(data stored in SCRATCH zone)

EMBL: CP000551

ID   CP000551; SV 1; circular; genomic DNA; STD; PRO; 1669886 BP.
AC   CP000551;
PR   Project:PRJNA13548;
DT   21-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
DE   Prochlorococcus marinus str. AS9601, complete genome.
KW   .
OS   Prochlorococcus marinus str. AS9601
OC   Bacteria; Cyanobacteria; Synechococcales; Prochloraceae; Prochlorococcus.
RN   [1]
RP   1-1669886
RX   DOI; 10.1371/journal.pgen.0030231.
RX   PUBMED; 18159947.
RA   Kettler G.C., Martiny A.C., Huang K., Zucker J., Coleman M.L., Rodrigue S.,
RA   Chen F., Lapidus A., Ferriera S., Johnson J., Steglich C., Church G.M.,
RA   Richardson P., Chisholm S.W.;
RT   "Patterns and implications of gene gain and loss in the evolution of
RT   Prochlorococcus";
RL   PloS Genet. 3(12):E231-E231(2007).
RN   [2]
RP   1-1669886
RA   Chisholm S., Huang K., Martiny A., Kettler G., Coleman M., Keller K.,
RA   Arkin A., Coe A., Rodrigue S., Ferriera S., Johnson J., Kravitz S.,
RA   Beeson K., Sutton G., Rogers Y.-H., Friedman R., Frazier M., Venter J.C.;
RT   ;
RL   Submitted (06-NOV-2006) to the INSDC.
RL   J Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
DR   MD5; f25c94b6317625856e320177f069518d.
DR   BioSample; SAMN02603921.
DR   EnsemblGenomes-Gn; A9601_rrfVIMSS1309387.
DR   EnsemblGenomes-Gn; A9601_rrlVIMSS1365720.
DR   EnsemblGenomes-Gn; A9601_rrsVIMSS1309386.
DR   EnsemblGenomes-Gn; A9601_tRNAAlaVIMSS1309073.
DR   EnsemblGenomes-Gn; A9601_tRNAAlaVIMSS1309089.
DR   EnsemblGenomes-Gn; A9601_tRNAArgVIMSS1309070.
DR   EnsemblGenomes-Gn; A9601_tRNAArgVIMSS1309086.
DR   EnsemblGenomes-Gn; A9601_tRNAArgVIMSS1309097.
DR   EnsemblGenomes-Gn; A9601_tRNAArgVIMSS1309103.
DR   EnsemblGenomes-Gn; A9601_tRNAAsnVIMSS1309105.
DR   EnsemblGenomes-Gn; A9601_tRNAAspVIMSS1309079.
DR   EnsemblGenomes-Gn; A9601_tRNACysVIMSS1309104.
DR   EnsemblGenomes-Gn; A9601_tRNAGlnVIMSS1309102.
DR   EnsemblGenomes-Gn; A9601_tRNAGluVIMSS1309075.
DR   EnsemblGenomes-Gn; A9601_tRNAGlyVIMSS1309069.
DR   EnsemblGenomes-Gn; A9601_tRNAGlyVIMSS1309072.
DR   EnsemblGenomes-Gn; A9601_tRNAHisVIMSS1309099.
DR   EnsemblGenomes-Gn; A9601_tRNAIleVIMSS1309088.
DR   EnsemblGenomes-Gn; A9601_tRNALeuVIMSS1309067.
DR   EnsemblGenomes-Gn; A9601_tRNALeuVIMSS1309087.
DR   EnsemblGenomes-Gn; A9601_tRNALeuVIMSS1309090.
DR   EnsemblGenomes-Gn; A9601_tRNALeuVIMSS1309098.
DR   EnsemblGenomes-Gn; A9601_tRNALysVIMSS1309093.
DR   EnsemblGenomes-Gn; A9601_tRNAMetVIMSS1309085.
DR   EnsemblGenomes-Gn; A9601_tRNAMetVIMSS1309092.
DR   EnsemblGenomes-Gn; A9601_tRNAPheVIMSS1309084.
DR   EnsemblGenomes-Gn; A9601_tRNAProVIMSS1309076.
DR   EnsemblGenomes-Gn; A9601_tRNAProVIMSS1309094.
DR   EnsemblGenomes-Gn; A9601_tRNAProVIMSS1309096.
DR   EnsemblGenomes-Gn; A9601_tRNASerVIMSS1309071.
DR   EnsemblGenomes-Gn; A9601_tRNASerVIMSS1309074.
DR   EnsemblGenomes-Gn; A9601_tRNASerVIMSS1309077.
DR   EnsemblGenomes-Gn; A9601_tRNASerVIMSS1309091.
DR   EnsemblGenomes-Gn; A9601_tRNAThrVIMSS1309081.
DR   EnsemblGenomes-Gn; A9601_tRNAThrVIMSS1309082.
DR   EnsemblGenomes-Gn; A9601_tRNAThrVIMSS1309083.
DR   EnsemblGenomes-Gn; A9601_tRNAThrVIMSS1309101.
DR   EnsemblGenomes-Gn; A9601_tRNATrpVIMSS1309078.
DR   EnsemblGenomes-Gn; A9601_tRNATyrVIMSS1309080.
DR   EnsemblGenomes-Gn; A9601_tRNAValVIMSS1309068.
DR   EnsemblGenomes-Gn; A9601_tRNAValVIMSS1309100.
DR   EnsemblGenomes-Gn; EBG00001213812.
DR   EnsemblGenomes-Gn; EBG00001213813.
DR   EnsemblGenomes-Gn; EBG00001213814.
DR   EnsemblGenomes-Gn; EBG00001213815.
DR   EnsemblGenomes-Gn; EBG00001213816.
DR   EnsemblGenomes-Gn; EBG00001213817.
DR   EnsemblGenomes-Gn; EBG00001213818.
DR   EnsemblGenomes-Gn; EBG00001213819.
DR   EnsemblGenomes-Gn; EBG00001213820.
DR   EnsemblGenomes-Gn; EBG00001213821.
DR   EnsemblGenomes-Gn; EBG00001213822.
DR   EnsemblGenomes-Gn; EBG00001213823.
DR   EnsemblGenomes-Gn; EBG00001213824.
DR   EnsemblGenomes-Gn; EBG00001213825.
DR   EnsemblGenomes-Gn; EBG00001213826.
DR   EnsemblGenomes-Gn; EBG00001213827.
DR   EnsemblGenomes-Gn; EBG00001213828.
DR   EnsemblGenomes-Gn; EBG00001213829.
DR   EnsemblGenomes-Gn; EBG00001213830.
DR   EnsemblGenomes-Gn; EBG00001213831.
DR   EnsemblGenomes-Gn; EBG00001213832.
DR   EnsemblGenomes-Gn; EBG00001213833.
DR   EnsemblGenomes-Gn; EBG00001213834.
DR   EnsemblGenomes-Gn; EBG00001213835.
DR   EnsemblGenomes-Gn; EBG00001213836.
DR   EnsemblGenomes-Gn; EBG00001213837.
DR   EnsemblGenomes-Gn; EBG00001213838.
DR   EnsemblGenomes-Gn; EBG00001213839.
DR   EnsemblGenomes-Gn; EBG00001213840.
DR   EnsemblGenomes-Gn; EBG00001213841.
DR   EnsemblGenomes-Gn; EBG00001213842.
DR   EnsemblGenomes-Gn; EBG00001213843.
DR   EnsemblGenomes-Gn; EBG00001213844.
DR   EnsemblGenomes-Gn; EBG00001213845.
DR   EnsemblGenomes-Gn; EBG00001213846.
DR   EnsemblGenomes-Gn; EBG00001213847.
DR   EnsemblGenomes-Gn; EBG00001213848.
DR   EnsemblGenomes-Gn; EBG00001213849.
DR   EnsemblGenomes-Gn; EBG00001213850.
DR   EnsemblGenomes-Gn; EBG00001213851.
DR   EnsemblGenomes-Gn; EBG00001213852.
DR   EnsemblGenomes-Gn; EBG00001213853.
DR   EnsemblGenomes-Gn; EBG00001213854.
DR   EnsemblGenomes-Gn; EBG00001213855.
DR   EnsemblGenomes-Gn; EBG00001213856.
DR   EnsemblGenomes-Gn; EBG00001213857.
DR   EnsemblGenomes-Gn; EBG00001213858.
DR   EnsemblGenomes-Gn; EBG00001213859.
DR   EnsemblGenomes-Gn; EBG00001213860.
DR   EnsemblGenomes-Gn; EBG00001213861.
DR   EnsemblGenomes-Gn; EBG00001213862.
DR   EnsemblGenomes-Gn; EBG00001213863.
DR   EnsemblGenomes-Gn; EBG00001213864.
DR   EnsemblGenomes-Gn; EBG00001213865.
DR   EnsemblGenomes-Gn; EBG00001213866.
DR   EnsemblGenomes-Gn; EBG00001213867.
DR   EnsemblGenomes-Gn; EBG00001213868.
DR   EnsemblGenomes-Gn; EBG00001213869.
DR   EnsemblGenomes-Gn; EBG00001213870.
DR   EnsemblGenomes-Tr; A9601_rrfVIMSS1309387-1.
DR   EnsemblGenomes-Tr; A9601_rrlVIMSS1365720-1.
DR   EnsemblGenomes-Tr; A9601_rrsVIMSS1309386-1.
DR   EnsemblGenomes-Tr; A9601_tRNAAlaVIMSS1309073-1.
DR   EnsemblGenomes-Tr; A9601_tRNAAlaVIMSS1309089-1.
DR   EnsemblGenomes-Tr; A9601_tRNAArgVIMSS1309070-1.
DR   EnsemblGenomes-Tr; A9601_tRNAArgVIMSS1309086-1.
DR   EnsemblGenomes-Tr; A9601_tRNAArgVIMSS1309097-1.
DR   EnsemblGenomes-Tr; A9601_tRNAArgVIMSS1309103-1.
DR   EnsemblGenomes-Tr; A9601_tRNAAsnVIMSS1309105-1.
DR   EnsemblGenomes-Tr; A9601_tRNAAspVIMSS1309079-1.
DR   EnsemblGenomes-Tr; A9601_tRNACysVIMSS1309104-1.
DR   EnsemblGenomes-Tr; A9601_tRNAGlnVIMSS1309102-1.
DR   EnsemblGenomes-Tr; A9601_tRNAGluVIMSS1309075-1.
DR   EnsemblGenomes-Tr; A9601_tRNAGlyVIMSS1309069-1.
DR   EnsemblGenomes-Tr; A9601_tRNAGlyVIMSS1309072-1.
DR   EnsemblGenomes-Tr; A9601_tRNAHisVIMSS1309099-1.
DR   EnsemblGenomes-Tr; A9601_tRNAIleVIMSS1309088-1.
DR   EnsemblGenomes-Tr; A9601_tRNALeuVIMSS1309067-1.
DR   EnsemblGenomes-Tr; A9601_tRNALeuVIMSS1309087-1.
DR   EnsemblGenomes-Tr; A9601_tRNALeuVIMSS1309090-1.
DR   EnsemblGenomes-Tr; A9601_tRNALeuVIMSS1309098-1.
DR   EnsemblGenomes-Tr; A9601_tRNALysVIMSS1309093-1.
DR   EnsemblGenomes-Tr; A9601_tRNAMetVIMSS1309085-1.
DR   EnsemblGenomes-Tr; A9601_tRNAMetVIMSS1309092-1.
DR   EnsemblGenomes-Tr; A9601_tRNAPheVIMSS1309084-1.
DR   EnsemblGenomes-Tr; A9601_tRNAProVIMSS1309076-1.
DR   EnsemblGenomes-Tr; A9601_tRNAProVIMSS1309094-1.
DR   EnsemblGenomes-Tr; A9601_tRNAProVIMSS1309096-1.
DR   EnsemblGenomes-Tr; A9601_tRNASerVIMSS1309071-1.
DR   EnsemblGenomes-Tr; A9601_tRNASerVIMSS1309074-1.
DR   EnsemblGenomes-Tr; A9601_tRNASerVIMSS1309077-1.
DR   EnsemblGenomes-Tr; A9601_tRNASerVIMSS1309091-1.
DR   EnsemblGenomes-Tr; A9601_tRNAThrVIMSS1309081-1.
DR   EnsemblGenomes-Tr; A9601_tRNAThrVIMSS1309082-1.
DR   EnsemblGenomes-Tr; A9601_tRNAThrVIMSS1309083-1.
DR   EnsemblGenomes-Tr; A9601_tRNAThrVIMSS1309101-1.
DR   EnsemblGenomes-Tr; A9601_tRNATrpVIMSS1309078-1.
DR   EnsemblGenomes-Tr; A9601_tRNATyrVIMSS1309080-1.
DR   EnsemblGenomes-Tr; A9601_tRNAValVIMSS1309068-1.
DR   EnsemblGenomes-Tr; A9601_tRNAValVIMSS1309100-1.
DR   EnsemblGenomes-Tr; EBT00001782934.
DR   EnsemblGenomes-Tr; EBT00001782935.
DR   EnsemblGenomes-Tr; EBT00001782936.
DR   EnsemblGenomes-Tr; EBT00001782937.
DR   EnsemblGenomes-Tr; EBT00001782938.
DR   EnsemblGenomes-Tr; EBT00001782939.
DR   EnsemblGenomes-Tr; EBT00001782940.
DR   EnsemblGenomes-Tr; EBT00001782941.
DR   EnsemblGenomes-Tr; EBT00001782942.
DR   EnsemblGenomes-Tr; EBT00001782943.
DR   EnsemblGenomes-Tr; EBT00001782944.
DR   EnsemblGenomes-Tr; EBT00001782945.
DR   EnsemblGenomes-Tr; EBT00001782946.
DR   EnsemblGenomes-Tr; EBT00001782947.
DR   EnsemblGenomes-Tr; EBT00001782948.
DR   EnsemblGenomes-Tr; EBT00001782949.
DR   EnsemblGenomes-Tr; EBT00001782950.
DR   EnsemblGenomes-Tr; EBT00001782951.
DR   EnsemblGenomes-Tr; EBT00001782952.
DR   EnsemblGenomes-Tr; EBT00001782953.
DR   EnsemblGenomes-Tr; EBT00001782954.
DR   EnsemblGenomes-Tr; EBT00001782955.
DR   EnsemblGenomes-Tr; EBT00001782956.
DR   EnsemblGenomes-Tr; EBT00001782957.
DR   EnsemblGenomes-Tr; EBT00001782958.
DR   EnsemblGenomes-Tr; EBT00001782959.
DR   EnsemblGenomes-Tr; EBT00001782960.
DR   EnsemblGenomes-Tr; EBT00001782961.
DR   EnsemblGenomes-Tr; EBT00001782962.
DR   EnsemblGenomes-Tr; EBT00001782963.
DR   EnsemblGenomes-Tr; EBT00001782964.
DR   EnsemblGenomes-Tr; EBT00001782965.
DR   EnsemblGenomes-Tr; EBT00001782966.
DR   EnsemblGenomes-Tr; EBT00001782967.
DR   EnsemblGenomes-Tr; EBT00001782968.
DR   EnsemblGenomes-Tr; EBT00001782969.
DR   EnsemblGenomes-Tr; EBT00001782970.
DR   EnsemblGenomes-Tr; EBT00001782971.
DR   EnsemblGenomes-Tr; EBT00001782972.
DR   EnsemblGenomes-Tr; EBT00001782973.
DR   EnsemblGenomes-Tr; EBT00001782974.
DR   EnsemblGenomes-Tr; EBT00001782975.
DR   EnsemblGenomes-Tr; EBT00001782976.
DR   EnsemblGenomes-Tr; EBT00001782977.
DR   EnsemblGenomes-Tr; EBT00001782978.
DR   EnsemblGenomes-Tr; EBT00001782979.
DR   EnsemblGenomes-Tr; EBT00001782980.
DR   EnsemblGenomes-Tr; EBT00001782981.
DR   EnsemblGenomes-Tr; EBT00001782982.
DR   EnsemblGenomes-Tr; EBT00001782983.
DR   EnsemblGenomes-Tr; EBT00001782984.
DR   EnsemblGenomes-Tr; EBT00001782985.
DR   EnsemblGenomes-Tr; EBT00001782986.
DR   EnsemblGenomes-Tr; EBT00001782987.
DR   EnsemblGenomes-Tr; EBT00001782988.
DR   EnsemblGenomes-Tr; EBT00001782989.
DR   EnsemblGenomes-Tr; EBT00001782990.
DR   EnsemblGenomes-Tr; EBT00001782991.
DR   EnsemblGenomes-Tr; EBT00001782992.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC3390001; 22768379.
DR   EuropePMC; PMC6102989; 29915114.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01067; ATPC.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01704; Downstream-peptide.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000551.
DR   SILVA-SSU; CP000551.
