMRAISVAIDDVSGNAGLIEPGD
FT                   YVDVLLTQQLAAPGGTPADPQRAVESETIAARLRVLAVGSAFQRPKDDAAQPNTRARTV
FT                   TFEVSSRDAQVITVGAHLGALSLALRSFATSDRGAVGTAPAEPPAPPVWAGDVSRALRA
FT                   QAPAEAPAQPRRVGAARAQAERRVIVYRGSKQDDAASAGTPLPGGVPPIPTLPPLPGAA
FT                   APPAGARPAA"
FT   gene            796789..798237
FT                   /locus_tag="BMA10247_0825"
FT   CDS_pept        796789..798237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0825"
FT                   /product="RhcC2"
FT                   /note="identified by match to protein family HMM PF00263"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0825"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06090"
FT                   /protein_id="ABO06090.1"
FT                   /translation="MWSVIDAIGKRRQAASASPRARAFAAGRRAAAAALWWLALALGMA
FT                   VAPRFARAADLGPVLAVPAGGGEMVKLPAPAVAVFVADPDVADVHVPTPQAVFVLGKKA
FT                   GTTTLFALGANNRTILRETVVVDVDTPSLQRILDARFPQLRLTLAGAPGSLMVSGRVPS
FT                   AADADAVVQTLKPYLRQQEALVNRLTLARPIQVHLRVRITEVDRNITQQLGINWSALGA
FT                   SGNFVGGLFNGRTLFDTASKAFDLSPSGAFSVVGGFHTSRYSIDGVLDALDQEGLITML
FT                   AEPNLTAISGQTASFLAGGEFPIPVAQDTTGAITIQFKPYGVSLDFTPTVLADNRISLK
FT                   VRPEVSEIDPTNSVTTGSIKVPALTVRRVDTTVELSSGQSFAIGGLLQSKSSDVLAELP
FT                   GLARLPVLGKLFSSRNYLNDKTEVVVIVTPYIVQPANPGELRDALDDVTRPSSDIEFVL
FT                   QRSLGIDPLGGDAPRLAGPAGFVY"
FT   gene            798271..798684
FT                   /locus_tag="BMA10247_0826"
FT   CDS_pept        798271..798684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0826"
FT                   /product="putative liporotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0826"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04923"
FT                   /protein_id="ABO04923.1"
FT                   /translation="MAIRPEHTTRRRASRAVAACAALAALAGCMSGHPPYGMPDASTIG
FT                   YDARTGLARAPDCAALEQRSQMIDAGRARPGVSFGCATYGNLAAMLARPADLVAPLPYA
FT                   GADAALGASAVRRYDEGRATPLNPTSTTTSVTH"
FT   gene            798695..799930
FT                   /locus_tag="BMA10247_0827"
FT   CDS_pept        798695..799930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0827"
FT                   /product="putative CpaE protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0827"
FT                   /db_xref="EnsemblGenomes-Tr:ABO03998"
FT                   /protein_id="ABO03998.1"
FT                   /translation="MGAFDRVGGARPVKELRDAAGGARLVAIVADAASDEVIRNLIADQ
FT                   AMTGAQVARGGIDDAIALMRDLSHGPQHLLVDVSGAAMPLSDLARLADVCDPSVNVIVI
FT                   GERNDVGLFRSMLRIGVRDYLVKPLTVELVHRALSAADPNAAARAGKAIGFVGARGGVG
FT                   VTSIAVALARHLADRTRRRVAYVDFDCHGGAACSMLGVVSNQGLVELLQNPQRLDAQLI
FT                   HQAMVAQSDRLFVLSAELPYDSEAPWRAGAVAGLVGALRHQFHYVLLDLPERAGRLVDE
FT                   ALAACASVYVVADRSVHAAREAARLLHHAQARDGDAHVSLILNNAQQPVRGRVEPADFA
FT                   RAVGRASMLELPYEPQTLAVAENLGAALDAPRGDGFAAGIGALAQGLTGADAAPAARRP
FT                   WYARLAGARGAR"
FT   gene            799930..801492
FT                   /locus_tag="BMA10247_0828"
FT   CDS_pept        799930..801492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0828"
FT                   /product="CpaF"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0828"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06911"
FT                   /protein_id="ABO06911.1"
FT                   /translation="MFGRRPAASFAPGDAGGAREFVPDAVSAGAGAAPAGGHASAPDAG
FT                   GAARAREPAGASGASAPGGAPQSGVAPSGHRPASRDDRIDRDDGHDRAPAQDHHEALIR
FT                   SETFKTIRAVVFSSMNMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQALIVDEI
FT                   LNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQRIA
FT                   AAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQGNL
FT                   SQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQP
FT                   HVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS
FT                   MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRV
FT                   TEIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSLRPAFAQRAAYYGLEGALLGA
FT                   LQP"
FT   gene            801489..802484