FH   Key             Location/Qualifiers
FT   source          1..1669886
FT                   /organism="Prochlorococcus marinus str. AS9601"
FT                   /strain="AS9601"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:146891"
FT   gene            168..1325
FT                   /gene="dnaN"
FT                   /locus_tag="A9601_00001"
FT   CDS_pept        168..1325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="A9601_00001"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number=""
FT                   /note="COG592 DNA polymerase sliding clamp subunit (PCNA
FT                   homolog) [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69288"
FT                   /db_xref="GOA:A2BNC7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNC7"
FT                   /protein_id="ABM69288.1"
FT   gene            1327..2034
FT                   /locus_tag="A9601_00011"
FT   CDS_pept        1327..2034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69289"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNC8"
FT                   /protein_id="ABM69289.1"
FT                   REFSEKKEDDPWI"
FT   gene            2038..4377
FT                   /locus_tag="A9601_00021"
FT   CDS_pept        2038..4377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00021"
FT                   /product="phosphoribosylformylglycinamidine synthetase II"
FT                   /EC_number=""
FT                   /note="COG46 Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, synthetase domain [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69290"
FT                   /db_xref="GOA:A2BNC9"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNC9"
FT                   /protein_id="ABM69290.1"
FT   gene            4425..5885
FT                   /gene="purF"
FT                   /locus_tag="A9601_00031"
FT   CDS_pept        4425..5885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="A9601_00031"
FT                   /product="Glutamine amidotransferase
FT                   class-II:Phosphoribosyl transferase"
FT                   /EC_number=""
FT                   /note="COG34 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69291"
FT                   /db_xref="GOA:A2BND0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A2BND0"
FT                   /protein_id="ABM69291.1"
FT   gene            complement(5882..8323)
FT                   /locus_tag="A9601_00041"
FT   CDS_pept        complement(5882..8323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00041"
FT                   /product="DNA gyrase/topoisomerase IV, subunit A"
FT                   /EC_number=""
FT                   /note="COG188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69292"
FT                   /db_xref="GOA:A2BND1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A2BND1"
FT                   /protein_id="ABM69292.1"
FT                   N"
FT   gene            complement(8400..9263)
FT                   /locus_tag="A9601_00051"
FT   CDS_pept        complement(8400..9263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00051"
FT                   /product="Flp pilus assembly protein TadD, contains TPR
FT                   repeats"
FT                   /note="COG5010 Flp pilus assembly protein TadD, contains
FT                   TPR repeats [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69293"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2BND2"
FT                   /protein_id="ABM69293.1"
FT                   KINQSS"
FT   gene            complement(9260..10216)
FT                   /locus_tag="A9601_00061"
FT   CDS_pept        complement(9260..10216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00061"
FT                   /product="Uncharacterized Fe-S protein"
FT                   /note="COG1600 Uncharacterized Fe-S protein [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69294"
FT                   /db_xref="GOA:A2BND3"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A2BND3"
FT                   /protein_id="ABM69294.1"
FT   gene            10342..11076
FT                   /locus_tag="A9601_00071"
FT   CDS_pept        10342..11076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00071"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG2928 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69295"
FT                   /db_xref="GOA:A2BND4"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:A2BND4"
FT                   /protein_id="ABM69295.1"
FT   gene            11080..11706
FT                   /gene="nusB"
FT                   /locus_tag="A9601_00081"
FT   CDS_pept        11080..11706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="A9601_00081"
FT                   /product="Antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69296"
FT                   /db_xref="GOA:A2BND5"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A2BND5"
FT                   /protein_id="ABM69296.1"
FT   gene            11765..13054
FT                   /gene="ftsY"
FT                   /locus_tag="A9601_00091"
FT   CDS_pept        11765..13054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="A9601_00091"
FT                   /product="signal recognition particle docking protein FtsY"
FT                   /note="COG552 Signal recognition particle GTPase
FT                   [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69297"
FT                   /db_xref="GOA:A2BND6"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A2BND6"
FT                   /protein_id="ABM69297.1"
FT   gene            13122..14465
FT                   /gene="rsbU"
FT                   /locus_tag="A9601_00101"
FT   CDS_pept        13122..14465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /locus_tag="A9601_00101"
FT                   /product="Protein phosphatase 2C domain-containing protein"
FT                   /note="COG2208 Serine phosphatase RsbU, regulator of sigma
FT                   subunit [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69298"
FT                   /db_xref="GOA:A2BND7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A2BND7"
FT                   /protein_id="ABM69298.1"
FT   gene            14527..15906
FT                   /gene="argH"
FT                   /locus_tag="A9601_00111"
FT   CDS_pept        14527..15906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="A9601_00111"
FT                   /product="Fumarate lyase:Delta crystallin"
FT                   /EC_number=""
FT                   /note="COG165 Argininosuccinate lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69299"
FT                   /db_xref="GOA:A2BND8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BND8"
FT                   /protein_id="ABM69299.1"
FT                   L"
FT   gene            16022..16633
FT                   /locus_tag="A9601_00121"
FT   CDS_pept        16022..16633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00121"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69300"
FT                   /db_xref="GOA:A2BND9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A2BND9"
FT                   /protein_id="ABM69300.1"
FT   gene            complement(16630..17634)
FT                   /locus_tag="A9601_00131"
FT   CDS_pept        complement(16630..17634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00131"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /note="COG42 tRNA-dihydrouridine synthase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69301"
FT                   /db_xref="GOA:A2BNE0"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNE0"
FT                   /protein_id="ABM69301.1"
FT   gene            17656..18150
FT                   /locus_tag="A9601_00141"
FT   CDS_pept        17656..18150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00141"
FT                   /product="Domain of unknown function DUF25"
FT                   /EC_number=""
FT                   /note="COG229 Conserved domain frequently associated with
FT                   peptide methionine sulfoxide reductase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69302"
FT                   /db_xref="GOA:A2BNE1"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNE1"
FT                   /protein_id="ABM69302.1"
FT                   D"
FT   gene            18225..18944
FT                   /gene="grpE"
FT                   /locus_tag="A9601_00151"
FT   CDS_pept        18225..18944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="A9601_00151"
FT                   /product="Heat shock protein GrpE"
FT                   /note="COG576 Molecular chaperone GrpE (heat shock protein)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69303"
FT                   /db_xref="GOA:A2BNE2"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNE2"
FT                   /protein_id="ABM69303.1"
FT                   DKVEGDIDSEENTSEDV"
FT   gene            18974..20098
FT                   /gene="dnaJ"
FT                   /locus_tag="A9601_00161"
FT   CDS_pept        18974..20098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="A9601_00161"
FT                   /product="DnaJ protein"
FT                   /note="COG484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69304"
FT                   /db_xref="GOA:A2BNE3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNE3"
FT                   /protein_id="ABM69304.1"
FT   gene            20098..20328
FT                   /locus_tag="A9601_00171"
FT   CDS_pept        20098..20328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69305"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNE4"
FT                   /protein_id="ABM69305.1"
FT   gene            20318..21235
FT                   /locus_tag="A9601_00181"
FT   CDS_pept        20318..21235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00181"
FT                   /product="Predicted GTPases"
FT                   /note="COG1162 Predicted GTPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69306"
FT                   /db_xref="GOA:A2BNE5"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNE5"
FT                   /protein_id="ABM69306.1"
FT   gene            complement(21201..21551)
FT                   /locus_tag="A9601_00191"
FT   CDS_pept        complement(21201..21551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00191"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG718 Uncharacterized protein conserved in bacteria
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69307"
FT                   /db_xref="GOA:A2BNE6"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNE6"
FT                   /protein_id="ABM69307.1"
FT                   NLNLPGFDNSDS"
FT   gene            complement(21569..22462)
FT                   /gene="murB"
FT                   /locus_tag="A9601_00201"
FT   CDS_pept        complement(21569..22462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="A9601_00201"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number=""
FT                   /note="COG812 UDP-N-acetylmuramate dehydrogenase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69308"
FT                   /db_xref="GOA:A2BNE7"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNE7"
FT                   /protein_id="ABM69308.1"
FT                   IYLQPEVRMIGFDYPY"
FT   gene            complement(22479..23828)
FT                   /gene="murC"
FT                   /locus_tag="A9601_00211"
FT   CDS_pept        complement(22479..23828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="A9601_00211"
FT                   /product="Probable UDP-N-acetylmuramate-alanine ligase"
FT                   /EC_number=""
FT                   /note="COG773 UDP-N-acetylmuramate-alanine ligase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69309"
FT                   /db_xref="GOA:A2BNE8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNE8"
FT                   /protein_id="ABM69309.1"
FT   gene            24082..25104
FT                   /gene="gap2"
FT                   /locus_tag="A9601_00221"
FT   CDS_pept        24082..25104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap2"
FT                   /locus_tag="A9601_00221"
FT                   /product="Glyceraldehyde 3-phosphate
FT                   dehydrogenase(NADP+)(phosphorylating)"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG57 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69310"
FT                   /db_xref="GOA:A2BNE9"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNE9"
FT                   /protein_id="ABM69310.1"
FT                   "
FT   gene            complement(25105..26091)
FT                   /gene="thiL"
FT                   /locus_tag="A9601_00231"
FT   CDS_pept        complement(25105..26091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="A9601_00231"
FT                   /product="putative thiamine-monophosphate kinase"
FT                   /EC_number=""
FT                   /note="COG611 Thiamine monophosphate kinase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69311"
FT                   /db_xref="GOA:A2BNF0"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNF0"
FT                   /protein_id="ABM69311.1"
FT   gene            complement(26084..27175)
FT                   /locus_tag="A9601_00241"
FT   CDS_pept        complement(26084..27175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00241"
FT                   /product="Cyclophilin-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /note="COG652 Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) - cyclophilin family [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69312"
FT                   /db_xref="GOA:A2BNF1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNF1"
FT                   /protein_id="ABM69312.1"
FT   gene            27219..27779
FT                   /gene="efp"
FT                   /locus_tag="A9601_00251"
FT   CDS_pept        27219..27779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="A9601_00251"
FT                   /product="Elongation factor P (EF-P)"
FT                   /note="COG231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69313"
FT                   /db_xref="GOA:A2BNF2"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNF2"
FT                   /protein_id="ABM69313.1"
FT   gene            27779..28285
FT                   /gene="accB"
FT                   /locus_tag="A9601_00261"
FT   CDS_pept        27779..28285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="A9601_00261"
FT                   /product="Biotin / Lipoyl attachment:Acetyl-CoA biotin
FT                   carboxyl carrier subunit"
FT                   /EC_number=""
FT                   /note="COG511 Biotin carboxyl carrier protein [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69314"
FT                   /db_xref="GOA:A2BNF3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNF3"
FT                   /protein_id="ABM69314.1"
FT                   RVKQS"
FT   gene            complement(28262..29296)
FT                   /gene="pdxA"
FT                   /locus_tag="A9601_00271"
FT   CDS_pept        complement(28262..29296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="A9601_00271"
FT                   /product="putative pyridoxal phosphate biosynthetic protein
FT                   PdxA"
FT                   /EC_number=""
FT                   /note="COG1995 Pyridoxal phosphate biosynthesis protein
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69315"
FT                   /db_xref="GOA:A2BNF4"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNF4"
FT                   /protein_id="ABM69315.1"
FT                   LNTH"
FT   gene            complement(29317..30195)
FT                   /locus_tag="A9601_00281"
FT   CDS_pept        complement(29317..30195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00281"
FT                   /product="Nucleoside-diphosphate-sugar epimerases"
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69316"
FT                   /db_xref="GOA:A2BNF5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNF5"
FT                   /protein_id="ABM69316.1"
FT                   KIGLKNCYLNR"
FT   gene            30228..30458
FT                   /locus_tag="A9601_00291"
FT   CDS_pept        30228..30458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00291"
FT                   /product="possible Transcription factor TFIID (or TATA-box
FT                   binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69317"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNF6"
FT                   /protein_id="ABM69317.1"
FT   gene            complement(30459..30860)
FT                   /locus_tag="A9601_00301"
FT   CDS_pept        complement(30459..30860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00301"
FT                   /product="HNH endonuclease:HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69318"
FT                   /db_xref="GOA:A2BNF7"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNF7"
FT                   /protein_id="ABM69318.1"
FT   gene            complement(31022..31486)
FT                   /locus_tag="A9601_00311"
FT   CDS_pept        complement(31022..31486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00311"
FT                   /product="type II secretion system protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69319"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNF8"
FT                   /protein_id="ABM69319.1"
FT   gene            complement(31543..32055)
FT                   /locus_tag="A9601_00321"
FT   CDS_pept        complement(31543..32055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69320"
FT                   /db_xref="GOA:A2BNF9"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNF9"
FT                   /protein_id="ABM69320.1"
FT                   IFGVIKS"
FT   gene            32189..32386
FT                   /locus_tag="A9601_00331"
FT   CDS_pept        32189..32386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69321"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNG0"
FT                   /protein_id="ABM69321.1"
FT   gene            complement(32388..33551)
FT                   /gene="dhsS"
FT                   /locus_tag="A9601_00341"
FT   CDS_pept        complement(32388..33551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhsS"
FT                   /locus_tag="A9601_00341"
FT                   /product="soluble hydrogenase small subunit"
FT                   /EC_number=""
FT                   /note="COG75 Serine-pyruvate aminotransferase/archaeal
FT                   aspartate aminotransferase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69322"
FT                   /db_xref="GOA:A2BNG1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNG1"
FT                   /protein_id="ABM69322.1"
FT   gene            33636..34724
FT                   /gene="cbiD"
FT                   /locus_tag="A9601_00351"
FT   CDS_pept        33636..34724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiD"
FT                   /locus_tag="A9601_00351"
FT                   /product="CbiD protein"
FT                   /note="COG1903 Cobalamin biosynthesis protein CbiD
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69323"
FT                   /db_xref="GOA:A2BNG2"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNG2"
FT                   /protein_id="ABM69323.1"
FT   gene            34778..36364
FT                   /locus_tag="A9601_00361"
FT   CDS_pept        34778..36364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00361"
FT                   /product="Glutamine amidotransferase class-I:GMP synthase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG519 GMP synthase, PP-ATPase domain/subunit
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69324"
FT                   /db_xref="GOA:A2BNG3"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNG3"
FT                   /protein_id="ABM69324.1"
FT                   TSKPPGTIEWE"
FT   gene            complement(36584..38173)
FT                   /locus_tag="A9601_00371"
FT   CDS_pept        complement(36584..38173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00371"
FT                   /product="Hypothetical protein"
FT                   /note="COG5010 Flp pilus assembly protein TadD, contains
FT                   TPR repeats [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69325"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNG4"
FT                   /protein_id="ABM69325.1"
FT                   LSQTERYRNLVL"
FT   gene            38483..39196
FT                   /locus_tag="A9601_00381"
FT   CDS_pept        38483..39196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69326"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNG5"
FT                   /protein_id="ABM69326.1"
FT                   EYCNYLKKRWQLSVT"
FT   gene            39277..39876
FT                   /locus_tag="A9601_00391"
FT   CDS_pept        39277..39876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69327"
FT                   /db_xref="GOA:A2BNG6"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNG6"
FT                   /protein_id="ABM69327.1"
FT   gene            39987..40130
FT                   /locus_tag="A9601_00401"
FT   CDS_pept        39987..40130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00401"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69328"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNG7"
FT                   /protein_id="ABM69328.1"
FT                   FK"
FT   gene            40286..41932
FT                   /locus_tag="A9601_00411"
FT   CDS_pept        40286..41932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00411"
FT                   /product="Putative penicillin-binding protein"
FT                   /note="COG768 Cell division protein FtsI/penicillin-binding
FT                   protein 2 [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69329"
FT                   /db_xref="GOA:A2BNG8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNG8"
FT                   /protein_id="ABM69329.1"
FT   gene            complement(41955..42479)
FT                   /locus_tag="A9601_00421"
FT   CDS_pept        complement(41955..42479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00421"
FT                   /product="possible reductase"
FT                   /note="COG431 Predicted flavoprotein [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69330"
FT                   /db_xref="GOA:A2BNG9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNG9"
FT                   /protein_id="ABM69330.1"
FT                   QRLLQMKKLKT"
FT   gene            complement(42497..44299)
FT                   /locus_tag="A9601_00431"
FT   CDS_pept        complement(42497..44299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00431"
FT                   /product="flavoprotein"
FT                   /note="COG426 Uncharacterized flavoproteins [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69331"
FT                   /db_xref="GOA:A2BNH0"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNH0"
FT                   /protein_id="ABM69331.1"
FT   gene            complement(44316..46091)
FT                   /locus_tag="A9601_00441"
FT   CDS_pept        complement(44316..46091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00441"
FT                   /product="flavoprotein"
FT                   /note="COG426 Uncharacterized flavoproteins [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69332"
FT                   /db_xref="GOA:A2BNH1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNH1"
FT                   /protein_id="ABM69332.1"
FT                   SCKTAVHHRKVANHY"
FT   gene            46211..48871
FT                   /gene="alaS"
FT                   /locus_tag="A9601_00451"
FT   CDS_pept        46211..48871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="A9601_00451"
FT                   /product="Alanyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG13 Alanyl-tRNA synthetase [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69333"
FT                   /db_xref="GOA:A2BNH2"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNH2"
FT                   /protein_id="ABM69333.1"
FT                   AKNYLQKTLASHSDK"
FT   gene            complement(48856..50802)
FT                   /gene="speA"
FT                   /locus_tag="A9601_00461"
FT   CDS_pept        complement(48856..50802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="A9601_00461"
FT                   /product="Orn/DAP/Arg decarboxylases family 2"
FT                   /EC_number=""
FT                   /note="COG1166 Arginine decarboxylase (spermidine
FT                   biosynthesis) [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69334"
FT                   /db_xref="GOA:A2BNH3"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNH3"
FT                   /protein_id="ABM69334.1"
FT                   IEISLRKSSYLSE"
FT   gene            50925..51383
FT                   /gene="ndk"
FT                   /locus_tag="A9601_00471"
FT   CDS_pept        50925..51383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="A9601_00471"
FT                   /product="Nucleoside diphosphate kinase"
FT                   /EC_number=""
FT                   /note="COG105 Nucleoside diphosphate kinase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69335"
FT                   /db_xref="GOA:A2BNH4"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNH4"
FT                   /protein_id="ABM69335.1"
FT   gene            complement(51387..52496)
FT                   /gene="dadA"
FT                   /locus_tag="A9601_00481"
FT   CDS_pept        complement(51387..52496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /locus_tag="A9601_00481"
FT                   /product="putative thiamine biosynthesis oxidoreductase"
FT                   /note="COG665 Glycine/D-amino acid oxidases (deaminating)
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69336"
FT                   /db_xref="GOA:A2BNH5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNH5"
FT                   /protein_id="ABM69336.1"
FT   gene            52576..54048
FT                   /gene="gatB"
FT                   /locus_tag="A9601_00491"
FT   CDS_pept        52576..54048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="A9601_00491"
FT                   /product="Glutamyl-tRNA (Gln) amidotransferase subunit B"
FT                   /EC_number=""
FT                   /note="COG64 Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog) [Translation, ribosomal structure
FT                   and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69337"
FT                   /db_xref="GOA:A2BNH6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNH6"
FT                   /protein_id="ABM69337.1"
FT   gene            complement(54052..54669)
FT                   /gene="coaE"
FT                   /locus_tag="A9601_00501"
FT   CDS_pept        complement(54052..54669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="A9601_00501"
FT                   /product="putative dephospho-CoA kinase"
FT                   /EC_number=""
FT                   /note="COG237 Dephospho-CoA kinase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69338"
FT                   /db_xref="GOA:A2BNH7"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNH7"
FT                   /protein_id="ABM69338.1"
FT   gene            54746..55984
FT                   /gene="argJ"
FT                   /locus_tag="A9601_00511"
FT   CDS_pept        54746..55984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="A9601_00511"
FT                   /product="ArgJ family"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1364 N-acetylglutamate synthase
FT                   (N-acetylornithine aminotransferase) [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69339"
FT                   /db_xref="GOA:A2BNH8"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNH8"
FT                   /protein_id="ABM69339.1"
FT                   SKKYVEINSEYTT"
FT   gene            complement(56081..60106)
FT                   /locus_tag="A9601_00521"
FT   CDS_pept        complement(56081..60106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00521"
FT                   /product="Hypothetical protein"
FT                   /note="COG1061 DNA or RNA helicases of superfamily II
FT                   [Transcription / DNA replication, recombination, and
FT                   repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69340"
FT                   /db_xref="GOA:A2BNH9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039442"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNH9"
FT                   /protein_id="ABM69340.1"
FT   gene            complement(60107..60859)
FT                   /locus_tag="A9601_00531"
FT   CDS_pept        complement(60107..60859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00531"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69341"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNI0"
FT                   /protein_id="ABM69341.1"
FT   gene            60951..61403
FT                   /locus_tag="A9601_00541"
FT   CDS_pept        60951..61403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00541"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69342"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNI1"
FT                   /protein_id="ABM69342.1"
FT   gene            complement(61428..61985)
FT                   /locus_tag="A9601_00551"
FT   CDS_pept        complement(61428..61985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00551"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69343"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNI2"
FT                   /protein_id="ABM69343.1"
FT   gene            62077..62577
FT                   /locus_tag="A9601_00561"
FT   CDS_pept        62077..62577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00561"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69344"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNI3"
FT                   /protein_id="ABM69344.1"
FT                   LHQ"
FT   gene            62577..63074
FT                   /locus_tag="A9601_00571"
FT   CDS_pept        62577..63074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00571"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69345"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNI4"
FT                   /protein_id="ABM69345.1"
FT                   SY"
FT   gene            63077..63229
FT                   /locus_tag="A9601_00581"
FT   CDS_pept        63077..63229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00581"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69346"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNI5"
FT                   /protein_id="ABM69346.1"
FT                   DLFKK"
FT   gene            63226..63459
FT                   /locus_tag="A9601_00591"
FT   CDS_pept        63226..63459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00591"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69347"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNI6"
FT                   /protein_id="ABM69347.1"
FT   gene            complement(63742..65064)
FT                   /locus_tag="A9601_00601"
FT   CDS_pept        complement(63742..65064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00601"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69348"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNI7"
FT                   /protein_id="ABM69348.1"
FT   gene            complement(65495..66166)
FT                   /locus_tag="A9601_00611"
FT   CDS_pept        complement(65495..66166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00611"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /note="COG1192 ATPases involved in chromosome partitioning
FT                   [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69349"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNI8"
FT                   /protein_id="ABM69349.1"
FT                   A"
FT   gene            66317..67279
FT                   /gene="tas"
FT                   /locus_tag="A9601_00621"
FT   CDS_pept        66317..67279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tas"
FT                   /locus_tag="A9601_00621"
FT                   /product="Aldo/keto reductase family"
FT                   /note="COG667 Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases) [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69350"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNI9"
FT                   /protein_id="ABM69350.1"
FT   gene            complement(67288..67425)
FT                   /locus_tag="A9601_00631"
FT   CDS_pept        complement(67288..67425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00631"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69351"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNJ0"
FT                   /protein_id="ABM69351.1"
FT                   "
FT   gene            67907..69031
FT                   /locus_tag="A9601_00641"
FT   CDS_pept        67907..69031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00641"
FT                   /product="Putative RNA methylase family UPF0020"
FT                   /note="COG116 Predicted N6-adenine-specific DNA methylase
FT                   [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69352"
FT                   /db_xref="GOA:A2BNJ1"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNJ1"
FT                   /protein_id="ABM69352.1"
FT   gene            complement(69033..69419)
FT                   /locus_tag="A9601_00651"
FT   CDS_pept        complement(69033..69419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69353"
FT                   /db_xref="GOA:A2BNJ2"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNJ2"
FT                   /protein_id="ABM69353.1"
FT   gene            complement(69421..69882)
FT                   /locus_tag="A9601_00661"
FT   CDS_pept        complement(69421..69882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69354"
FT                   /db_xref="GOA:A2BNJ3"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNJ3"
FT                   /protein_id="ABM69354.1"
FT   gene            70053..70208
FT                   /locus_tag="A9601_00671"
FT   CDS_pept        70053..70208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00671"
FT                   /product="Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69355"
FT                   /db_xref="GOA:A2BNJ4"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNJ4"
FT                   /protein_id="ABM69355.1"
FT                   VPDAGN"
FT   gene            70292..70654
FT                   /locus_tag="A9601_00681"
FT   CDS_pept        70292..70654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69356"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNJ5"
FT                   /protein_id="ABM69356.1"
FT                   GLFEISANSCRLSKSY"
FT   gene            70731..74321
FT                   /gene="smc"
FT                   /locus_tag="A9601_00691"
FT   CDS_pept        70731..74321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="A9601_00691"
FT                   /product="putative chromosome segregation protein, SMC
FT                   ATPase superfamily"
FT                   /note="COG1196 Chromosome segregation ATPases [Cell
FT                   division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69357"
FT                   /db_xref="GOA:A2BNJ6"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNJ6"
FT                   /protein_id="ABM69357.1"
FT   gene            74367..75422
FT                   /locus_tag="A9601_00701"
FT   CDS_pept        74367..75422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00701"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69358"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNJ7"
FT                   /protein_id="ABM69358.1"
FT                   KSEKFEIDDPW"
FT   gene            complement(75426..76814)
FT                   /locus_tag="A9601_00711"
FT   CDS_pept        complement(75426..76814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00711"
FT                   /product="cyanobacteria-specific protein"
FT                   /note="related to lipid A disaccharide synthetase; COG763
FT                   Lipid A disaccharide synthetase [Cell envelope biogenesis,
FT                   outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69359"
FT                   /db_xref="GOA:A2BNJ8"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNJ8"
FT                   /protein_id="ABM69359.1"
FT                   IKKL"
FT   gene            complement(76717..76798)
FT                   /locus_tag="A9601_tRNALeuVIMSS1309067"
FT                   /note="tRNA-Leu"
FT   tRNA            complement(76717..76798)
FT                   /locus_tag="A9601_tRNALeuVIMSS1309067"
FT                   /product="tRNA-Leu"
FT   gene            77058..78407
FT                   /gene="accC"
FT                   /locus_tag="A9601_00721"
FT   CDS_pept        77058..78407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="A9601_00721"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG4770 Acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69360"
FT                   /db_xref="GOA:A2BNJ9"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNJ9"
FT                   /protein_id="ABM69360.1"
FT   gene            complement(78425..78730)
FT                   /locus_tag="A9601_00731"
FT   CDS_pept        complement(78425..78730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00731"
FT                   /product="YGGT family, conserved hypothetical integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69361"
FT                   /db_xref="GOA:A2BNK0"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNK0"
FT                   /protein_id="ABM69361.1"
FT   gene            78820..79005
FT                   /locus_tag="A9601_00741"
FT   CDS_pept        78820..79005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00741"
FT                   /product="Photosystem II protein X PsbX"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69362"
FT                   /db_xref="GOA:A2BNK1"
FT                   /db_xref="InterPro:IPR009518"
FT                   /db_xref="InterPro:IPR023428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNK1"
FT                   /protein_id="ABM69362.1"
FT                   FVSQKDSLDRTSTGRR"
FT   gene            79084..80013
FT                   /locus_tag="A9601_00751"
FT   CDS_pept        79084..80013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69363"
FT                   /db_xref="GOA:A2BNK2"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNK2"
FT                   /protein_id="ABM69363.1"
FT   gene            complement(80014..80289)
FT                   /locus_tag="A9601_00761"
FT   CDS_pept        complement(80014..80289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00761"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69364"
FT                   /db_xref="GOA:A2BNK3"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNK3"
FT                   /protein_id="ABM69364.1"
FT   gene            complement(80298..82280)
FT                   /locus_tag="A9601_00771"
FT   CDS_pept        complement(80298..82280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00771"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /note="COG4178 ABC-type uncharacterized transport system,
FT                   permease and ATPase components [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69365"
FT                   /db_xref="GOA:A2BNK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNK4"
FT                   /protein_id="ABM69365.1"
FT   gene            complement(82322..82600)
FT                   /locus_tag="A9601_00781"
FT   CDS_pept        complement(82322..82600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00781"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69366"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNK5"
FT                   /protein_id="ABM69366.1"
FT   gene            complement(82647..82988)
FT                   /gene="hit"
FT                   /locus_tag="A9601_00791"
FT   CDS_pept        complement(82647..82988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hit"
FT                   /locus_tag="A9601_00791"
FT                   /product="HIT (Histidine triad) family protein"
FT                   /note="COG537 Diadenosine tetraphosphate (Ap4A) hydrolase
FT                   and other HIT family hydrolases [Nucleotide transport and
FT                   metabolism / Carbohydrate transport and metabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69367"
FT                   /db_xref="GOA:A2BNK6"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNK6"
FT                   /protein_id="ABM69367.1"
FT                   GRKMNWPPG"
FT   gene            complement(82993..83598)
FT                   /gene="def"
FT                   /locus_tag="A9601_00801"
FT   CDS_pept        complement(82993..83598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="A9601_00801"
FT                   /product="putative formylmethionine deformylase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG242 N-formylmethionyl-tRNA deformylase
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69368"
FT                   /db_xref="GOA:A2BNK7"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNK7"
FT                   /protein_id="ABM69368.1"
FT   gene            83680..85605
FT                   /gene="dap2"
FT                   /locus_tag="A9601_00811"
FT   CDS_pept        83680..85605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dap2"
FT                   /locus_tag="A9601_00811"
FT                   /product="Esterase/lipase/thioesterase family active site"
FT                   /note="COG1506 Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69369"
FT                   /db_xref="GOA:A2BNK8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNK8"
FT                   /protein_id="ABM69369.1"
FT                   KNALNI"
FT   gene            complement(85602..86855)
FT                   /locus_tag="A9601_00821"
FT   CDS_pept        complement(85602..86855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00821"
FT                   /product="putative cysteine desulfurase or selenocysteine
FT                   lyase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG520 Selenocysteine lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69370"
FT                   /db_xref="GOA:A2BNK9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNK9"
FT                   /protein_id="ABM69370.1"
FT                   DIFLEKLKDTIDFLKINS"
FT   gene            complement(86855..88072)
FT                   /locus_tag="A9601_00831"
FT   CDS_pept        complement(86855..88072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00831"
FT                   /product="ABC transporter, membrane component"
FT                   /note="COG719 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69371"
FT                   /db_xref="GOA:A2BNL0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNL0"
FT                   /protein_id="ABM69371.1"
FT                   KLLNEK"
FT   gene            complement(88077..88862)
FT                   /gene="sufC"
FT                   /locus_tag="A9601_00841"
FT   CDS_pept        complement(88077..88862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="A9601_00841"
FT                   /product="ABC transporter, ATP binding component"
FT                   /note="COG396 ABC-type transport system involved in Fe-S
FT                   cluster assembly, ATPase component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69372"
FT                   /db_xref="GOA:A2BNL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNL1"
FT                   /protein_id="ABM69372.1"
FT   gene            complement(88884..90326)
FT                   /locus_tag="A9601_00851"
FT   CDS_pept        complement(88884..90326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00851"
FT                   /product="ABC transporter, membrane component"
FT                   /note="COG719 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69373"
FT                   /db_xref="GOA:A2BNL2"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNL2"
FT                   /protein_id="ABM69373.1"
FT   gene            90422..90775
FT                   /locus_tag="A9601_00861"
FT   CDS_pept        90422..90775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00861"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69374"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNL3"
FT                   /protein_id="ABM69374.1"
FT                   LEIDDLVLLVEQR"
FT   gene            91049..92149
FT                   /locus_tag="A9601_00871"
FT   CDS_pept        91049..92149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00871"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3330 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69375"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNL4"
FT                   /protein_id="ABM69375.1"
FT   gene            92162..92332
FT                   /locus_tag="A9601_00881"
FT   CDS_pept        92162..92332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00881"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69376"
FT                   /db_xref="GOA:A2BNL5"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNL5"
FT                   /protein_id="ABM69376.1"
FT                   IAMLRTSEMPH"
FT   gene            92366..94003
FT                   /gene="pgm"
FT                   /locus_tag="A9601_00891"
FT   CDS_pept        92366..94003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="A9601_00891"
FT                   /product="Phosphoglucomutase"
FT                   /EC_number=""
FT                   /note="COG33 Phosphoglucomutase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69377"
FT                   /db_xref="GOA:A2BNL6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNL6"
FT                   /protein_id="ABM69377.1"
FT   gene            94037..95326
FT                   /gene="mgs1"
FT                   /locus_tag="A9601_00901"
FT   CDS_pept        94037..95326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgs1"
FT                   /locus_tag="A9601_00901"
FT                   /product="putative ATPase, AAA family"
FT                   /note="COG2256 ATPase related to the helicase subunit of
FT                   the Holliday junction resolvase [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69378"
FT                   /db_xref="GOA:A2BNL7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNL7"
FT                   /protein_id="ABM69378.1"
FT   gene            complement(95323..95979)
FT                   /locus_tag="A9601_00911"
FT   CDS_pept        complement(95323..95979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00911"
FT                   /product="possible 4'-phosphopantetheinyl transferase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69379"
FT                   /db_xref="GOA:A2BNL8"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNL8"
FT                   /protein_id="ABM69379.1"
FT   gene            95979..96446
FT                   /locus_tag="A9601_00921"
FT   CDS_pept        95979..96446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00921"
FT                   /product="putative bacterioferritin comigratory (BCP)
FT                   protein"
FT                   /note="COG1225 Peroxiredoxin [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69380"
FT                   /db_xref="GOA:A2BNL9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNL9"
FT                   /protein_id="ABM69380.1"
FT   gene            complement(96438..97133)
FT                   /locus_tag="A9601_00931"
FT   CDS_pept        complement(96438..97133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00931"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="COG1521 Putative transcriptional regulator, homolog
FT                   of Bvg accessory factor [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69381"
FT                   /db_xref="GOA:A2BNM0"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNM0"
FT                   /protein_id="ABM69381.1"
FT                   HHLSIKKLA"
FT   gene            complement(97149..97871)
FT                   /gene="cysH"
FT                   /locus_tag="A9601_00941"
FT   CDS_pept        complement(97149..97871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="A9601_00941"
FT                   /product="Phosphoadenosine phosphosulfate reductase"
FT                   /EC_number=""
FT                   /note="COG175 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase and
FT                   related enzymes [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69382"
FT                   /db_xref="GOA:A2BNM1"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNM1"
FT                   /protein_id="ABM69382.1"
FT                   RDTRFGGIKQECGIHTNN"
FT   gene            97967..99160
FT                   /locus_tag="A9601_00951"
FT   CDS_pept        97967..99160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00951"
FT                   /product="putative NADH dehydrogenase, transport
FT                   associated"
FT                   /EC_number=""
FT                   /note="COG1252 NADH dehydrogenase, FAD-containing subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69383"
FT                   /db_xref="GOA:A2BNM2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNM2"
FT                   /protein_id="ABM69383.1"
FT   gene            99210..101018
FT                   /gene="citT"
FT                   /locus_tag="A9601_00961"
FT   CDS_pept        99210..101018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="A9601_00961"
FT                   /product="putative sodium/sulfate transporter, DASS family"
FT                   /note="COG471 Di- and tricarboxylate transporters
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69384"
FT                   /db_xref="GOA:A2BNM3"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNM3"
FT                   /protein_id="ABM69384.1"
FT   gene            101023..102426
FT                   /gene="trkG"
FT                   /locus_tag="A9601_00971"
FT   CDS_pept        101023..102426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkG"
FT                   /locus_tag="A9601_00971"
FT                   /product="possible sodium transporter, Trk family"
FT                   /note="COG168 Trk-type K+ transport systems, membrane
FT                   components [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69385"
FT                   /db_xref="GOA:A2BNM4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNM4"
FT                   /protein_id="ABM69385.1"
FT                   GYPRADLYV"
FT   gene            102445..103149
FT                   /locus_tag="A9601_00981"
FT   CDS_pept        102445..103149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00981"
FT                   /product="putative potassium channel, VIC family"
FT                   /note="COG569 K+ transport systems, NAD-binding component
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69386"
FT                   /db_xref="GOA:A2BNM5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNM5"
FT                   /protein_id="ABM69386.1"
FT                   GKTADLQKLPQN"
FT   gene            complement(103156..103458)
FT                   /locus_tag="A9601_00991"
FT   CDS_pept        complement(103156..103458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_00991"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_00991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69387"
FT                   /db_xref="InterPro:IPR012869"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNM6"
FT                   /protein_id="ABM69387.1"
FT   gene            103577..103915
FT                   /locus_tag="A9601_01001"
FT   CDS_pept        103577..103915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69388"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNM7"
FT                   /protein_id="ABM69388.1"
FT                   KYNEQNVA"
FT   gene            103950..104180
FT                   /locus_tag="A9601_01011"
FT   CDS_pept        103950..104180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69389"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNM8"
FT                   /protein_id="ABM69389.1"
FT   gene            complement(104158..104337)
FT                   /locus_tag="A9601_01021"
FT   CDS_pept        complement(104158..104337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01021"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69390"
FT                   /db_xref="GOA:A2BNM9"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNM9"
FT                   /protein_id="ABM69390.1"
FT                   NNYSKPVPKDLLEP"
FT   gene            complement(104334..104435)
FT                   /locus_tag="A9601_01031"
FT   CDS_pept        complement(104334..104435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01031"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69391"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNN0"
FT                   /protein_id="ABM69391.1"
FT   gene            104410..106035
FT                   /locus_tag="A9601_01041"
FT   CDS_pept        104410..106035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01041"
FT                   /product="ABC transporter, ATP binding component"
FT                   /note="COG488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69392"
FT                   /db_xref="GOA:A2BNN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNN1"
FT                   /protein_id="ABM69392.1"
FT   gene            106146..106289
FT                   /locus_tag="A9601_01051"
FT   CDS_pept        106146..106289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01051"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69393"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNN2"
FT                   /protein_id="ABM69393.1"
FT                   NN"
FT   gene            complement(106295..107368)
FT                   /locus_tag="A9601_01061"
FT   CDS_pept        complement(106295..107368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01061"
FT                   /product="possible serine protease"
FT                   /note="COG265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69394"
FT                   /db_xref="GOA:A2BNN3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNN3"
FT                   /protein_id="ABM69394.1"
FT                   FIKLKVIPTDITNLQNK"
FT   gene            107590..107853
FT                   /locus_tag="A9601_01071"
FT   CDS_pept        107590..107853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69395"
FT                   /db_xref="InterPro:IPR021355"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNN4"
FT                   /protein_id="ABM69395.1"
FT   gene            107878..108261
FT                   /locus_tag="A9601_01081"
FT   CDS_pept        107878..108261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69396"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNN5"
FT                   /protein_id="ABM69396.1"
FT   gene            108332..108478
FT                   /locus_tag="A9601_01091"
FT   CDS_pept        108332..108478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01091"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69397"
FT                   /db_xref="GOA:A2BNN6"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNN6"
FT                   /protein_id="ABM69397.1"
FT                   GIG"
FT   gene            complement(108483..108824)
FT                   /locus_tag="A9601_01101"
FT   CDS_pept        complement(108483..108824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01101"
FT                   /product="possible Zinc finger, C3HC4 type (RING finger)"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69398"
FT                   /db_xref="GOA:A2BNN7"
FT                   /db_xref="InterPro:IPR020912"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNN7"
FT                   /protein_id="ABM69398.1"
FT                   IEVEAEEIK"
FT   gene            complement(108836..109750)
FT                   /gene="rbn"
FT                   /locus_tag="A9601_01111"
FT   CDS_pept        complement(108836..109750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="A9601_01111"
FT                   /product="serum resistance locus BrkB-like protein"
FT                   /note="COG1295 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69399"
FT                   /db_xref="GOA:A2BNN8"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNN8"
FT                   /protein_id="ABM69399.1"
FT   gene            complement(109842..110642)
FT                   /locus_tag="A9601_01121"
FT   CDS_pept        complement(109842..110642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01121"
FT                   /product="inositol monophosphate family protein"
FT                   /note="COG483 Archaeal fructose-1,6-bisphosphatase and
FT                   related enzymes of inositol monophosphatase family
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69400"
FT                   /db_xref="GOA:A2BNN9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNN9"
FT                   /protein_id="ABM69400.1"
FT   gene            complement(110645..112072)
FT                   /locus_tag="A9601_01131"
FT   CDS_pept        complement(110645..112072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01131"
FT                   /product="possible RND family outer membrane efflux
FT                   protein"
FT                   /note="COG1538 Outer membrane protein [Cell envelope
FT                   biogenesis, outer membrane / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69401"
FT                   /db_xref="GOA:A2BNP0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNP0"
FT                   /protein_id="ABM69401.1"
FT                   LSSKNTKINNTDSICNI"
FT   gene            complement(112098..113477)
FT                   /locus_tag="A9601_01141"
FT   CDS_pept        complement(112098..113477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01141"
FT                   /product="possible Fe-S oxidoreductase"
FT                   /note="COG1625 Fe-S oxidoreductase, related to NifB/MoaA
FT                   family [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69402"
FT                   /db_xref="GOA:A2BNP1"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017673"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNP1"
FT                   /protein_id="ABM69402.1"
FT                   G"
FT   gene            113656..114423
FT                   /locus_tag="A9601_01151"
FT   CDS_pept        113656..114423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69403"
FT                   /db_xref="GOA:A2BNP2"
FT                   /db_xref="InterPro:IPR021468"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNP2"
FT                   /protein_id="ABM69403.1"
FT   gene            114423..116090
FT                   /gene="nadB"
FT                   /locus_tag="A9601_01161"
FT   CDS_pept        114423..116090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="A9601_01161"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number=""