FT                   /locus_tag="BMA10247_0829"
FT   CDS_pept        801489..802484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0829"
FT                   /product="type II secretion system protein"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0829"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05939"
FT                   /protein_id="ABO05939.1"
FT                   /translation="MSAADVVAVGAFFAIVVAGFIVRALRDLARRRPAARVRSRVEALR
FT                   EPRAAARPVAPARASRVGLQLFTRTHGEGEGGALRAWLRARGEHVRTAAGGGGVRAIAF
FT                   ASALAALAGFVGASFAGFAPWLRLALAAALAAGAARAVYRILIGRFKQRFLSVFPDALD
FT                   LIIRAVRAGIPVAQAIGTAGRESEEPVRATFRAMGDALRVGADLKDVLEQQAERLQLAD
FT                   FSFFGVCLVLQRETGGNLTETLENLSGIIRTRRDIRMKTRALTAEGRIASKIIAAVPFA
FT                   IAGFLFVVNRPYVNLLFHTRAGHKMLILAAVLLTVGLAMIRKIANLDTSR"
FT   gene            802481..803425
FT                   /locus_tag="BMA10247_0830"
FT   CDS_pept        802481..803425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0830"
FT                   /product="bacterial type II secretion system F domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0830"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06299"
FT                   /protein_id="ABO06299.1"
FT                   /translation="MTPAALSITVLLALVAVAALAWLLTRDVAVRRRVAQRARASAARA
FT                   AAVYAPVDDGARSVPRRVAQRVASLGERVPVVDATQRMKLAARLASAGFREHRAVSVMA
FT                   GLKLVVGACAGLAALALGAHVPRVGDYVVLRVLMMAGAFVIGMMLPEHALGFVLARRQK
FT                   TIAAYLPDALDLLVICTNAGNSLAVAIRRVASELKTICPPLADEFSVCADELQIGGDAA
FT                   FALNAMAARIGLPSMRALVTTLVQSQQYGTPITQSLRMLSRTERAMQMIALEEKAAKLA
FT                   PKMTLPMMLFVMPTVALIAAGPAVIRLIAVFHK"
FT   gene            803569..804498
FT                   /pseudo
FT                   /locus_tag="BMA10247_0831"
FT                   /note="TPR repeat protein; this gene contains a frame shift
FT                   which may be the result of a sequencing error; identified
FT                   by match to protein family HMM PF07719; match to protein
FT                   family HMM PF07721"
FT   gene            804508..804936
FT                   /locus_tag="BMA10247_0832"
FT   CDS_pept        804508..804936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0832"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07811"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0832"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04744"
FT                   /protein_id="ABO04744.1"
FT                   /translation="MKRLARLVHDERGVVSLEFVLAFPFMMLVLFGIVDTSLLLCDKAV
FT                   ITNASREAARAGVVVRVPQLAATDITNIALSYAQGSLVSGGTVGAPVVNVDQSAGTSPG
FT                   SPLKVTVSYTYQGLVLGSALSALTGPITLTAVTVMNYE"
FT   gene            804929..805960
FT                   /locus_tag="BMA10247_0834"
FT   CDS_pept        804929..805960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0834"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07811"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0834"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05619"
FT                   /protein_id="ABO05619.1"
FT                   /translation="MNERRAAFARRRERGAVVLWFVLFLPVLLLFGAFAIDLPRVAAAR
FT                   NELQNAADAAALAGAASLEAGAGAPAWAAAASAAAAALSLNASDGAALSSGDVQTGYWN
FT                   VTGVPAGLEPTTLAPGEYDVPAVQATVTRAPNQNGGPLSLLMGGLLGLVGTPAAATAVA
FT                   VAGAPATVGAGGLFPMVIDQCVLDQYWDARAGAPRVDPTTGAPYEFQVGNGRTYGGTCY
FT                   AGQWTTFLVNANDVPTVRGLMAHGNPTPLSIGDSIWIEPGVKTALYYDVPVGVTVVVPV
FT                   ATQISSKTYVPVVAFAAFYVDASDGANLKAITGHFVGGYKIPASASGIGPAYGAYVAPR
FT                   LAY"
FT   gene            complement(805924..806067)
FT                   /locus_tag="BMA10247_0833"
FT   CDS_pept        complement(805924..806067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0833"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0833"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07064"
FT                   /protein_id="ABO07064.1"
FT                   /translation="MPRHDPARHDAVRRGAKHTRGPRVARMRATAAGADVQYARRGATY
FT                   AP"
FT   gene            806240..807055
FT                   /locus_tag="BMA10247_0835"
FT   CDS_pept        806240..807055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0835"
FT                   /product="extracellular solute-binding protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0835"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04487"
FT                   /protein_id="ABO04487.1"
FT                   /translation="MKFKPFATWLLGLSLVAAHAAAHADRLDDIRKAGVLRVATFDSNP
FT                   PFGFVDPRTNRIVGLDVDYAQALADRLGVKLKLQPTNPANRIPFLTSGKVDLVLANFTI
FT                   TDERAKQVDFSVPYFASGQQFLAKKGVLKSADQLNRLRIGADKGTTNEVTLREKYPQAT
FT                   IVAYDDTPFAFAALRAGNVQAITQDGPKLIGLLANVPDKQNYEVPAFSISNDYMGVGAP
FT                   KGEPRLVAFVNETLTDLEASGRAGRIYDAWFGPNTKTPLARIFKIGDKR"
FT   gene            807094..807219
FT                   /locus_tag="BMA10247_0836"
FT   CDS_pept        807094..807219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0836"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0836"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04028"
FT                   /protein_id="ABO04028.1"
FT                   /translation="MKLTVVVNPALNVRGDARGVGRAMPRPTGARAASDACITRA"
FT   gene            807249..807452
FT                   /locus_tag="BMA10247_0837"
FT   CDS_pept        807249..807452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0837"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0837"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04988"
FT                   /protein_id="ABO04988.1"
FT                   /translation="MPCGTLARNAARASARAACASHIHAPRARREGAGGTRANDAIRGA
FT                   QSRDKQSRDKQSAAARAGGPKQ"
FT   gene            807454..808179
FT                   /locus_tag="BMA10247_0838"
FT   CDS_pept        807454..808179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0838"
FT                   /product="binding-protein-dependent transport system inner
FT                   membrane component"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0838"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06409"
FT                   /protein_id="ABO06409.1"
FT                   /translation="MDAWLAPKYLMWLWQGFLLTLGLSLAAAVTATLAGFALAIARHAK
FT                   RASPRRAAAAYVVAFRNTPLVVQLLFWYFGVAALLPEPAMAWLNAPHALDVGGLALRWP
FT                   SFEFVAGWLGLSGYTSAFVAEEFQAGLRGVPAGQHHAASALGLSPLQAFRFVVLPQAVR
FT                   IALPPLFGQYMNLIKNSSLTMAIGVAELSYASRQVETETFRTFAAFGVSTVLYVAAVAL
FT                   VEAAAQWTLRRRDRTFAGR"
FT   gene            808182..808925
FT                   /locus_tag="BMA10247_0839"
FT   CDS_pept        808182..808925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0839"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0839"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07348"
FT                   /protein_id="ABO07348.1"
FT                   /translation="MDLSILANNLPYLLVGAFPDGSLGGAALSLVLALASALASAGLGV
FT                   ALGVALALATGALRGALVVVIGFFRAIPVLMLIFWTYFLLPVLLHADVPGLAAVVCALL
FT                   LVGGAYLAHSVHAGIRAAGDGQWQAGLALGLTRWQTVRHVLLPQAVRIMTPSFVNQWVS
FT                   LVKDTSLAYIVGVPELSFVATQVNNRLMVYPAQIFLFVGVIYLILCTALDVAATRLLAH
FT                   RRRRAPRGDDATRASAAQPAAGGPR"
FT   gene            complement(808967..810379)
FT                   /pseudo
FT                   /locus_tag="BMA10247_0840"
FT                   /note="subfamily M23B unassigned peptidase; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF01551"
FT   gene            810362..810649
FT                   /locus_tag="BMA10247_0841"
FT   CDS_pept        810362..810649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0841"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0841"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04434"
FT                   /protein_id="ABO04434.1"
FT                   /translation="MAKGVHILEKGGSNGKGGGAAAASEPASGRAGSARALNAAGRDRQ
FT                   RTAPRRVPLGPTTRTISAPNGDSVFEGSNPNEESMPTKVTAPRAQLFLAI"
FT   gene            complement(810704..811375)
FT                   /locus_tag="BMA10247_0842"
FT   CDS_pept        complement(810704..811375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0842"
FT                   /product="regulator AmrR"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM PF08361"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0842"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05348"
FT                   /protein_id="ABO05348.1"