FT                   /note="COG29 Aspartate oxidase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69404"
FT                   /db_xref="GOA:A2BNP3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNP3"
FT                   /protein_id="ABM69404.1"
FT   gene            complement(116080..117015)
FT                   /locus_tag="A9601_01171"
FT   CDS_pept        complement(116080..117015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01171"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4243 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69405"
FT                   /db_xref="GOA:A2BNP4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNP4"
FT                   /protein_id="ABM69405.1"
FT   gene            117120..118484
FT                   /locus_tag="A9601_01181"
FT   CDS_pept        117120..118484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01181"
FT                   /product="possible Fe-S oxidoreductase"
FT                   /note="COG621 2-methylthioadenine synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69406"
FT                   /db_xref="GOA:A2BNP5"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNP5"
FT                   /protein_id="ABM69406.1"
FT   gene            complement(118489..118599)
FT                   /locus_tag="A9601_01191"
FT   CDS_pept        complement(118489..118599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01191"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69407"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNP6"
FT                   /protein_id="ABM69407.1"
FT   gene            complement(118646..119032)
FT                   /locus_tag="A9601_01201"
FT   CDS_pept        complement(118646..119032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69408"
FT                   /db_xref="InterPro:IPR017260"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNP7"
FT                   /protein_id="ABM69408.1"
FT   gene            complement(119093..120247)
FT                   /locus_tag="A9601_01211"
FT   CDS_pept        complement(119093..120247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01211"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3146 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69409"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNP8"
FT                   /protein_id="ABM69409.1"
FT   gene            complement(120265..120915)
FT                   /locus_tag="A9601_01221"
FT   CDS_pept        complement(120265..120915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01221"
FT                   /product="RibD/ribG C-terminal domain-containing protein"
FT                   /EC_number=""
FT                   /note="COG1985 Pyrimidine reductase, riboflavin
FT                   biosynthesis [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69410"
FT                   /db_xref="GOA:A2BNP9"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNP9"
FT                   /protein_id="ABM69410.1"
FT   gene            complement(120912..121838)
FT                   /locus_tag="A9601_01231"
FT   CDS_pept        complement(120912..121838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01231"
FT                   /product="6-pyruvoyl tetrahydropterin synthase"
FT                   /EC_number=""
FT                   /note="COG720 6-pyruvoyl-tetrahydropterin synthase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69411"
FT                   /db_xref="GOA:A2BNQ0"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNQ0"
FT                   /protein_id="ABM69411.1"
FT   gene            121889..122446
FT                   /gene="aroK"
FT                   /locus_tag="A9601_01241"
FT   CDS_pept        121889..122446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="A9601_01241"
FT                   /product="Shikimate kinase"
FT                   /EC_number=""
FT                   /note="COG703 Shikimate kinase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69412"
FT                   /db_xref="GOA:A2BNQ1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNQ1"
FT                   /protein_id="ABM69412.1"
FT   gene            complement(122443..122700)
FT                   /locus_tag="A9601_01251"
FT   CDS_pept        complement(122443..122700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69413"
FT                   /db_xref="InterPro:IPR021954"
FT                   /db_xref="InterPro:IPR038150"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNQ2"
FT                   /protein_id="ABM69413.1"
FT   gene            122702..123409
FT                   /locus_tag="A9601_01261"
FT   CDS_pept        122702..123409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01261"
FT                   /product="possible POLO box duplicated region"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69414"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNQ3"
FT                   /protein_id="ABM69414.1"
FT                   TNKYKLTFEFIES"
FT   gene            complement(123396..124121)
FT                   /locus_tag="A9601_01271"
FT   CDS_pept        complement(123396..124121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01271"
FT                   /product="putative glutathione S-transferase"
FT                   /EC_number=""
FT                   /note="COG625 Glutathione S-transferase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69415"
FT                   /db_xref="GOA:A2BNQ4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNQ4"
FT                   /protein_id="ABM69415.1"
FT   gene            complement(124148..124330)
FT                   /locus_tag="A9601_01281"
FT   CDS_pept        complement(124148..124330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01281"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69416"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNQ5"
FT                   /protein_id="ABM69416.1"
FT                   LEKNSPISSTNRLLF"
FT   gene            124176..124385
FT                   /locus_tag="A9601_01291"
FT   CDS_pept        124176..124385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69417"
FT                   /db_xref="GOA:A2BNQ6"
FT                   /db_xref="InterPro:IPR008470"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNQ6"
FT                   /protein_id="ABM69417.1"
FT   gene            124385..124777
FT                   /gene="rbfA"
FT                   /locus_tag="A9601_01301"
FT   CDS_pept        124385..124777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="A9601_01301"
FT                   /product="Ribosome-binding factor A"
FT                   /note="COG858 Ribosome-binding factor A [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69418"
FT                   /db_xref="GOA:A2BNQ7"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNQ7"
FT                   /protein_id="ABM69418.1"
FT   gene            124764..125561
FT                   /gene="hemD"
FT                   /locus_tag="A9601_01311"
FT   CDS_pept        124764..125561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="A9601_01311"
FT                   /product="putative uroporphyrinogen III synthase"
FT                   /EC_number=""
FT                   /note="COG1587 Uroporphyrinogen-III synthase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69419"
FT                   /db_xref="GOA:A2BNQ8"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNQ8"
FT                   /protein_id="ABM69419.1"
FT   gene            complement(125554..126024)
FT                   /locus_tag="A9601_01321"
FT   CDS_pept        complement(125554..126024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01321"
FT                   /product="Predicted integral membrane protein"
FT                   /note="COG5637 Predicted integral membrane protein
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69420"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNQ9"
FT                   /protein_id="ABM69420.1"
FT   gene            complement(126028..127482)
FT                   /gene="crtQ"
FT                   /locus_tag="A9601_01331"
FT   CDS_pept        complement(126028..127482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtQ"
FT                   /locus_tag="A9601_01331"
FT                   /product="zeta-carotene desaturase"
FT                   /EC_number=""
FT                   /note="COG3349 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69421"
FT                   /db_xref="GOA:A2BNR0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014103"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNR0"
FT                   /protein_id="ABM69421.1"
FT   gene            127577..127975
FT                   /locus_tag="A9601_01341"
FT   CDS_pept        127577..127975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01341"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG316 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69422"
FT                   /db_xref="GOA:A2BNR1"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNR1"
FT                   /protein_id="ABM69422.1"
FT   gene            127982..128410
FT                   /locus_tag="A9601_01351"
FT   CDS_pept        127982..128410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69423"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNR2"
FT                   /protein_id="ABM69423.1"
FT   gene            128412..129614
FT                   /locus_tag="A9601_01361"
FT   CDS_pept        128412..129614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01361"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG4370 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69424"
FT                   /db_xref="InterPro:IPR019994"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNR3"
FT                   /protein_id="ABM69424.1"
FT                   D"
FT   gene            129607..129876
FT                   /locus_tag="A9601_01371"
FT   CDS_pept        129607..129876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69425"
FT                   /db_xref="GOA:A2BNR4"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNR4"
FT                   /protein_id="ABM69425.1"
FT   gene            complement(129827..130753)
FT                   /locus_tag="A9601_01381"
FT   CDS_pept        complement(129827..130753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01381"
FT                   /product="putative cell division inhibitor"
FT                   /note="COG1090 Predicted nucleoside-diphosphate sugar
FT                   epimerase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69426"
FT                   /db_xref="GOA:A2BNR5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNR5"
FT                   /protein_id="ABM69426.1"
FT   gene            130890..131126
FT                   /locus_tag="A9601_01391"
FT   CDS_pept        130890..131126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69427"
FT                   /db_xref="GOA:A2BNR6"
FT                   /db_xref="InterPro:IPR020905"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNR6"
FT                   /protein_id="ABM69427.1"
FT   gene            complement(131138..131845)
FT                   /locus_tag="A9601_01401"
FT   CDS_pept        complement(131138..131845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01401"
FT                   /product="possible heat shock protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69428"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNR7"
FT                   /protein_id="ABM69428.1"
FT                   QSKMSTEKKNKNF"
FT   gene            complement(131832..132800)
FT                   /locus_tag="A9601_01411"
FT   CDS_pept        complement(131832..132800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01411"
FT                   /product="O-acetylserine (thiol)-lyase A"
FT                   /EC_number=""
FT                   /note="COG31 Cysteine synthase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69429"
FT                   /db_xref="GOA:A2BNR8"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNR8"
FT                   /protein_id="ABM69429.1"
FT   gene            132949..133227
FT                   /locus_tag="A9601_01421"
FT   CDS_pept        132949..133227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01421"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein in cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69430"
FT                   /db_xref="InterPro:IPR020885"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNR9"
FT                   /protein_id="ABM69430.1"
FT   gene            133236..133910
FT                   /locus_tag="A9601_01431"
FT   CDS_pept        133236..133910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01431"
FT                   /product="possible ABC transporter, ATP-binding component"
FT                   /note="COG1122 ABC-type cobalt transport system, ATPase
FT                   component [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69431"
FT                   /db_xref="GOA:A2BNS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNS0"
FT                   /protein_id="ABM69431.1"
FT                   YN"
FT   gene            133960..134031
FT                   /locus_tag="A9601_tRNAAsnVIMSS1309105"
FT                   /note="tRNA-Asn"
FT   tRNA            133960..134031
FT                   /locus_tag="A9601_tRNAAsnVIMSS1309105"
FT                   /product="tRNA-Asn"
FT   gene            complement(134361..134720)
FT                   /locus_tag="A9601_01441"
FT   CDS_pept        complement(134361..134720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01441"
FT                   /product="possible Signal peptide binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69432"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNS1"
FT                   /protein_id="ABM69432.1"
FT                   ERNNLDQEKKDMWDD"
FT   gene            135124..135906
FT                   /gene="rpaA"
FT                   /locus_tag="A9601_01451"
FT   CDS_pept        135124..135906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpaA"
FT                   /locus_tag="A9601_01451"
FT                   /product="two-component response regulator"
FT                   /EC_number=""
FT                   /note="COG745 Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69433"
FT                   /db_xref="GOA:A2BNS2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNS2"
FT                   /protein_id="ABM69433.1"
FT   gene            complement(135909..136871)
FT                   /gene="holB"
FT                   /locus_tag="A9601_01461"
FT   CDS_pept        complement(135909..136871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="A9601_01461"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number=""
FT                   /note="COG470 ATPase involved in DNA replication [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69434"
FT                   /db_xref="GOA:A2BNS3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNS3"
FT                   /protein_id="ABM69434.1"
FT   gene            complement(136868..137506)
FT                   /gene="tmk"
FT                   /locus_tag="A9601_01471"
FT   CDS_pept        complement(136868..137506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="A9601_01471"
FT                   /product="Thymidylate kinase"
FT                   /EC_number=""
FT                   /note="COG125 Thymidylate kinase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69435"
FT                   /db_xref="GOA:A2BNS4"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNS4"
FT                   /protein_id="ABM69435.1"
FT   gene            complement(137507..139801)
FT                   /gene="zntA"
FT                   /locus_tag="A9601_01481"
FT   CDS_pept        complement(137507..139801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zntA"
FT                   /locus_tag="A9601_01481"
FT                   /product="putative P-type ATPase transporter for copper"
FT                   /EC_number=""
FT                   /note="COG2217 Cation transport ATPase [Inorganic ion
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69436"
FT                   /db_xref="GOA:A2BNS5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNS5"
FT                   /protein_id="ABM69436.1"
FT                   ITVVINALSLD"
FT   gene            139924..140445
FT                   /locus_tag="A9601_01491"
FT   CDS_pept        139924..140445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01491"
FT                   /product="cyanobacterial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69437"
FT                   /db_xref="GOA:A2BNS6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022818"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNS6"
FT                   /protein_id="ABM69437.1"
FT                   SGRSSIDIYL"
FT   gene            complement(140451..141803)
FT                   /gene="sms"
FT                   /locus_tag="A9601_01501"
FT   CDS_pept        complement(140451..141803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sms"
FT                   /locus_tag="A9601_01501"
FT                   /product="putative DNA repair protein RadA"
FT                   /note="COG1066 Predicted ATP-dependent serine protease
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69438"
FT                   /db_xref="GOA:A2BNS7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNS7"
FT                   /protein_id="ABM69438.1"
FT   gene            141911..142657
FT                   /locus_tag="A9601_01511"
FT   CDS_pept        141911..142657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01511"
FT                   /product="two-component response regulator"
FT                   /EC_number=""
FT                   /note="COG745 Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69439"
FT                   /db_xref="GOA:A2BNS8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNS8"
FT                   /protein_id="ABM69439.1"
FT   gene            142658..144076
FT                   /gene="plsX"
FT                   /locus_tag="A9601_01521"
FT   CDS_pept        142658..144076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="A9601_01521"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="COG416 Fatty acid/phospholipid biosynthesis enzyme
FT                   [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69440"
FT                   /db_xref="GOA:A2BNS9"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNS9"
FT                   /protein_id="ABM69440.1"
FT                   DNLNQLQKLQVLNS"
FT   gene            144160..145137
FT                   /gene="fabH"
FT                   /locus_tag="A9601_01531"
FT   CDS_pept        144160..145137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="A9601_01531"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number=""
FT                   /note="COG332 3-oxoacyl-[acyl-carrier-protein]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69441"
FT                   /db_xref="GOA:A2BNT0"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNT0"
FT                   /protein_id="ABM69441.1"
FT   gene            145151..146047
FT                   /gene="fabD"
FT                   /locus_tag="A9601_01541"
FT   CDS_pept        145151..146047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="A9601_01541"
FT                   /product="Malonyl coenzyme A-acyl carrier protein
FT                   transacylase"
FT                   /EC_number=""
FT                   /note="COG331 (acyl-carrier-protein) S-malonyltransferase
FT                   [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69442"
FT                   /db_xref="GOA:A2BNT1"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNT1"
FT                   /protein_id="ABM69442.1"
FT                   LKDVKISQVSSSDQISY"
FT   gene            146053..146673
FT                   /locus_tag="A9601_01551"
FT   CDS_pept        146053..146673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01551"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /EC_number=""
FT                   /note="COG204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69443"
FT                   /db_xref="GOA:A2BNT2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNT2"
FT                   /protein_id="ABM69443.1"
FT   gene            complement(146678..147331)
FT                   /locus_tag="A9601_01561"
FT   CDS_pept        complement(146678..147331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01561"
FT                   /product="putative molecular chaperone"
FT                   /note="COG1214 Inactive homolog of metal-dependent
FT                   proteases, putative molecular chaperone [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69444"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNT3"
FT                   /protein_id="ABM69444.1"
FT   gene            complement(147341..147592)
FT                   /gene="ycf34"
FT                   /locus_tag="A9601_01571"
FT   CDS_pept        complement(147341..147592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf34"
FT                   /locus_tag="A9601_01571"
FT                   /product="putative Ycf34"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69445"
FT                   /db_xref="InterPro:IPR019656"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNT4"
FT                   /protein_id="ABM69445.1"
FT   gene            147607..148824
FT                   /locus_tag="A9601_01581"
FT   CDS_pept        147607..148824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01581"
FT                   /product="Poly A polymerase family"
FT                   /EC_number=""
FT                   /note="COG617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69446"
FT                   /db_xref="GOA:A2BNT5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNT5"
FT                   /protein_id="ABM69446.1"
FT                   NAPKCD"
FT   gene            148883..149302
FT                   /locus_tag="A9601_01591"
FT   CDS_pept        148883..149302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01591"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69447"
FT                   /db_xref="GOA:A2BNT6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNT6"
FT                   /protein_id="ABM69447.1"
FT   gene            complement(149303..150211)
FT                   /gene="crtB"
FT                   /gene_synonym="pys"
FT                   /locus_tag="A9601_01601"
FT   CDS_pept        complement(149303..150211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtB"
FT                   /gene_synonym="pys"
FT                   /locus_tag="A9601_01601"
FT                   /product="Squalene and phytoene synthases"
FT                   /EC_number=""
FT                   /note="COG1562 Phytoene/squalene synthetase [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69448"
FT                   /db_xref="GOA:A2BNT7"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNT7"
FT                   /protein_id="ABM69448.1"
FT   gene            complement(150251..151651)
FT                   /gene="pds"
FT                   /locus_tag="A9601_01611"
FT   CDS_pept        complement(150251..151651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pds"
FT                   /locus_tag="A9601_01611"
FT                   /product="phytoene desaturase"
FT                   /EC_number=""
FT                   /note="COG3349 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69449"
FT                   /db_xref="GOA:A2BNT8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014102"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNT8"
FT                   /protein_id="ABM69449.1"
FT                   KIPQNVSA"
FT   gene            151742..152089
FT                   /locus_tag="A9601_01621"
FT   CDS_pept        151742..152089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01621"
FT                   /product="NADH dehydrogenase I subunit M"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69450"
FT                   /db_xref="GOA:A2BNT9"
FT                   /db_xref="InterPro:IPR018922"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNT9"
FT                   /protein_id="ABM69450.1"
FT                   SMGLPKTNEVL"
FT   gene            152086..152709
FT                   /locus_tag="A9601_01631"
FT   CDS_pept        152086..152709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69451"
FT                   /db_xref="GOA:A2BNU0"
FT                   /db_xref="InterPro:IPR021511"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNU0"
FT                   /protein_id="ABM69451.1"
FT   gene            complement(152714..153658)
FT                   /gene="rbcR"
FT                   /locus_tag="A9601_01641"
FT   CDS_pept        complement(152714..153658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcR"
FT                   /locus_tag="A9601_01641"
FT                   /product="putative Rubisco transcriptional regulator"
FT                   /note="COG583 Transcriptional regulator [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69452"
FT                   /db_xref="GOA:A2BNU1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNU1"
FT                   /protein_id="ABM69452.1"
FT   gene            153742..154470
FT                   /locus_tag="A9601_01651"
FT   CDS_pept        153742..154470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01651"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4094 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69453"
FT                   /db_xref="GOA:A2BNU2"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNU2"
FT                   /protein_id="ABM69453.1"
FT   gene            154504..156516
FT                   /gene="ndhF"
FT                   /locus_tag="A9601_01661"
FT   CDS_pept        154504..156516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /locus_tag="A9601_01661"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 5)"
FT                   /EC_number=""
FT                   /note="COG1009 NADH:ubiquinone oxidoreductase subunit 5
FT                   (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit
FT                   [Energy production and conversion / Inorganic ion transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69454"
FT                   /db_xref="GOA:A2BNU3"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR002128"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNU3"
FT                   /protein_id="ABM69454.1"
FT   gene            156647..158251
FT                   /locus_tag="A9601_01671"
FT   CDS_pept        156647..158251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01671"
FT                   /product="putative NADH dehydrogenase subunit (chain 4)"
FT                   /EC_number=""
FT                   /note="COG1008 NADH:ubiquinone oxidoreductase subunit 4
FT                   (chain M) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69455"
FT                   /db_xref="GOA:A2BNU4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNU4"
FT                   /protein_id="ABM69455.1"
FT                   NIFSGTKKNDILKAPTI"
FT   gene            158375..159196
FT                   /locus_tag="A9601_01681"
FT   CDS_pept        158375..159196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01681"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG1354 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69456"
FT                   /db_xref="GOA:A2BNU5"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNU5"
FT                   /protein_id="ABM69456.1"
FT   gene            159244..160422
FT                   /locus_tag="A9601_01691"
FT   CDS_pept        159244..160422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01691"
FT                   /product="Putative sugar-phosphate nucleotidyl transferase"
FT                   /EC_number=""
FT                   /note="COG1208 Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B,
FT                   gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell
FT                   envelope biogenesis, outer membrane / Translation,
FT                   ribosomal structure an"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69457"
FT                   /db_xref="GOA:A2BNU6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037538"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNU6"
FT                   /protein_id="ABM69457.1"
FT   gene            complement(160406..161296)
FT                   /gene="metF"
FT                   /locus_tag="A9601_01701"
FT   CDS_pept        complement(160406..161296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="A9601_01701"
FT                   /product="Methylenetetrahydrofolate reductase"
FT                   /note="COG685 5,10-methylenetetrahydrofolate reductase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69458"
FT                   /db_xref="GOA:A2BNU7"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNU7"
FT                   /protein_id="ABM69458.1"
FT                   LIPEIIEKANLSLEY"
FT   gene            161374..161652
FT                   /gene="csgD"
FT                   /locus_tag="A9601_01711"
FT   CDS_pept        161374..161652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgD"
FT                   /locus_tag="A9601_01711"
FT                   /product="Bacterial regulatory protein, LuxR family"
FT                   /note="COG2771 DNA-binding HTH domain-containing proteins
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69459"
FT                   /db_xref="GOA:A2BNU8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNU8"
FT                   /protein_id="ABM69459.1"
FT   gene            complement(161615..161803)
FT                   /locus_tag="A9601_01721"