FT                   /translation="MARKTREESLNTKNRILDAAELVLLEKGVGQTAMADIAEAAGMSR
FT                   GAVYGHFNGKIEVCVAVCDRAFSRAVEGFDLSDERPALATLRLAASHYLHQCGEPGSMQ
FT                   RVLEILYMKCEQSEENAPLMRRRALYELQTLRIAKALLRRAVAAGELDASLDVHLAGVY
FT                   LLSLLEGIFGSMIWTTRLRGDRWRDAEAMLDAGVDTLRASPALRVAEACAARGLPRANV
FT                   H"
FT   gene            811519..812718
FT                   /locus_tag="BMA10247_0843"
FT   CDS_pept        811519..812718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0843"
FT                   /product="putative membrane fusion protein AmrA"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0843"
FT                   /db_xref="EnsemblGenomes-Tr:ABO06773"
FT                   /protein_id="ABO06773.1"
FT                   /translation="MKYEWARTRRLSAALAVAAFVAAGCGKHESEHDAAAPREASVVTV
FT                   KKTSVPLSVELPGRLDAYRQAEVRAWGAGIVTARTYEEGQEVKRGAVLFRIDPAPFKAA
FT                   RDAAAGALEKARAAHLAALDKRRRYDELVRDRAVSERDHTEALADERQAKAAVASARAE
FT                   LARAQLQLDYATVTAPIDGRARRALVTEGALVGQDQATPLTTVEQLDPIYVNFSQPAAD
FT                   VESLRRAVKSGRAAGIAQQDVEVTLVRPDGSTYARKGKLLFADLAVDPSTDTVAMRALF
FT                   PNPERELLPGAYVRIALDRAVARDAILVPRDALLRTADSATVKVVGQNGKIRDVTVEAA
FT                   QMKGRDWIVTRGLAGGERVVVVDAAQFEAGTTVKALERGAAAQPASGAAAASAPGRRST
FT                   "
FT   gene            812735..813697
FT                   /locus_tag="BMA10247_0844"
FT   CDS_pept        812735..813697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0844"
FT                   /product="multidrug resistance protein MdtF"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0844"
FT                   /db_xref="EnsemblGenomes-Tr:ABO04440"
FT                   /protein_id="ABO04440.1"
FT                   /translation="MARFFIDRPVFAWVISLFIMLGGIFAIRALPVAQYPDIAPPVVSL
FT                   YATYPGASAQVVEESVTAVIEREMNGVPGLLYTSATSSAGQASLSLTFKQGVSADLAAV
FT                   DVQNRLKIVEARLPEPVRRDGISIEKAADNAQIIVSLTSEDGRLSGVELGEYASANVLQ
FT                   ALRRVEGVGKVQFWGAEYAMRIWPDPVKMAALGLTASDIASAVRAHNARVTIGDVGRSA
FT                   VPDSAPIAATVLADAPLTTPDAPVPFGASVQDAATGKELGIVGEAGAAYLTQVQPRAKL
FT                   VVRAGAKTICTPAALPDTLQLDGTPAPVACEAAAQHASR"
FT   gene            813777..814526
FT                   /locus_tag="BMA10247_0845"
FT   CDS_pept        813777..814526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0845"
FT                   /product="MrpD"
FT                   /note="identified by match to protein family HMM PF00345"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0845"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05389"
FT                   /protein_id="ABO05389.1"
FT                   /translation="MTDMTHRFPCAARARRAAAALFIALAGAAHAAIVPDRTRVILNEG
FT                   EQAAIVTLSNKSDAYPYLVQSWLEDERGNRITTPLMVVPPLQRVEPKERNVLRIARMPG
FT                   ATLPADRESVFYLNIREVPPKTDTPNALQIALHTQMKLFYRPAGVQPARDEDPTLPMTL
FT                   RVDAVARKLVFDNPTPYHVTVVALAAGANRAALPLDPVMVNPKSAASVPFSASAAGGLF
FT                   VTHVDDYGGQVTVEYTCDGLACRSVKR"
FT   gene            814523..815548
FT                   /locus_tag="BMA10247_0846"
FT   CDS_pept        814523..815548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0846"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMA10247_0846"
FT                   /db_xref="EnsemblGenomes-Tr:ABO05241"
FT                   /protein_id="ABO05241.1"
FT                   /translation="MSALARLLPRRAPGWLAWACAALVVALAQPAWAVRCLTNSGQTSL
FT                   TEPIGNVASYPTDAPDGYVIWISAPRTTDGYCYKDLGGAGNLNIVDNIYFYANPDGKNP
FT                   AAWGLEIGIRYRGVDHFGAGSRPGTGVPTGFAVPPCSQTDFNAKRCPKIPVSITYQVVV
FT                   RKKGAWVQPPGDVYTVFQFDGEKGLNNTNPSFQYKLSGLQNLKPTPCMVDVTVTPEPGI
FT                   VKFGQVQSSGNGFSPAVPRKPFSLALTKKCSIAVRVDGYFETSQAVRDGLLVPQSDSNF
FT                   GIGIEDRNGHAIAFNRQFVLTQMPANVSYQNIVLDAVLKSFGAPKIGPFTGTATIRLFI
FT                   Y"
FT   gene            complement(815599..817359)
FT                   /locus_tag="BMA10247_0847"
FT   CDS_pept        complement(815599..817359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMA10247_0847"
FT                   /product="putative ABC transport system, membrane protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-