FT   CDS_pept        complement(161615..161803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01721"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69460"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNU9"
FT                   /protein_id="ABM69460.1"
FT                   KVKSNTNLDQSLGVYNN"
FT   gene            complement(161894..162367)
FT                   /locus_tag="A9601_01731"
FT   CDS_pept        complement(161894..162367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01731"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG2954 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69461"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNV0"
FT                   /protein_id="ABM69461.1"
FT   gene            complement(162368..163279)
FT                   /locus_tag="A9601_01741"
FT   CDS_pept        complement(162368..163279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01741"
FT                   /product="predicted inorganic polyphosphate / ATP-NAD+
FT                   kinase"
FT                   /EC_number=""
FT                   /note="COG61 Predicted sugar kinase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69462"
FT                   /db_xref="GOA:A2BNV1"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNV1"
FT                   /protein_id="ABM69462.1"
FT   gene            complement(163289..163612)
FT                   /gene="ndhE"
FT                   /locus_tag="A9601_01751"
FT   CDS_pept        complement(163289..163612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhE"
FT                   /locus_tag="A9601_01751"
FT                   /product="putative NADH Dehydrogenase subunit"
FT                   /EC_number=""
FT                   /note="COG713 NADH:ubiquinone oxidoreductase subunit 11 or
FT                   4L (chain K) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69463"
FT                   /db_xref="GOA:A2BNV2"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNV2"
FT                   /protein_id="ABM69463.1"
FT                   LKW"
FT   gene            complement(163628..164227)
FT                   /gene="ndhG"
FT                   /locus_tag="A9601_01761"
FT   CDS_pept        complement(163628..164227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhG"
FT                   /locus_tag="A9601_01761"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 6)"
FT                   /EC_number=""
FT                   /note="COG839 NADH:ubiquinone oxidoreductase subunit 6
FT                   (chain J) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69464"
FT                   /db_xref="GOA:A2BNV3"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNV3"
FT                   /protein_id="ABM69464.1"
FT   gene            complement(164241..164867)
FT                   /gene="ndhI"
FT                   /locus_tag="A9601_01771"
FT   CDS_pept        complement(164241..164867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhI"
FT                   /locus_tag="A9601_01771"
FT                   /product="putative NADH Dehydrogenase subunit"
FT                   /EC_number=""
FT                   /note="COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69465"
FT                   /db_xref="GOA:A2BNV4"
FT                   /db_xref="InterPro:IPR004497"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNV4"
FT                   /protein_id="ABM69465.1"
FT   gene            complement(164936..166054)
FT                   /gene="ndhA"
FT                   /locus_tag="A9601_01781"
FT   CDS_pept        complement(164936..166054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhA"
FT                   /locus_tag="A9601_01781"
FT                   /product="putative respiratory-chain NADH dehydrogenase
FT                   subunit"
FT                   /EC_number=""
FT                   /note="COG1005 NADH:ubiquinone oxidoreductase subunit 1
FT                   (chain H) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69466"
FT                   /db_xref="GOA:A2BNV5"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNV5"
FT                   /protein_id="ABM69466.1"
FT   gene            complement(166130..167275)
FT                   /gene="gltA"
FT                   /locus_tag="A9601_01791"
FT   CDS_pept        complement(166130..167275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="A9601_01791"
FT                   /product="Citrate synthase"
FT                   /EC_number=""
FT                   /note="COG372 Citrate synthase [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69467"
FT                   /db_xref="GOA:A2BNV6"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNV6"
FT                   /protein_id="ABM69467.1"
FT   gene            complement(167401..168861)
FT                   /locus_tag="A9601_01801"
FT   CDS_pept        complement(167401..168861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01801"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69468"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNV7"
FT                   /protein_id="ABM69468.1"
FT   gene            168951..169301
FT                   /gene="pspE"
FT                   /locus_tag="A9601_01811"
FT   CDS_pept        168951..169301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspE"
FT                   /locus_tag="A9601_01811"
FT                   /product="Rhodanese-like"
FT                   /note="COG607 Rhodanese-related sulfurtransferase
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69469"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNV8"
FT                   /protein_id="ABM69469.1"
FT                   WSRYIDPSIPRY"
FT   gene            complement(169302..170546)
FT                   /gene="trpB"
FT                   /locus_tag="A9601_01821"
FT   CDS_pept        complement(169302..170546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="A9601_01821"
FT                   /product="Tryptophan synthase subunit beta"
FT                   /EC_number=""
FT                   /note="COG133 Tryptophan synthase beta chain [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69470"
FT                   /db_xref="GOA:A2BNV9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNV9"
FT                   /protein_id="ABM69470.1"
FT                   RGDKDVNTVASSLDI"
FT   gene            170586..170906
FT                   /gene="sui1"
FT                   /locus_tag="A9601_01831"
FT   CDS_pept        170586..170906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sui1"
FT                   /locus_tag="A9601_01831"
FT                   /product="Translation initiation factor SUI1"
FT                   /note="COG23 Translation initiation factor 1 (eIF-1/SUI1)
FT                   and related proteins [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69471"
FT                   /db_xref="GOA:A2BNW0"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNW0"
FT                   /protein_id="ABM69471.1"
FT                   NL"
FT   gene            170949..171572
FT                   /gene="cysC"
FT                   /locus_tag="A9601_01841"
FT   CDS_pept        170949..171572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="A9601_01841"
FT                   /product="Adenylylsulfate kinase"
FT                   /EC_number=""
FT                   /note="COG529 Adenylylsulfate kinase and related kinases
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69472"
FT                   /db_xref="GOA:A2BNW1"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNW1"
FT                   /protein_id="ABM69472.1"
FT   gene            complement(171588..172079)
FT                   /gene="purE"
FT                   /locus_tag="A9601_01851"
FT   CDS_pept        complement(171588..172079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="A9601_01851"
FT                   /product="Phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number=""
FT                   /note="COG41 Phosphoribosylcarboxyaminoimidazole (NCAIR)
FT                   mutase [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69473"
FT                   /db_xref="GOA:A2BNW2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNW2"
FT                   /protein_id="ABM69473.1"
FT                   "
FT   gene            172214..172915
FT                   /gene="chlM"
FT                   /locus_tag="A9601_01861"
FT   CDS_pept        172214..172915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlM"
FT                   /locus_tag="A9601_01861"
FT                   /product="Mg-protoporphyrin IX methyltransferase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG2227
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol
FT                   methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69474"
FT                   /db_xref="GOA:A2BNW3"
FT                   /db_xref="InterPro:IPR010251"
FT                   /db_xref="InterPro:IPR010940"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNW3"
FT                   /protein_id="ABM69474.1"
FT                   FSKLIEFEKIK"
FT   gene            complement(172917..173645)
FT                   /locus_tag="A9601_01871"
FT   CDS_pept        complement(172917..173645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01871"
FT                   /product="two-component response regulator"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain [Signal
FT                   transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69475"
FT                   /db_xref="GOA:A2BNW4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNW4"
FT                   /protein_id="ABM69475.1"
FT   gene            173705..174850
FT                   /locus_tag="A9601_01881"
FT   CDS_pept        173705..174850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01881"
FT                   /product="NifS-like aminotransferase class-V"
FT                   /EC_number=""
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69476"
FT                   /db_xref="GOA:A2BNW5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNW5"
FT                   /protein_id="ABM69476.1"
FT   gene            complement(174865..175767)
FT                   /locus_tag="A9601_01891"
FT   CDS_pept        complement(174865..175767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01891"
FT                   /product="Predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="COG275 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis
FT                   [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69477"
FT                   /db_xref="GOA:A2BNW6"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNW6"
FT                   /protein_id="ABM69477.1"
FT   gene            175806..176993
FT                   /gene="ndhH"
FT                   /locus_tag="A9601_01901"
FT   CDS_pept        175806..176993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhH"
FT                   /locus_tag="A9601_01901"
FT                   /product="putative NADH dehydrogenase subunit"
FT                   /EC_number=""
FT                   /note="COG649 NADH:ubiquinone oxidoreductase 49 kD subunit
FT                   7 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69478"
FT                   /db_xref="GOA:A2BNW7"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNW7"
FT                   /protein_id="ABM69478.1"
FT   gene            177003..177455
FT                   /locus_tag="A9601_01911"
FT   CDS_pept        177003..177455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01911"
FT                   /product="Predicted thioesterase"
FT                   /note="COG824 Predicted thioesterase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69479"
FT                   /db_xref="GOA:A2BNW8"
FT                   /db_xref="InterPro:IPR022829"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNW8"
FT                   /protein_id="ABM69479.1"
FT   gene            complement(177459..178661)
FT                   /gene="menE"
FT                   /locus_tag="A9601_01921"
FT   CDS_pept        complement(177459..178661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="A9601_01921"
FT                   /product="probable O-succinylbenzoic acid--CoA ligase
FT                   (OSB-CoA synthetase)"
FT                   /EC_number=""
FT                   /note="COG318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II [Lipid metabolism / Secondary metabolites
FT                   biosynthesis, transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69480"
FT                   /db_xref="GOA:A2BNW9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNW9"
FT                   /protein_id="ABM69480.1"
FT                   K"
FT   gene            complement(178658..179623)
FT                   /gene="menC"
FT                   /locus_tag="A9601_01931"
FT   CDS_pept        complement(178658..179623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="A9601_01931"
FT                   /product="putative O-succinylbenzoate synthase"
FT                   /EC_number=""
FT                   /note="COG4948 L-alanine-DL-glutamate epimerase and related
FT                   enzymes of enolase superfamily [Cell envelope biogenesis,
FT                   outer membrane / General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69481"
FT                   /db_xref="GOA:A2BNX0"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNX0"
FT                   /protein_id="ABM69481.1"
FT   gene            complement(179620..180537)
FT                   /gene="menA"
FT                   /locus_tag="A9601_01941"
FT   CDS_pept        complement(179620..180537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="A9601_01941"
FT                   /product="1,4-dihydroxy-2-naphthoate (DHNA)
FT                   octaprenyltransferase"
FT                   /note="UbiA prenyltranferase family; COG1575
FT                   1,4-dihydroxy-2-naphthoate octaprenyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69482"
FT                   /db_xref="GOA:A2BNX1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR011937"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNX1"
FT                   /protein_id="ABM69482.1"
FT   gene            180639..182051
FT                   /gene="menF"
FT                   /locus_tag="A9601_01951"
FT   CDS_pept        180639..182051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="A9601_01951"
FT                   /product="Isochorismate synthase"
FT                   /EC_number=""
FT                   /note="COG1169 Isochorismate synthase [Coenzyme metabolism
FT                   / Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69483"
FT                   /db_xref="GOA:A2BNX2"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNX2"
FT                   /protein_id="ABM69483.1"
FT                   IVKQIFCAKNPR"
FT   gene            complement(182044..182967)
FT                   /gene="gshB"
FT                   /locus_tag="A9601_01961"
FT   CDS_pept        complement(182044..182967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="A9601_01961"
FT                   /product="putative Glutathione synthetase"
FT                   /EC_number=""
FT                   /note="COG189 Glutathione synthase/Ribosomal protein S6
FT                   modification enzyme (glutaminyl transferase) [Coenzyme
FT                   metabolism / Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69484"
FT                   /db_xref="GOA:A2BNX3"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNX3"
FT                   /protein_id="ABM69484.1"
FT   gene            complement(182973..183227)
FT                   /gene="grxC"
FT                   /locus_tag="A9601_01971"
FT   CDS_pept        complement(182973..183227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="A9601_01971"
FT                   /product="Glutaredoxin"
FT                   /EC_number=""
FT                   /note="COG695 Glutaredoxin and related proteins
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69485"
FT                   /db_xref="GOA:A2BNX4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNX4"
FT                   /protein_id="ABM69485.1"
FT   gene            183362..184426
FT                   /gene="prfB"
FT                   /locus_tag="A9601_01981"
FT   CDS_pept        183362..184426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="A9601_01981"
FT                   /product="peptide chain release factor RF-2"
FT                   /note="COG1186 Protein chain release factor B [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69486"
FT                   /db_xref="GOA:A2BNX5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNX5"
FT                   /protein_id="ABM69486.1"
FT                   ELLRMNISSNESIE"
FT   gene            184430..184612
FT                   /locus_tag="A9601_01991"
FT   CDS_pept        184430..184612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_01991"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_01991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69487"
FT                   /db_xref="GOA:A2BNX6"
FT                   /db_xref="InterPro:IPR021702"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNX6"
FT                   /protein_id="ABM69487.1"
FT                   ILILVATIGKPNIPV"
FT   gene            184619..185158
FT                   /locus_tag="A9601_02001"
FT   CDS_pept        184619..185158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02001"
FT                   /product="Predicted metal-dependent hydrolase"
FT                   /note="COG319 Predicted metal-dependent hydrolase [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69488"
FT                   /db_xref="GOA:A2BNX7"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNX7"
FT                   /protein_id="ABM69488.1"
FT                   LENMLNFQEYLITRLD"
FT   gene            185165..185575
FT                   /gene="dgkA"
FT                   /locus_tag="A9601_02011"
FT   CDS_pept        185165..185575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="A9601_02011"
FT                   /product="Prokaryotic diacylglycerol kinase"
FT                   /EC_number=""
FT                   /note="COG818 Diacylglycerol kinase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69489"
FT                   /db_xref="GOA:A2BNX8"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNX8"
FT                   /protein_id="ABM69489.1"
FT   gene            185588..186184
FT                   /gene="pabA"
FT                   /locus_tag="A9601_02021"
FT   CDS_pept        185588..186184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="A9601_02021"
FT                   /product="para-aminobenzoate synthase component II"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG512 Anthranilate/para-aminobenzoate synthases
FT                   component II [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69490"
FT                   /db_xref="GOA:A2BNX9"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNX9"
FT                   /protein_id="ABM69490.1"
FT   gene            186204..186929
FT                   /locus_tag="A9601_02031"
FT   CDS_pept        186204..186929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02031"
FT                   /product="Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold"
FT                   /note="COG2220 Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69491"
FT                   /db_xref="GOA:A2BNY0"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNY0"
FT                   /protein_id="ABM69491.1"
FT   gene            complement(186926..188035)
FT                   /locus_tag="A9601_02041"
FT   CDS_pept        complement(186926..188035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02041"
FT                   /product="Aminotransferases class-I"
FT                   /EC_number=""
FT                   /note="COG79 Histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69492"
FT                   /db_xref="GOA:A2BNY1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNY1"
FT                   /protein_id="ABM69492.1"
FT   gene            complement(188035..189849)
FT                   /gene="argS"
FT                   /locus_tag="A9601_02051"
FT   CDS_pept        complement(188035..189849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="A9601_02051"
FT                   /product="Arginyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG18 Arginyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69493"
FT                   /db_xref="GOA:A2BNY2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNY2"
FT                   /protein_id="ABM69493.1"
FT   gene            complement(189877..190743)
FT                   /gene="nadC"
FT                   /locus_tag="A9601_02061"
FT   CDS_pept        complement(189877..190743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="A9601_02061"
FT                   /product="Nicotinate-nucleotide
FT                   pyrophosphorylase:Quinolinate phosphoriobsyl transferase"
FT                   /EC_number=""
FT                   /note="COG157 Nicotinate-nucleotide pyrophosphorylase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69494"
FT                   /db_xref="GOA:A2BNY3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNY3"
FT                   /protein_id="ABM69494.1"
FT                   LSMRYIN"
FT   gene            complement(190826..192208)
FT                   /gene="thdF"
FT                   /locus_tag="A9601_02071"
FT   CDS_pept        complement(190826..192208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thdF"
FT                   /locus_tag="A9601_02071"
FT                   /product="putative thiophen / furan oxidation protein"
FT                   /note="COG486 Predicted GTPase [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69495"
FT                   /db_xref="GOA:A2BNY4"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNY4"
FT                   /protein_id="ABM69495.1"
FT                   GK"
FT   gene            192275..192718
FT                   /locus_tag="A9601_02081"
FT   CDS_pept        192275..192718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02081"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3216 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69496"
FT                   /db_xref="GOA:A2BNY5"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNY5"
FT                   /protein_id="ABM69496.1"
FT   gene            complement(192737..195046)
FT                   /gene="spoT"
FT                   /locus_tag="A9601_02091"
FT   CDS_pept        complement(192737..195046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="A9601_02091"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-diphosphatase, (ppGpp)ase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases [Signal transduction
FT                   mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69497"
FT                   /db_xref="GOA:A2BNY6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNY6"
FT                   /protein_id="ABM69497.1"
FT                   IKSMADVLDIARVGQS"
FT   gene            195101..196699
FT                   /locus_tag="A9601_02101"
FT   CDS_pept        195101..196699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02101"
FT                   /product="ABC transporter, ATP binding component, possibly
FT                   for oligopeptides"
FT                   /note="COG1123 ATPase components of various ABC-type
FT                   transport systems, contain duplicated ATPase [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69498"
FT                   /db_xref="GOA:A2BNY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNY7"
FT                   /protein_id="ABM69498.1"
FT                   NTYTKSLLNSSLNLI"
FT   gene            complement(196692..197651)
FT                   /gene="rluD"
FT                   /locus_tag="A9601_02111"
FT   CDS_pept        complement(196692..197651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="A9601_02111"
FT                   /product="putative pseudouridylate synthase specific to
FT                   ribosomal large subunit"
FT                   /EC_number=""
FT                   /note="COG564 Pseudouridylate synthases, 23S RNA-specific
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69499"
FT                   /db_xref="GOA:A2BNY8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNY8"
FT                   /protein_id="ABM69499.1"
FT   gene            complement(197642..198514)
FT                   /locus_tag="A9601_02121"
FT   CDS_pept        complement(197642..198514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02121"
FT                   /product="Predicted GTPases"
FT                   /note="COG1161 Predicted GTPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69500"
FT                   /db_xref="GOA:A2BNY9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNY9"
FT                   /protein_id="ABM69500.1"
FT                   IALEVPLWN"
FT   gene            198727..199935
FT                   /gene="pgk"
FT                   /locus_tag="A9601_02131"
FT   CDS_pept        198727..199935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="A9601_02131"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number=""
FT                   /note="COG126 3-phosphoglycerate kinase [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69501"
FT                   /db_xref="GOA:A2BNZ0"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNZ0"
FT                   /protein_id="ABM69501.1"
FT                   NDA"
FT   gene            complement(199937..200662)
FT                   /locus_tag="A9601_02141"
FT   CDS_pept        complement(199937..200662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69502"
FT                   /db_xref="GOA:A2BNZ1"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNZ1"
FT                   /protein_id="ABM69502.1"
FT   gene            200704..201795
FT                   /gene="murG"
FT                   /locus_tag="A9601_02151"
FT   CDS_pept        200704..201795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="A9601_02151"
FT                   /product="Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc
FT                   GlcNAc transferase"
FT                   /EC_number=""
FT                   /note="COG707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase [Cell envelope biogenesis,
FT                   outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69503"
FT                   /db_xref="GOA:A2BNZ2"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNZ2"
FT                   /protein_id="ABM69503.1"
FT   gene            complement(201774..202895)
FT                   /locus_tag="A9601_02161"
FT   CDS_pept        complement(201774..202895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02161"
FT                   /product="Aminotransferases class-I"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG79 Histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69504"
FT                   /db_xref="GOA:A2BNZ3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNZ3"
FT                   /protein_id="ABM69504.1"
FT   gene            complement(202905..204074)
FT                   /gene="pyrD"
FT                   /locus_tag="A9601_02171"
FT   CDS_pept        complement(202905..204074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="A9601_02171"
FT                   /product="Dihydroorotate dehydrogenase"
FT                   /EC_number=""
FT                   /note="COG167 Dihydroorotate dehydrogenase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69505"
FT                   /db_xref="GOA:A2BNZ4"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNZ4"
FT                   /protein_id="ABM69505.1"
FT   gene            complement(204081..204800)
FT                   /gene="rnhA"
FT                   /locus_tag="A9601_02181"
FT   CDS_pept        complement(204081..204800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="A9601_02181"
FT                   /product="possible ribonuclease HI"
FT                   /EC_number=""
FT                   /note="COG328 Ribonuclease HI [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69506"
FT                   /db_xref="GOA:A2BNZ5"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2BNZ5"
FT                   /protein_id="ABM69506.1"
FT                   ILIPKDKKYWIIEKKEA"
FT   gene            complement(204848..205243)
FT                   /gene="rplL"
FT                   /locus_tag="A9601_02191"
FT   CDS_pept        complement(204848..205243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="A9601_02191"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="COG222 Ribosomal protein L7/L12 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69507"
FT                   /db_xref="GOA:A2BNZ6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNZ6"
FT                   /protein_id="ABM69507.1"
FT   gene            complement(205272..205799)
FT                   /gene="rplJ"
FT                   /locus_tag="A9601_02201"
FT   CDS_pept        complement(205272..205799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="A9601_02201"
FT                   /product="50S ribosomal protein L10"
FT                   /note="COG244 Ribosomal protein L10 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69508"
FT                   /db_xref="GOA:A2BNZ7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNZ7"
FT                   /protein_id="ABM69508.1"
FT                   RSLKQHSEKSES"
FT   gene            complement(205990..206697)
FT                   /gene="rplA"
FT                   /locus_tag="A9601_02211"
FT   CDS_pept        complement(205990..206697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="A9601_02211"
FT                   /product="50S ribosomal protein L1"
FT                   /note="COG81 Ribosomal protein L1 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69509"
FT                   /db_xref="GOA:A2BNZ8"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNZ8"
FT                   /protein_id="ABM69509.1"
FT                   LDINAVQDYQPEG"
FT   gene            complement(206764..207189)
FT                   /gene="rplK"
FT                   /locus_tag="A9601_02221"
FT   CDS_pept        complement(206764..207189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="A9601_02221"
FT                   /product="50S ribosomal protein L11"
FT                   /note="COG80 Ribosomal protein L11 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69510"
FT                   /db_xref="GOA:A2BNZ9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BNZ9"
FT                   /protein_id="ABM69510.1"
FT   gene            complement(207257..207868)
FT                   /gene="nusG"
FT                   /locus_tag="A9601_02231"
FT   CDS_pept        complement(207257..207868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="A9601_02231"
FT                   /product="transcription antitermination protein, NusG"
FT                   /note="COG250 Transcription antiterminator [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69511"
FT                   /db_xref="GOA:A2BP00"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP00"
FT                   /protein_id="ABM69511.1"
FT   gene            complement(207920..208162)
FT                   /gene="secE"
FT                   /locus_tag="A9601_02241"
FT   CDS_pept        complement(207920..208162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="A9601_02241"
FT                   /product="putative preprotein translocase, SecE subunit"
FT                   /note="COG690 Preprotein translocase subunit SecE
FT                   [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69512"
FT                   /db_xref="GOA:A2BP01"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP01"
FT                   /protein_id="ABM69512.1"
FT   gene            complement(208224..210986)
FT                   /gene="clpB2"
FT                   /locus_tag="A9601_02251"
FT   CDS_pept        complement(208224..210986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB2"
FT                   /locus_tag="A9601_02251"
FT                   /product="putative ATP-dependent Clp protease, Hsp 100,
FT                   ATP-binding subunit ClpB"
FT                   /EC_number=""
FT                   /note="COG542 ATPases with chaperone activity, ATP-binding
FT                   subunit [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69513"
FT                   /db_xref="GOA:A2BP02"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP02"
FT                   /protein_id="ABM69513.1"
FT   gene            211249..212541
FT                   /gene="eno"
FT                   /locus_tag="A9601_02261"
FT   CDS_pept        211249..212541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="A9601_02261"
FT                   /product="Enolase"
FT                   /EC_number=""
FT                   /note="COG148 Enolase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69514"
FT                   /db_xref="GOA:A2BP03"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP03"
FT                   /protein_id="ABM69514.1"
FT   gene            complement(212547..214214)
FT                   /locus_tag="A9601_02271"
FT   CDS_pept        complement(212547..214214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02271"
FT                   /product="possible kinase"
FT                   /note="COG661 Predicted unusual protein kinase [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69515"
FT                   /db_xref="GOA:A2BP04"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP04"
FT                   /protein_id="ABM69515.1"
FT   gene            complement(214211..214528)
FT                   /locus_tag="A9601_02281"
FT   CDS_pept        complement(214211..214528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02281"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69516"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP05"
FT                   /protein_id="ABM69516.1"
FT                   K"
FT   gene            214785..215741
FT                   /locus_tag="A9601_02291"
FT   CDS_pept        214785..215741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02291"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /EC_number=""
FT                   /note="COG492 Thioredoxin reductase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69517"
FT                   /db_xref="GOA:A2BP06"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP06"
FT                   /protein_id="ABM69517.1"
FT   gene            complement(215763..216044)
FT                   /locus_tag="A9601_02301"
FT   CDS_pept        complement(215763..216044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69518"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP07"
FT                   /protein_id="ABM69518.1"
FT   gene            complement(216047..217045)
FT                   /locus_tag="A9601_02311"
FT   CDS_pept        complement(216047..217045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02311"
FT                   /product="putative sodium-dependent bicarbonate
FT                   transporter"
FT                   /note="COG3329 Predicted permease [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69519"
FT                   /db_xref="GOA:A2BP08"
FT                   /db_xref="InterPro:IPR010293"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP08"
FT                   /protein_id="ABM69519.1"
FT   gene            216900..217055
FT                   /locus_tag="A9601_02321"
FT   CDS_pept        216900..217055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02321"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69520"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP09"
FT                   /protein_id="ABM69520.1"
FT                   LISINY"
FT   gene            complement(217052..218704)
FT                   /locus_tag="A9601_02331"
FT   CDS_pept        complement(217052..218704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02331"
FT                   /product="putative sulfate transporter"
FT                   /note="COG659 Sulfate permease and related transporters
FT                   (MFS superfamily) [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69521"
FT                   /db_xref="GOA:A2BP10"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP10"
FT                   /protein_id="ABM69521.1"
FT   gene            complement(218733..218927)
FT                   /locus_tag="A9601_02341"
FT   CDS_pept        complement(218733..218927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02341"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69522"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP11"
FT                   /protein_id="ABM69522.1"
FT   gene            218928..219929
FT                   /gene="hemB"
FT                   /locus_tag="A9601_02351"
FT   CDS_pept        218928..219929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="A9601_02351"
FT                   /product="Delta-aminolevulinic acid dehydratase"
FT                   /EC_number=""
FT                   /note="COG113 Delta-aminolevulinic acid dehydratase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69523"
FT                   /db_xref="GOA:A2BP12"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP12"
FT                   /protein_id="ABM69523.1"
FT   gene            219992..220378
FT                   /locus_tag="A9601_02361"
FT   CDS_pept        219992..220378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02361"
FT                   /product="Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69524"
FT                   /db_xref="GOA:A2BP13"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP13"
FT                   /protein_id="ABM69524.1"
FT   gene            220393..222804
FT                   /locus_tag="A9601_02371"
FT   CDS_pept        220393..222804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02371"
FT                   /product="putative DNA mismatch repair protein MutS family"
FT                   /note="COG1193 Mismatch repair ATPase (MutS family) [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69525"
FT                   /db_xref="GOA:A2BP14"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP14"
FT                   /protein_id="ABM69525.1"
FT   gene            222845..223828
FT                   /gene="obg"
FT                   /locus_tag="A9601_02381"
FT   CDS_pept        222845..223828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obg"
FT                   /locus_tag="A9601_02381"
FT                   /product="GTP1/OBG family"
FT                   /note="COG536 Predicted GTPase [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69526"
FT                   /db_xref="GOA:A2BP15"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP15"
FT                   /protein_id="ABM69526.1"
FT   gene            223914..224096
FT                   /locus_tag="A9601_02391"
FT   CDS_pept        223914..224096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69527"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP16"
FT                   /protein_id="ABM69527.1"
FT                   VCSLTGSPSDFNRDY"
FT   gene            complement(224166..224384)
FT                   /locus_tag="A9601_02401"
FT   CDS_pept        complement(224166..224384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02401"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69528"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP17"
FT                   /protein_id="ABM69528.1"
FT   gene            complement(224516..225460)
FT                   /gene="ecm4"
FT                   /locus_tag="A9601_02411"
FT   CDS_pept        complement(224516..225460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecm4"
FT                   /locus_tag="A9601_02411"
FT                   /product="Glutathione S-transferase C terminus"
FT                   /note="COG435 Predicted glutathione S-transferase
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69529"
FT                   /db_xref="GOA:A2BP18"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP18"
FT                   /protein_id="ABM69529.1"
FT   gene            225484..226389
FT                   /gene="aspA"
FT                   /locus_tag="A9601_02421"
FT   CDS_pept        225484..226389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="A9601_02421"
FT                   /product="putative aspartoacylase"
FT                   /note="COG2988 Succinylglutamate desuccinylase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69530"
FT                   /db_xref="GOA:A2BP19"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP19"
FT                   /protein_id="ABM69530.1"
FT   gene            complement(226507..226635)
FT                   /locus_tag="A9601_02431"
FT   CDS_pept        complement(226507..226635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02431"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69531"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP20"
FT                   /protein_id="ABM69531.1"
FT   gene            226824..227906
FT                   /gene="psbA"
FT                   /locus_tag="A9601_02441"
FT   CDS_pept        226824..227906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbA"
FT                   /locus_tag="A9601_02441"
FT                   /product="Photosystem II PsbA protein (D1)"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69532"
FT                   /db_xref="GOA:A2BP21"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP21"
FT                   /protein_id="ABM69532.1"
FT   gene            228016..229113
FT                   /gene="aroC"
FT                   /locus_tag="A9601_02451"
FT   CDS_pept        228016..229113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="A9601_02451"
FT                   /product="Chorismate synthase"
FT                   /EC_number=""
FT                   /note="COG82 Chorismate synthase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69533"
FT                   /db_xref="GOA:A2BP22"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP22"
FT                   /protein_id="ABM69533.1"
FT   gene            complement(229148..229774)
FT                   /gene="eda"
FT                   /locus_tag="A9601_02461"
FT   CDS_pept        complement(229148..229774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="A9601_02461"
FT                   /product="possible 2-keto-3-deoxy-6-phosphogluconate
FT                   aldolase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG800 2-keto-3-deoxy-6-phosphogluconate aldolase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69534"
FT                   /db_xref="GOA:A2BP23"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP23"
FT                   /protein_id="ABM69534.1"
FT   gene            complement(229796..231649)
FT                   /locus_tag="A9601_02471"
FT   CDS_pept        complement(229796..231649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02471"
FT                   /product="cell division protein FtsH2"
FT                   /note="COG465 ATP-dependent Zn proteases [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69535"
FT                   /db_xref="GOA:A2BP24"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP24"
FT                   /protein_id="ABM69535.1"
FT   gene            complement(231696..232871)
FT                   /gene="met3"
FT                   /locus_tag="A9601_02481"
FT   CDS_pept        complement(231696..232871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="met3"
FT                   /locus_tag="A9601_02481"
FT                   /product="ATP-sulfurylase"
FT                   /EC_number=""
FT                   /note="COG2046 ATP sulfurylase (sulfate
FT                   adenylyltransferase) [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69536"
FT                   /db_xref="GOA:A2BP25"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP25"
FT                   /protein_id="ABM69536.1"
FT   gene            complement(232944..233783)
FT                   /gene="psbO"
FT                   /locus_tag="A9601_02491"
FT   CDS_pept        complement(232944..233783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbO"
FT                   /locus_tag="A9601_02491"
FT                   /product="Photosystem II manganese-stabilizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69537"
FT                   /db_xref="GOA:A2BP26"
FT                   /db_xref="InterPro:IPR002628"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP26"
FT                   /protein_id="ABM69537.1"
FT   gene            complement(233956..235212)
FT                   /gene="dfp"
FT                   /locus_tag="A9601_02501"
FT   CDS_pept        complement(233956..235212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="A9601_02501"
FT                   /product="putative p-pantothenate cysteine ligase and
FT                   p-pantothenenoylcysteine decarboxylase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG452 Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69538"
FT                   /db_xref="GOA:A2BP27"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP27"
FT                   /protein_id="ABM69538.1"
FT   gene            complement(235202..235423)
FT                   /locus_tag="A9601_02511"
FT   CDS_pept        complement(235202..235423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69539"
FT                   /db_xref="InterPro:IPR019678"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP28"
FT                   /protein_id="ABM69539.1"
FT   gene            235642..235842
FT                   /locus_tag="A9601_02521"
FT   CDS_pept        235642..235842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69540"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP29"
FT                   /protein_id="ABM69540.1"
FT   gene            235854..236195
FT                   /locus_tag="A9601_02531"
FT   CDS_pept        235854..236195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69541"
FT                   /db_xref="GOA:A2BP30"
FT                   /db_xref="InterPro:IPR007572"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP30"
FT                   /protein_id="ABM69541.1"
FT                   FFTESLKLL"
FT   gene            complement(236198..237214)
FT                   /gene="pyrB"
FT                   /locus_tag="A9601_02541"
FT   CDS_pept        complement(236198..237214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="A9601_02541"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number=""
FT                   /note="COG540 Aspartate carbamoyltransferase, catalytic
FT                   chain [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69542"
FT                   /db_xref="GOA:A2BP31"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP31"
FT                   /protein_id="ABM69542.1"
FT   gene            complement(237236..237643)
FT                   /locus_tag="A9601_02551"
FT   CDS_pept        complement(237236..237643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02551"
FT                   /product="possible Methylpurine-DNA glycosylase (MPG)"
FT                   /note="COG2094 3-methyladenine DNA glycosylase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69543"
FT                   /db_xref="GOA:A2BP32"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP32"
FT                   /protein_id="ABM69543.1"
FT   gene            237985..238278
FT                   /gene="gatC"
FT                   /locus_tag="A9601_02561"
FT   CDS_pept        237985..238278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="A9601_02561"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit C"
FT                   /EC_number=""
FT                   /note="COG721 Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69544"
FT                   /db_xref="GOA:A2BP33"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP33"
FT                   /protein_id="ABM69544.1"
FT   gene            complement(238284..239117)
FT                   /gene="crtR"
FT                   /locus_tag="A9601_02571"
FT   CDS_pept        complement(238284..239117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtR"
FT                   /locus_tag="A9601_02571"
FT                   /product="Beta-carotene hydroxylase"
FT                   /note="COG3239 Fatty acid desaturase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69545"
FT                   /db_xref="GOA:A2BP34"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP34"
FT                   /protein_id="ABM69545.1"
FT   gene            239473..239554
FT                   /locus_tag="A9601_tRNALeuVIMSS1309087"
FT                   /note="tRNA-Leu"
FT   tRNA            239473..239554
FT                   /locus_tag="A9601_tRNALeuVIMSS1309087"
FT                   /product="tRNA-Leu"
FT   gene            239626..240075
FT                   /locus_tag="A9601_02581"
FT   CDS_pept        239626..240075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69546"
FT                   /db_xref="GOA:A2BP35"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP35"
FT                   /protein_id="ABM69546.1"
FT   gene            240196..243102
FT                   /gene="ileS"
FT                   /locus_tag="A9601_02591"
FT   CDS_pept        240196..243102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="A9601_02591"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG60 Isoleucyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69547"
FT                   /db_xref="GOA:A2BP36"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP36"
FT                   /protein_id="ABM69547.1"
FT   gene            complement(243099..243434)
FT                   /locus_tag="A9601_02601"
FT   CDS_pept        complement(243099..243434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02601"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69548"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP37"
FT                   /protein_id="ABM69548.1"
FT                   LNKKNWI"
FT   gene            complement(243394..244179)
FT                   /locus_tag="A9601_02611"
FT   CDS_pept        complement(243394..244179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69549"
FT                   /db_xref="GOA:A2BP38"
FT                   /db_xref="InterPro:IPR021515"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP38"
FT                   /protein_id="ABM69549.1"
FT   gene            244138..244767
FT                   /locus_tag="A9601_02621"
FT   CDS_pept        244138..244767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02621"
FT                   /product="Predicted SAM-dependent methyltransferase"
FT                   /EC_number=""
FT                   /note="COG220 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69550"
FT                   /db_xref="GOA:A2BP39"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP39"
FT                   /protein_id="ABM69550.1"
FT   gene            complement(244775..246127)
FT                   /locus_tag="A9601_02631"
FT   CDS_pept        complement(244775..246127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02631"
FT                   /product="Phosphotransferase superclass"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1109 Phosphomannomutase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69551"
FT                   /db_xref="GOA:A2BP40"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP40"
FT                   /protein_id="ABM69551.1"
FT   gene            246340..246810
FT                   /locus_tag="A9601_02641"
FT   CDS_pept        246340..246810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02641"
FT                   /product="thioredoxin-like protein TxlA"
FT                   /note="COG526 Thiol-disulfide isomerase and thioredoxins
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones / Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69552"
FT                   /db_xref="GOA:A2BP41"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP41"
FT                   /protein_id="ABM69552.1"
FT   gene            complement(246814..247446)
FT                   /gene="thy1"
FT                   /locus_tag="A9601_02651"
FT   CDS_pept        complement(246814..247446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thy1"
FT                   /locus_tag="A9601_02651"
FT                   /product="possible Thy1-like protein"
FT                   /EC_number=""
FT                   /note="COG1351 Predicted alternative thymidylate synthase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69553"
FT                   /db_xref="GOA:A2BP42"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP42"
FT                   /protein_id="ABM69553.1"
FT   gene            complement(247448..248041)
FT                   /gene="dcd"
FT                   /locus_tag="A9601_02661"
FT   CDS_pept        complement(247448..248041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="A9601_02661"
FT                   /product="dCTP Deaminase"
FT                   /EC_number=""
FT                   /note="COG717 Deoxycytidine deaminase [Nucleotide transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69554"
FT                   /db_xref="GOA:A2BP43"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP43"
FT                   /protein_id="ABM69554.1"
FT   gene            complement(248046..248627)
FT                   /locus_tag="A9601_02671"
FT   CDS_pept        complement(248046..248627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02671"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number=""
FT                   /note="COG2109 ATP:corrinoid adenosyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69555"
FT                   /db_xref="GOA:A2BP44"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP44"
FT                   /protein_id="ABM69555.1"
FT   gene            248828..249562
FT                   /gene="ntcA"
FT                   /locus_tag="A9601_02681"
FT   CDS_pept        248828..249562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntcA"
FT                   /locus_tag="A9601_02681"
FT                   /product="Global nitrogen regulatory protein, CRP family of
FT                   transcriptional regulators"
FT                   /note="COG664 cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases [Signal transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69556"
FT                   /db_xref="GOA:A2BP45"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR022299"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP45"
FT                   /protein_id="ABM69556.1"
FT   gene            249602..250567
FT                   /locus_tag="A9601_02691"
FT   CDS_pept        249602..250567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69557"
FT                   /db_xref="GOA:A2BP46"
FT                   /db_xref="InterPro:IPR021435"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP46"
FT                   /protein_id="ABM69557.1"
FT   gene            250568..251005
FT                   /locus_tag="A9601_02701"
FT   CDS_pept        250568..251005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02701"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69558"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP47"
FT                   /protein_id="ABM69558.1"
FT   gene            complement(250986..251243)
FT                   /locus_tag="A9601_02711"
FT   CDS_pept        complement(250986..251243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02711"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69559"
FT                   /db_xref="InterPro:IPR021492"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP48"
FT                   /protein_id="ABM69559.1"
FT   gene            complement(251247..251849)
FT                   /gene="pth"
FT                   /locus_tag="A9601_02721"
FT   CDS_pept        complement(251247..251849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="A9601_02721"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /EC_number=""
FT                   /note="COG193 Peptidyl-tRNA hydrolase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69560"
FT                   /db_xref="GOA:A2BP49"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP49"
FT                   /protein_id="ABM69560.1"
FT   gene            complement(251989..252189)
FT                   /gene="psbH"
FT                   /locus_tag="A9601_02731"
FT   CDS_pept        complement(251989..252189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbH"
FT                   /locus_tag="A9601_02731"
FT                   /product="Photosystem II PsbH protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69561"
FT                   /db_xref="GOA:A2BP50"
FT                   /db_xref="InterPro:IPR001056"
FT                   /db_xref="InterPro:IPR036863"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP50"
FT                   /protein_id="ABM69561.1"
FT   gene            252269..252421
FT                   /gene="psbN"
FT                   /locus_tag="A9601_02741"
FT   CDS_pept        252269..252421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbN"
FT                   /locus_tag="A9601_02741"
FT                   /product="Photosystem II reaction centre N protein (psbN)"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69562"
FT                   /db_xref="GOA:A2BP51"
FT                   /db_xref="InterPro:IPR003398"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP51"
FT                   /protein_id="ABM69562.1"
FT                   DDHDD"
FT   gene            252530..252658
FT                   /gene="psbI"
FT                   /locus_tag="A9601_02751"
FT   CDS_pept        252530..252658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbI"
FT                   /locus_tag="A9601_02751"
FT                   /product="photosystem II reaction center PsbI protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69563"
FT                   /db_xref="GOA:A2BP52"
FT                   /db_xref="InterPro:IPR003686"
FT                   /db_xref="InterPro:IPR037271"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP52"
FT                   /protein_id="ABM69563.1"
FT   gene            252780..254681
FT                   /locus_tag="A9601_02761"
FT   CDS_pept        252780..254681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02761"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69564"
FT                   /db_xref="InterPro:IPR022244"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP53"
FT                   /protein_id="ABM69564.1"
FT   gene            complement(254682..255305)
FT                   /gene="leuD"
FT                   /locus_tag="A9601_02771"
FT   CDS_pept        complement(254682..255305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="A9601_02771"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number=""
FT                   /note="COG66 3-isopropylmalate dehydratase small subunit
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69565"
FT                   /db_xref="GOA:A2BP54"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP54"
FT                   /protein_id="ABM69565.1"
FT   gene            complement(255305..256711)
FT                   /gene="leuC"
FT                   /locus_tag="A9601_02781"
FT   CDS_pept        complement(255305..256711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="A9601_02781"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number=""
FT                   /note="COG65 3-isopropylmalate dehydratase large subunit
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69566"
FT                   /db_xref="GOA:A2BP55"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP55"
FT                   /protein_id="ABM69566.1"
FT                   KVSDVREFIN"
FT   gene            complement(256725..257999)
FT                   /gene="cinA"
FT                   /locus_tag="A9601_02791"
FT   CDS_pept        complement(256725..257999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="A9601_02791"
FT                   /product="Molybdenum cofactor biosynthesis protein"
FT                   /note="COG1058 Predicted nucleotide-utilizing enzyme
FT                   related to molybdopterin-biosynthesis enzyme MoeA [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69567"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP56"
FT                   /protein_id="ABM69567.1"
FT   gene            complement(257996..259267)
FT                   /gene="glyA"
FT                   /locus_tag="A9601_02801"
FT   CDS_pept        complement(257996..259267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="A9601_02801"
FT                   /product="Serine hydroxymethyltransferase (SHMT)"
FT                   /EC_number=""
FT                   /note="COG112 Glycine/serine hydroxymethyltransferase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69568"
FT                   /db_xref="GOA:A2BP57"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP57"
FT                   /protein_id="ABM69568.1"
FT   gene            complement(259345..259418)
FT                   /locus_tag="A9601_tRNAArgVIMSS1309086"
FT                   /note="tRNA-Arg"
FT   tRNA            complement(259345..259418)
FT                   /locus_tag="A9601_tRNAArgVIMSS1309086"
FT                   /product="tRNA-Arg"
FT   gene            259475..259756
FT                   /locus_tag="A9601_02811"
FT   CDS_pept        259475..259756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02811"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69569"
FT                   /db_xref="GOA:A2BP58"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP58"
FT                   /protein_id="ABM69569.1"
FT   gene            259769..260059
FT                   /locus_tag="A9601_02821"
FT   CDS_pept        259769..260059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02821"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69570"
FT                   /db_xref="InterPro:IPR021518"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP59"
FT                   /protein_id="ABM69570.1"
FT   gene            complement(260056..261639)
FT                   /gene="mviN"
FT                   /locus_tag="A9601_02831"
FT   CDS_pept        complement(260056..261639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="A9601_02831"
FT                   /product="Uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /note="COG728 Uncharacterized membrane protein, putative
FT                   virulence factor [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69571"
FT                   /db_xref="GOA:A2BP60"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP60"
FT                   /protein_id="ABM69571.1"
FT                   NKFKVSKKMI"
FT   gene            261710..262450
FT                   /gene="sfsA"
FT                   /locus_tag="A9601_02841"
FT   CDS_pept        261710..262450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="A9601_02841"
FT                   /product="putative sugar fermentation stimulation protein"
FT                   /note="COG1489 DNA-binding protein, stimulates sugar
FT                   fermentation [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69572"
FT                   /db_xref="GOA:A2BP61"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP61"
FT                   /protein_id="ABM69572.1"
FT   gene            262631..264091
FT                   /gene="amtB"
FT                   /locus_tag="A9601_02851"
FT   CDS_pept        262631..264091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="A9601_02851"
FT                   /product="Ammonium transporter family"
FT                   /note="COG4 Ammonia permease [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69573"
FT                   /db_xref="GOA:A2BP62"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP62"
FT                   /protein_id="ABM69573.1"
FT   gene            264180..265376
FT                   /gene="lytB"
FT                   /locus_tag="A9601_02861"
FT   CDS_pept        264180..265376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="A9601_02861"
FT                   /product="LytB"
FT                   /EC_number=""
FT                   /note="COG761 Penicillin tolerance protein [Lipid
FT                   metabolism / Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69574"
FT                   /db_xref="GOA:A2BP63"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP63"
FT                   /protein_id="ABM69574.1"
FT   gene            265480..266040
FT                   /locus_tag="A9601_02871"
FT   CDS_pept        265480..266040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02871"
FT                   /product="Predicted membrane protein"
FT                   /note="COG2259 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69575"
FT                   /db_xref="GOA:A2BP64"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP64"
FT                   /protein_id="ABM69575.1"
FT   gene            complement(266042..267595)
FT                   /gene="purH"
FT                   /locus_tag="A9601_02881"
FT   CDS_pept        complement(266042..267595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="A9601_02881"
FT                   /product="AICARFT/IMPCHase bienzyme:Methylglyoxal
FT                   synthase-like domain-containing protein"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG138 AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful) [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69576"
FT                   /db_xref="GOA:A2BP65"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP65"
FT                   /protein_id="ABM69576.1"
FT                   "
FT   gene            267629..268246
FT                   /locus_tag="A9601_02891"
FT   CDS_pept        267629..268246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02891"
FT                   /product="probable esterase"
FT                   /note="COG400 Predicted esterase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69577"
FT                   /db_xref="GOA:A2BP66"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP66"
FT                   /protein_id="ABM69577.1"
FT   gene            complement(268243..268611)
FT                   /locus_tag="A9601_02901"
FT   CDS_pept        complement(268243..268611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02901"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69578"
FT                   /db_xref="InterPro:IPR021498"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP67"
FT                   /protein_id="ABM69578.1"
FT                   ELTADDWEEIEEYEYAFV"
FT   gene            268862..269998
FT                   /locus_tag="A9601_02911"
FT   CDS_pept        268862..269998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02911"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69579"
FT                   /db_xref="GOA:A2BP68"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP68"
FT                   /protein_id="ABM69579.1"
FT   gene            complement(269976..270716)
FT                   /gene="cobS"
FT                   /locus_tag="A9601_02921"
FT   CDS_pept        complement(269976..270716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="A9601_02921"
FT                   /product="Cobalamin-5-phosphate synthase CobS"
FT                   /EC_number=""
FT                   /note="COG368 Cobalamin-5-phosphate synthase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69580"
FT                   /db_xref="GOA:A2BP69"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP69"
FT                   /protein_id="ABM69580.1"
FT   gene            270815..271933
FT                   /gene="tgt"
FT                   /locus_tag="A9601_02931"
FT   CDS_pept        270815..271933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="A9601_02931"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number=""
FT                   /note="COG343 Queuine/archaeosine tRNA-ribosyltransferase
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69581"
FT                   /db_xref="GOA:A2BP70"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP70"
FT                   /protein_id="ABM69581.1"
FT   gene            271967..272107
FT                   /gene="psbK"
FT                   /locus_tag="A9601_02941"
FT   CDS_pept        271967..272107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbK"
FT                   /locus_tag="A9601_02941"
FT                   /product="Photosystem II protein PsbK"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69582"
FT                   /db_xref="GOA:A2BP71"
FT                   /db_xref="InterPro:IPR003687"
FT                   /db_xref="InterPro:IPR037270"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP71"
FT                   /protein_id="ABM69582.1"
FT                   K"
FT   gene            complement(272134..273138)
FT                   /locus_tag="A9601_02951"
FT   CDS_pept        complement(272134..273138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02951"
FT                   /product="probable oxidoreductase"
FT                   /note="COG673 Predicted dehydrogenases and related proteins
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69583"
FT                   /db_xref="GOA:A2BP72"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP72"
FT                   /protein_id="ABM69583.1"
FT   gene            273101..273214
FT                   /locus_tag="A9601_02961"
FT   CDS_pept        273101..273214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02961"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69584"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP73"
FT                   /protein_id="ABM69584.1"
FT   gene            complement(273189..274457)
FT                   /locus_tag="A9601_02971"
FT   CDS_pept        complement(273189..274457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02971"
FT                   /product="Hemolysin-like protein"
FT                   /note="COG1253 Hemolysins and related proteins containing
FT                   CBS domains [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69585"
FT                   /db_xref="GOA:A2BP74"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP74"
FT                   /protein_id="ABM69585.1"
FT   gene            complement(274476..274548)
FT                   /locus_tag="A9601_tRNAMetVIMSS1309085"
FT                   /note="tRNA-Met"
FT   tRNA            complement(274476..274548)
FT                   /locus_tag="A9601_tRNAMetVIMSS1309085"
FT                   /product="tRNA-Met"
FT   gene            274689..275249
FT                   /gene="pyrE"
FT                   /locus_tag="A9601_02981"
FT   CDS_pept        274689..275249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="A9601_02981"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="COG461 Orotate phosphoribosyltransferase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69586"
FT                   /db_xref="GOA:A2BP75"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP75"
FT                   /protein_id="ABM69586.1"
FT   gene            275260..276096
FT                   /locus_tag="A9601_02991"
FT   CDS_pept        275260..276096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_02991"
FT                   /product="Predicted aminomethyltransferase"
FT                   /note="related to GcvT; COG354 Predicted
FT                   aminomethyltransferase related to GcvT [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_02991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69587"
FT                   /db_xref="GOA:A2BP76"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP76"
FT                   /protein_id="ABM69587.1"
FT   gene            complement(276082..277500)
FT                   /locus_tag="A9601_03001"
FT   CDS_pept        complement(276082..277500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03001"
FT                   /product="Predicted nuclease (RecB family)"
FT                   /note="COG2251 Predicted nuclease (RecB family) [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69588"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP77"
FT                   /protein_id="ABM69588.1"
FT                   QIAEYLIKNRLKKN"
FT   gene            277581..279035
FT                   /locus_tag="A9601_03011"
FT   CDS_pept        277581..279035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03011"
FT                   /product="Phosphotransferase superclass"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1109 Phosphomannomutase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69589"
FT                   /db_xref="GOA:A2BP78"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP78"
FT                   /protein_id="ABM69589.1"
FT   gene            278999..279613
FT                   /locus_tag="A9601_03021"
FT   CDS_pept        278999..279613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03021"
FT                   /product="Xanthosine triphosphate pyrophosphatase"
FT                   /EC_number=""
FT                   /note="COG127 Xanthosine triphosphate pyrophosphatase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69590"
FT                   /db_xref="GOA:A2BP79"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP79"
FT                   /protein_id="ABM69590.1"
FT   gene            complement(279616..281100)
FT                   /locus_tag="A9601_03031"
FT   CDS_pept        complement(279616..281100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03031"
FT                   /product="Retinal pigment epithelial membrane protein"
FT                   /EC_number=""
FT                   /note="COG3670 Lignostilbene-alpha,beta-dioxygenase and
FT                   related enzymes [Secondary metabolites biosynthesis,
FT                   transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69591"
FT                   /db_xref="GOA:A2BP80"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP80"
FT                   /protein_id="ABM69591.1"
FT   gene            complement(281174..281779)
FT                   /locus_tag="A9601_03041"
FT   CDS_pept        complement(281174..281779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03041"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number=""
FT                   /note="COG131 Imidazoleglycerol-phosphate dehydratase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69592"
FT                   /db_xref="GOA:A2BP81"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP81"
FT                   /protein_id="ABM69592.1"
FT   gene            complement(281800..282582)
FT                   /gene="fabI"
FT                   /locus_tag="A9601_03051"
FT   CDS_pept        complement(281800..282582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="A9601_03051"
FT                   /product="enoyl-[acyl-carrier-protein] reductase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG623 Enoyl-[acyl-carrier-protein]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69593"
FT                   /db_xref="GOA:A2BP82"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP82"
FT                   /protein_id="ABM69593.1"
FT   gene            282688..283281
FT                   /locus_tag="A9601_03061"
FT   CDS_pept        282688..283281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69594"
FT                   /db_xref="GOA:A2BP83"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP83"
FT                   /protein_id="ABM69594.1"
FT   gene            283335..284540
FT                   /gene="degT"
FT                   /locus_tag="A9601_03071"
FT   CDS_pept        283335..284540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degT"
FT                   /locus_tag="A9601_03071"
FT                   /product="putative pleiotropic regulatory protein"
FT                   /note="COG399 Predicted pyridoxal phosphate-dependent
FT                   enzyme apparently involved in regulation of cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69595"
FT                   /db_xref="GOA:A2BP84"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP84"
FT                   /protein_id="ABM69595.1"
FT                   SA"
FT   gene            complement(284525..285958)
FT                   /gene="phrB"
FT                   /locus_tag="A9601_03081"
FT   CDS_pept        complement(284525..285958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="A9601_03081"
FT                   /product="putative DNA photolyase"
FT                   /EC_number=""
FT                   /note="COG415 Deoxyribodipyrimidine photolyase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69596"
FT                   /db_xref="GOA:A2BP85"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP85"
FT                   /protein_id="ABM69596.1"
FT   gene            complement(285955..286518)
FT                   /locus_tag="A9601_03091"
FT   CDS_pept        complement(285955..286518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03091"
FT                   /product="NUDIX hydrolase"
FT                   /EC_number=""
FT                   /note="COG494 NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes [DNA replication, recombination, and
FT                   repair / General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69597"
FT                   /db_xref="GOA:A2BP86"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP86"
FT                   /protein_id="ABM69597.1"
FT   gene            complement(286566..287132)
FT                   /gene="folK"
FT                   /locus_tag="A9601_03101"
FT   CDS_pept        complement(286566..287132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="A9601_03101"
FT                   /product="possible
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number=""
FT                   /note="COG801
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69598"
FT                   /db_xref="GOA:A2BP87"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP87"
FT                   /protein_id="ABM69598.1"
FT   gene            287181..289364
FT                   /gene="chlD"
FT                   /locus_tag="A9601_03111"
FT   CDS_pept        287181..289364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlD"
FT                   /locus_tag="A9601_03111"
FT                   /product="Protoporphyrin IX Magnesium chelatase, ChlD
FT                   subunit"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1239 Mg-chelatase subunit ChlI [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69599"
FT                   /db_xref="GOA:A2BP88"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011776"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP88"
FT                   /protein_id="ABM69599.1"
FT   gene            complement(289372..290217)
FT                   /locus_tag="A9601_03121"
FT   CDS_pept        complement(289372..290217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03121"
FT                   /product="possible ABC transporter"
FT                   /note="COG1463 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69600"
FT                   /db_xref="GOA:A2BP89"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR039342"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP89"
FT                   /protein_id="ABM69600.1"
FT                   "
FT   gene            complement(290223..290945)
FT                   /locus_tag="A9601_03131"
FT   CDS_pept        complement(290223..290945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03131"
FT                   /product="possible ABC transporter, ATP binding component"
FT                   /EC_number=""
FT                   /note="COG1127 ABC-type transport system involved in
FT                   resistance to organic solvents, ATPase component [Secondary
FT                   metabolites biosynthesis, transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69601"
FT                   /db_xref="GOA:A2BP90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP90"
FT                   /protein_id="ABM69601.1"
FT                   VFQFRNGKLDGPMQPKDI"
FT   gene            291140..292525
FT                   /locus_tag="A9601_03141"
FT   CDS_pept        291140..292525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03141"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG391 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69602"
FT                   /db_xref="GOA:A2BP91"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP91"
FT                   /protein_id="ABM69602.1"
FT                   KIN"
FT   gene            complement(292522..293052)
FT                   /gene="ndhJ"
FT                   /locus_tag="A9601_03151"
FT   CDS_pept        complement(292522..293052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhJ"
FT                   /locus_tag="A9601_03151"
FT                   /product="putative respiratory-chain NADH dehydrogenase
FT                   subunit"
FT                   /EC_number=""
FT                   /note="COG852 NADH:ubiquinone oxidoreductase 27 kD subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69603"
FT                   /db_xref="GOA:A2BP92"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP92"
FT                   /protein_id="ABM69603.1"
FT                   YIQPDFYELQDAY"
FT   gene            complement(293052..293786)
FT                   /gene="ndhK"
FT                   /locus_tag="A9601_03161"
FT   CDS_pept        complement(293052..293786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhK"
FT                   /locus_tag="A9601_03161"
FT                   /product="putative respiratory-chain NADH dehydrogenase
FT                   subunit"
FT                   /EC_number=""
FT                   /note="COG377 NADH:ubiquinone oxidoreductase 20 kD subunit
FT                   and related Fe-S oxidoreductases [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69604"
FT                   /db_xref="GOA:A2BP93"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP93"
FT                   /protein_id="ABM69604.1"
FT   gene            complement(293791..294153)
FT                   /gene="ndhC"
FT                   /locus_tag="A9601_03171"
FT   CDS_pept        complement(293791..294153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhC"
FT                   /locus_tag="A9601_03171"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 3)"
FT                   /EC_number=""
FT                   /note="COG838 NADH:ubiquinone oxidoreductase subunit 3
FT                   (chain A) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69605"
FT                   /db_xref="GOA:A2BP94"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP94"
FT                   /protein_id="ABM69605.1"
FT                   VIALAYAWRKGALEWS"
FT   gene            294230..294658
FT                   /gene="rub"
FT                   /locus_tag="A9601_03181"
FT   CDS_pept        294230..294658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rub"
FT                   /locus_tag="A9601_03181"
FT                   /product="probable rubredoxin"
FT                   /note="COG1773 Rubredoxin [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69606"
FT                   /db_xref="GOA:A2BP95"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP95"
FT                   /protein_id="ABM69606.1"
FT   gene            294668..295684
FT                   /locus_tag="A9601_03191"
FT   CDS_pept        294668..295684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03191"
FT                   /product="Uncharacterized plant photosystem II
FT                   stability/assembly factor-like protein"
FT                   /note="COG4447 Uncharacterized protein related to plant
FT                   photosystem II stability/assembly factor [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69607"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016705"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:A2BP96"
FT                   /protein_id="ABM69607.1"
FT   gene            295815..296069
FT                   /gene="psbE"
FT                   /locus_tag="A9601_03201"
FT   CDS_pept        295815..296069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbE"
FT                   /locus_tag="A9601_03201"
FT                   /product="Cytochrome b559 alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69608"
FT                   /db_xref="GOA:A2BP97"
FT                   /db_xref="InterPro:IPR006217"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="InterPro:IPR013082"
FT                   /db_xref="InterPro:IPR037025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP97"
FT                   /protein_id="ABM69608.1"
FT   gene            296072..296218
FT                   /gene="psbF"
FT                   /locus_tag="A9601_03211"
FT   CDS_pept        296072..296218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbF"
FT                   /locus_tag="A9601_03211"
FT                   /product="Cytochrome b559 beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69609"
FT                   /db_xref="GOA:A2BP98"
FT                   /db_xref="InterPro:IPR006216"
FT                   /db_xref="InterPro:IPR006241"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP98"
FT                   /protein_id="ABM69609.1"
FT                   VAR"
FT   gene            296230..296349
FT                   /gene="psbL"
FT                   /locus_tag="A9601_03221"
FT   CDS_pept        296230..296349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbL"
FT                   /locus_tag="A9601_03221"
FT                   /product="photosystem II PsbL protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69610"
FT                   /db_xref="GOA:A2BP99"
FT                   /db_xref="InterPro:IPR003372"
FT                   /db_xref="InterPro:IPR037266"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BP99"
FT                   /protein_id="ABM69610.1"
FT   gene            296359..296556
FT                   /gene="psbJ"
FT                   /locus_tag="A9601_03231"
FT   CDS_pept        296359..296556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbJ"
FT                   /locus_tag="A9601_03231"
FT                   /product="photosytem II PsbJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69611"
FT                   /db_xref="GOA:A2BPA0"
FT                   /db_xref="InterPro:IPR002682"
FT                   /db_xref="InterPro:IPR037267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPA0"
FT                   /protein_id="ABM69611.1"
FT   gene            complement(296600..297493)
FT                   /locus_tag="A9601_03241"
FT   CDS_pept        complement(296600..297493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03241"
FT                   /product="5'-methylthioadenosine phosphorylase"
FT                   /EC_number=""
FT                   /note="COG5 Purine nucleoside phosphorylase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69612"
FT                   /db_xref="GOA:A2BPA1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPA1"
FT                   /protein_id="ABM69612.1"
FT                   IPSSTEEKLRIFTDSY"
FT   gene            297504..299675
FT                   /locus_tag="A9601_03251"
FT   CDS_pept        297504..299675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03251"
FT                   /product="Selenide,water dikinase"
FT                   /EC_number=""
FT                   /note="COG1252 NADH dehydrogenase, FAD-containing subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69613"
FT                   /db_xref="GOA:A2BPA2"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR030805"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPA2"
FT                   /protein_id="ABM69613.1"
FT   gene            complement(299676..300923)
FT                   /locus_tag="A9601_03261"
FT   CDS_pept        complement(299676..300923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03261"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /EC_number=""
FT                   /note="COG617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69614"
FT                   /db_xref="GOA:A2BPA3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPA3"
FT                   /protein_id="ABM69614.1"
FT                   EIKRLRYLEIDKLNRN"
FT   gene            complement(300929..303337)
FT                   /gene="uvrD"
FT                   /locus_tag="A9601_03271"
FT   CDS_pept        complement(300929..303337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="A9601_03271"
FT                   /product="UvrD/REP helicase"
FT                   /note="COG210 Superfamily I DNA and RNA helicases [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69615"
FT                   /db_xref="GOA:A2BPA4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPA4"
FT                   /protein_id="ABM69615.1"
FT   gene            complement(303360..303566)
FT                   /locus_tag="A9601_03281"
FT   CDS_pept        complement(303360..303566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03281"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69616"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPA5"
FT                   /protein_id="ABM69616.1"
FT   gene            303745..304257
FT                   /gene="cpeB"
FT                   /locus_tag="A9601_03291"
FT   CDS_pept        303745..304257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeB"
FT                   /locus_tag="A9601_03291"
FT                   /product="Phycobilisome protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69617"
FT                   /db_xref="GOA:Q711U1"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q711U1"
FT                   /protein_id="ABM69617.1"
FT                   RIINLLN"
FT   gene            complement(304241..304792)
FT                   /gene="cpeS"
FT                   /locus_tag="A9601_03301"
FT   CDS_pept        complement(304241..304792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeS"
FT                   /locus_tag="A9601_03301"
FT                   /product="phycoerythrin linker protein CpeS"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69618"
FT                   /db_xref="GOA:A2BPA7"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR018536"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPA7"
FT                   /protein_id="ABM69618.1"
FT   gene            complement(304767..304946)
FT                   /locus_tag="A9601_03311"
FT   CDS_pept        complement(304767..304946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69619"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPA8"
FT                   /protein_id="ABM69619.1"
FT                   HSVEDKLDEESNNN"
FT   gene            complement(305063..305698)
FT                   /locus_tag="A9601_03321"
FT   CDS_pept        complement(305063..305698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03321"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG398 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69620"
FT                   /db_xref="GOA:A2BPA9"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPA9"
FT                   /protein_id="ABM69620.1"
FT   gene            305846..306265
FT                   /locus_tag="A9601_03331"
FT   CDS_pept        305846..306265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03331"
FT                   /product="possible Pollen allergen"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69621"
FT                   /db_xref="GOA:A2BPB0"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPB0"
FT                   /protein_id="ABM69621.1"
FT   gene            complement(306350..306425)
FT                   /locus_tag="A9601_tRNAPheVIMSS1309084"
FT                   /note="tRNA-Phe"
FT   tRNA            complement(306350..306425)
FT                   /locus_tag="A9601_tRNAPheVIMSS1309084"
FT                   /product="tRNA-Phe"
FT   gene            complement(306518..307747)
FT                   /gene="xylB"
FT                   /locus_tag="A9601_03341"
FT   CDS_pept        complement(306518..307747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="A9601_03341"
FT                   /product="Carbohydrate kinase, FGGY family"
FT                   /note="COG1070 Sugar (pentulose and hexulose) kinases
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69622"
FT                   /db_xref="GOA:A2BPB1"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPB1"
FT                   /protein_id="ABM69622.1"
FT                   GTALLAMNSK"
FT   gene            complement(307761..309002)
FT                   /gene="metK"
FT                   /locus_tag="A9601_03351"
FT   CDS_pept        complement(307761..309002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="A9601_03351"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number=""
FT                   /note="COG192 S-adenosylmethionine synthetase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69623"
FT                   /db_xref="GOA:A2BPB2"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPB2"
FT                   /protein_id="ABM69623.1"
FT                   EKAAQLAEASKVFL"
FT   gene            complement(309140..310231)
FT                   /gene="rps1a"
FT                   /gene_synonym="rpsA1"
FT                   /locus_tag="A9601_03361"
FT   CDS_pept        complement(309140..310231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps1a"
FT                   /gene_synonym="rpsA1"
FT                   /locus_tag="A9601_03361"
FT                   /product="30S ribosomal protein S1, protein A"
FT                   /note="COG1098 Predicted RNA binding protein (contains
FT                   ribosomal protein S1 domain) [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69624"
FT                   /db_xref="GOA:A2BPB3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPB3"
FT                   /protein_id="ABM69624.1"
FT   gene            complement(310341..310820)
FT                   /locus_tag="A9601_03371"
FT   CDS_pept        complement(310341..310820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03371"
FT                   /product="Predicted transcriptional regulator, consists of
FT                   a Zn-ribbon and ATP-cone domains"
FT                   /note="COG1327 Predicted transcriptional regulator,
FT                   consists of a Zn-ribbon and ATP-cone domains
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69625"
FT                   /db_xref="GOA:A2BPB4"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPB4"
FT                   /protein_id="ABM69625.1"
FT   gene            complement(310913..311011)
FT                   /gene="psbT"
FT                   /locus_tag="A9601_03381"
FT   CDS_pept        complement(310913..311011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbT"
FT                   /locus_tag="A9601_03381"
FT                   /product="Photosystem II PsbT protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69626"
FT                   /db_xref="GOA:A2BPB5"
FT                   /db_xref="InterPro:IPR001743"
FT                   /db_xref="InterPro:IPR037268"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPB5"
FT                   /protein_id="ABM69626.1"
FT                   /translation="MEAFAYVLILTLAVVTLFFAVAFRDPPKFDRK"
FT   gene            complement(311035..312558)
FT                   /gene="psbB"
FT                   /locus_tag="A9601_03391"
FT   CDS_pept        complement(311035..312558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbB"
FT                   /locus_tag="A9601_03391"
FT                   /product="Photosystem II PsbB protein (CP47)"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69627"
FT                   /db_xref="GOA:A2BPB6"
FT                   /db_xref="InterPro:IPR000932"
FT                   /db_xref="InterPro:IPR017486"
FT                   /db_xref="InterPro:IPR036001"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPB6"
FT                   /protein_id="ABM69627.1"
FT   gene            312781..313143
FT                   /gene="fdx"
FT                   /locus_tag="A9601_03401"
FT   CDS_pept        312781..313143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /locus_tag="A9601_03401"
FT                   /product="possible ferredoxin"
FT                   /note="COG633 Ferredoxin [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69628"
FT                   /db_xref="GOA:A2BPB7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPB7"
FT                   /protein_id="ABM69628.1"
FT                   NLEELKKISENKKLSR"
FT   gene            313249..313401
FT                   /gene="psbM"
FT                   /locus_tag="A9601_03411"
FT   CDS_pept        313249..313401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbM"
FT                   /locus_tag="A9601_03411"
FT                   /product="possible Photosystem II reaction center M protein
FT                   (PsbM)"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69629"
FT                   /db_xref="GOA:A2BPB8"
FT                   /db_xref="InterPro:IPR007826"
FT                   /db_xref="InterPro:IPR037269"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPB8"
FT                   /protein_id="ABM69629.1"
FT                   LGPKR"
FT   gene            313413..314282
FT                   /gene="hemK"
FT                   /locus_tag="A9601_03421"
FT   CDS_pept        313413..314282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="A9601_03421"
FT                   /product="putative protein methyltransferase"
FT                   /EC_number=""
FT                   /note="COG2890 Methylase of polypeptide chain release
FT                   factors [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69630"
FT                   /db_xref="GOA:A2BPB9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPB9"
FT                   /protein_id="ABM69630.1"
FT                   RFTIGRYK"
FT   gene            314306..314887
FT                   /gene="sua5"
FT                   /locus_tag="A9601_03431"
FT   CDS_pept        314306..314887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sua5"
FT                   /locus_tag="A9601_03431"
FT                   /product="Putative translation factor (SUA5)"
FT                   /note="COG9 Putative translation factor (SUA5)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69631"
FT                   /db_xref="GOA:A2BPC0"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPC0"
FT                   /protein_id="ABM69631.1"
FT   gene            complement(315066..315137)
FT                   /locus_tag="A9601_tRNAThrVIMSS1309083"
FT                   /note="tRNA-Thr"
FT   tRNA            complement(315066..315137)
FT                   /locus_tag="A9601_tRNAThrVIMSS1309083"
FT                   /product="tRNA-Thr"
FT   gene            complement(315202..315528)
FT                   /gene="minE"
FT                   /locus_tag="A9601_03441"
FT   CDS_pept        complement(315202..315528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="A9601_03441"
FT                   /product="possible septum site-determining protein MinE"
FT                   /note="COG851 Septum formation topological specificity
FT                   factor [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69632"
FT                   /db_xref="GOA:A2BPC1"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPC1"
FT                   /protein_id="ABM69632.1"
FT                   DIKK"
FT   gene            complement(315530..316357)
FT                   /gene="minD"
FT                   /locus_tag="A9601_03451"
FT   CDS_pept        complement(315530..316357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="A9601_03451"
FT                   /product="putative septum site-determining protein MinD"
FT                   /note="COG2894 Septum formation inhibitor-activating ATPase
FT                   [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69633"
FT                   /db_xref="GOA:A2BPC2"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPC2"
FT                   /protein_id="ABM69633.1"
FT   gene            complement(316457..317119)
FT                   /locus_tag="A9601_03461"
FT   CDS_pept        complement(316457..317119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03461"
FT                   /product="possible septum site-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69634"
FT                   /db_xref="GOA:A2BPC3"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPC3"
FT                   /protein_id="ABM69634.1"
FT   gene            complement(317130..318386)
FT                   /locus_tag="A9601_03471"
FT   CDS_pept        complement(317130..318386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03471"
FT                   /product="HD superfamily phosphohydrolases"
FT                   /note="COG1078 HD superfamily phosphohydrolases [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69635"
FT                   /db_xref="GOA:A2BPC4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPC4"
FT                   /protein_id="ABM69635.1"
FT   gene            complement(318414..319709)
FT                   /locus_tag="A9601_03481"
FT   CDS_pept        complement(318414..319709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03481"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number=""
FT                   /note="COG793 Periplasmic protease [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69636"
FT                   /db_xref="GOA:A2BPC5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPC5"
FT                   /protein_id="ABM69636.1"
FT   gene            319781..320437
FT                   /gene="petB"
FT                   /locus_tag="A9601_03491"
FT   CDS_pept        319781..320437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="A9601_03491"
FT                   /product="Cytochrome b6"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69637"
FT                   /db_xref="GOA:A2BPC6"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR023530"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPC6"
FT                   /protein_id="ABM69637.1"
FT   gene            320471..320953
FT                   /gene="petD"
FT                   /locus_tag="A9601_03501"
FT   CDS_pept        320471..320953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petD"
FT                   /locus_tag="A9601_03501"
FT                   /product="PetD protein (subunit IV of the Cytochrome b6f
FT                   complex)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69638"
FT                   /db_xref="GOA:A2BPC7"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR005870"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPC7"
FT                   /protein_id="ABM69638.1"
FT   gene            complement(320956..322395)
FT                   /locus_tag="A9601_03511"
FT   CDS_pept        complement(320956..322395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03511"
FT                   /product="putative neutral invertase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69639"
FT                   /db_xref="GOA:A2BPC8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPC8"
FT                   /protein_id="ABM69639.1"
FT   gene            complement(322657..322767)
FT                   /locus_tag="A9601_03521"
FT   CDS_pept        complement(322657..322767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03521"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69640"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPC9"
FT                   /protein_id="ABM69640.1"
FT   gene            322661..322825
FT                   /locus_tag="A9601_03531"
FT   CDS_pept        322661..322825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03531"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69641"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPD0"
FT                   /protein_id="ABM69641.1"
FT                   IKMSSIANF"
FT   gene            323018..324482
FT                   /locus_tag="A9601_rrsVIMSS1309386"
FT   rRNA            323018..324482
FT                   /locus_tag="A9601_rrsVIMSS1309386"
FT                   /product="16S ribosomal RNA"
FT   gene            324607..324680
FT                   /locus_tag="A9601_tRNAIleVIMSS1309088"
FT                   /note="tRNA-Ile"
FT   tRNA            324607..324680
FT                   /locus_tag="A9601_tRNAIleVIMSS1309088"
FT                   /product="tRNA-Ile"
FT   gene            324693..324765
FT                   /locus_tag="A9601_tRNAAlaVIMSS1309089"
FT                   /note="tRNA-Ala"
FT   tRNA            324693..324765
FT                   /locus_tag="A9601_tRNAAlaVIMSS1309089"
FT                   /product="tRNA-Ala"
FT   gene            325023..327896
FT                   /locus_tag="A9601_rrlVIMSS1365720"
FT   rRNA            325023..327896
FT                   /locus_tag="A9601_rrlVIMSS1365720"
FT                   /product="23S ribosomal RNA"
FT   gene            327963..328078
FT                   /gene="rrf"
FT                   /locus_tag="A9601_rrfVIMSS1309387"
FT   rRNA            327963..328078
FT                   /gene="rrf"
FT                   /locus_tag="A9601_rrfVIMSS1309387"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(328123..329001)
FT                   /gene="mutM"
FT                   /locus_tag="A9601_03541"
FT   CDS_pept        complement(328123..329001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="A9601_03541"
FT                   /product="Formamidopyrimidine-DNA glycolase (FAPY-DNA
FT                   glycolase)"
FT                   /EC_number=""
FT                   /note="COG266 Formamidopyrimidine-DNA glycosylase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69642"
FT                   /db_xref="GOA:A2BPD1"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPD1"
FT                   /protein_id="ABM69642.1"
FT                   RSTHWCPKCQK"
FT   gene            complement(329006..329215)
FT                   /gene="psaE"
FT                   /locus_tag="A9601_03551"
FT   CDS_pept        complement(329006..329215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaE"
FT                   /locus_tag="A9601_03551"
FT                   /product="Photosystem I PsaE protein (subunit IV)"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69643"
FT                   /db_xref="GOA:A2BPD2"
FT                   /db_xref="InterPro:IPR003375"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPD2"
FT                   /protein_id="ABM69643.1"
FT   gene            complement(329296..330057)
FT                   /locus_tag="A9601_03561"
FT   CDS_pept        complement(329296..330057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03561"
FT                   /product="possible LysM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69644"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPD3"
FT                   /protein_id="ABM69644.1"
FT   gene            complement(330130..331521)
FT                   /locus_tag="A9601_03571"
FT   CDS_pept        complement(330130..331521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03571"
FT                   /product="Putative aldehyde dehydrogenase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69645"
FT                   /db_xref="GOA:A2BPD4"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPD4"
FT                   /protein_id="ABM69645.1"
FT                   FIFQI"
FT   gene            331678..332568
FT                   /locus_tag="A9601_03581"
FT   CDS_pept        331678..332568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03581"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69646"
FT                   /db_xref="GOA:A2BPD5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPD5"
FT                   /protein_id="ABM69646.1"
FT                   CPMNQVYGLACLELG"
FT   gene            complement(332639..332887)
FT                   /locus_tag="A9601_03591"
FT   CDS_pept        complement(332639..332887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69647"
FT                   /db_xref="InterPro:IPR021453"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPD6"
FT                   /protein_id="ABM69647.1"
FT   gene            332989..333081
FT                   /locus_tag="A9601_03601"
FT   CDS_pept        332989..333081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03601"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69648"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPD7"
FT                   /protein_id="ABM69648.1"
FT                   /translation="MESTEIAIFSTLLGLILALTDAYIERNIPG"
FT   gene            complement(333099..333230)
FT                   /locus_tag="A9601_03611"
FT   CDS_pept        complement(333099..333230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03611"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69649"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPD8"
FT                   /protein_id="ABM69649.1"
FT   gene            complement(333342..333479)
FT                   /locus_tag="A9601_03621"
FT   CDS_pept        complement(333342..333479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03621"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69650"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPD9"
FT                   /protein_id="ABM69650.1"
FT                   "
FT   gene            complement(333596..333709)
FT                   /locus_tag="A9601_03631"
FT   CDS_pept        complement(333596..333709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03631"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69651"
FT                   /db_xref="GOA:A2BPE0"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPE0"
FT                   /protein_id="ABM69651.1"
FT   gene            333845..334279
FT                   /locus_tag="A9601_03641"
FT   CDS_pept        333845..334279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03641"
FT                   /product="NADH-plastoquinone oxidoreductase chain 5-like"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69652"
FT                   /db_xref="GOA:A2BPE1"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPE1"
FT                   /protein_id="ABM69652.1"
FT   gene            complement(334276..334785)
FT                   /locus_tag="A9601_03651"
FT   CDS_pept        complement(334276..334785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69653"
FT                   /db_xref="GOA:A2BPE2"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR038659"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPE2"
FT                   /protein_id="ABM69653.1"
FT                   SILTTV"
FT   gene            334941..335081
FT                   /locus_tag="A9601_03661"
FT   CDS_pept        334941..335081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03661"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69654"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPE3"
FT                   /protein_id="ABM69654.1"
FT                   A"
FT   gene            complement(335157..335341)
FT                   /pseudo
FT                   /locus_tag="A9601_pseudoVIMSS1362514"
FT                   /note="frameshift; Pseudogene derived from P9312_03541"
FT   gene            complement(335352..335660)
FT                   /locus_tag="A9601_03671"
FT   CDS_pept        complement(335352..335660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03671"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69655"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPE4"
FT                   /protein_id="ABM69655.1"
FT   gene            335960..336166
FT                   /locus_tag="A9601_03681"
FT   CDS_pept        335960..336166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03681"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69656"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPE5"
FT                   /protein_id="ABM69656.1"
FT   gene            336257..336547
FT                   /locus_tag="A9601_03691"
FT   CDS_pept        336257..336547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69657"
FT                   /db_xref="InterPro:IPR023810"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPE6"
FT                   /protein_id="ABM69657.1"
FT   gene            complement(336559..336762)
FT                   /locus_tag="A9601_03701"
FT   CDS_pept        complement(336559..336762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03701"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69658"
FT                   /db_xref="GOA:A2BPE7"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPE7"
FT                   /protein_id="ABM69658.1"
FT   gene            complement(336880..338409)
FT                   /locus_tag="A9601_03711"
FT   CDS_pept        complement(336880..338409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03711"
FT                   /product="Bacterial-type phytoene dehydrogenase"
FT                   /note="COG1233 Phytoene dehydrogenase and related proteins
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69659"
FT                   /db_xref="GOA:A2BPE8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPE8"
FT                   /protein_id="ABM69659.1"
FT   gene            complement(338449..338559)
FT                   /locus_tag="A9601_03721"
FT   CDS_pept        complement(338449..338559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03721"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69660"
FT                   /db_xref="GOA:A2BPE9"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPE9"
FT                   /protein_id="ABM69660.1"
FT   gene            338741..339226
FT                   /locus_tag="A9601_03731"
FT   CDS_pept        338741..339226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03731"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69661"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPF0"
FT                   /protein_id="ABM69661.1"
FT   gene            complement(339228..339443)
FT                   /locus_tag="A9601_03741"
FT   CDS_pept        complement(339228..339443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03741"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69662"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="InterPro:IPR022516"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPF1"
FT                   /protein_id="ABM69662.1"
FT   gene            339535..339852
FT                   /locus_tag="A9601_03751"
FT   CDS_pept        339535..339852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03751"
FT                   /product="possible Helper component proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69663"
FT                   /db_xref="GOA:A2BPF2"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPF2"
FT                   /protein_id="ABM69663.1"
FT                   D"
FT   gene            complement(339854..340246)
FT                   /locus_tag="A9601_03761"
FT   CDS_pept        complement(339854..340246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03761"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69664"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPF3"
FT                   /protein_id="ABM69664.1"
FT   gene            complement(340251..340517)
FT                   /locus_tag="A9601_03771"
FT   CDS_pept        complement(340251..340517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03771"
FT                   /product="mttA/Hcf106 family"
FT                   /note="COG1826 Sec-independent protein secretion pathway
FT                   components [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69665"
FT                   /db_xref="GOA:A2BPF4"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPF4"
FT                   /protein_id="ABM69665.1"
FT   gene            complement(340608..340745)
FT                   /locus_tag="A9601_03781"
FT   CDS_pept        complement(340608..340745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03781"
FT                   /product="protein family PM-16"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69666"
FT                   /db_xref="GOA:A2BPF5"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPF5"
FT                   /protein_id="ABM69666.1"
FT                   "
FT   gene            340926..341165
FT                   /locus_tag="A9601_03791"
FT   CDS_pept        340926..341165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03791"
FT                   /product="influenza non-structural protein (NS2)-like"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69667"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPF6"
FT                   /protein_id="ABM69667.1"
FT   gene            complement(341184..341315)
FT                   /locus_tag="A9601_03801"
FT   CDS_pept        complement(341184..341315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03801"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69668"
FT                   /db_xref="GOA:A2BPF7"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPF7"
FT                   /protein_id="ABM69668.1"
FT   gene            341466..341915
FT                   /locus_tag="A9601_03811"
FT   CDS_pept        341466..341915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03811"
FT                   /product="putative bacterioferritin comigratory protein"
FT                   /note="COG1225 Peroxiredoxin [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69669"
FT                   /db_xref="GOA:A2BPF8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPF8"
FT                   /protein_id="ABM69669.1"
FT   gene            341982..342254
FT                   /locus_tag="A9601_03821"
FT   CDS_pept        341982..342254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03821"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69670"
FT                   /db_xref="InterPro:IPR025149"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPF9"
FT                   /protein_id="ABM69670.1"
FT   gene            complement(342351..342695)
FT                   /locus_tag="A9601_03831"
FT   CDS_pept        complement(342351..342695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03831"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69671"
FT                   /db_xref="GOA:A2BPG0"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPG0"
FT                   /protein_id="ABM69671.1"
FT                   ISSDKKGWFK"
FT   gene            complement(342923..343297)
FT                   /locus_tag="A9601_03841"
FT   CDS_pept        complement(342923..343297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03841"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69672"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPG1"
FT                   /protein_id="ABM69672.1"
FT   gene            343362..343799
FT                   /locus_tag="A9601_03851"
FT   CDS_pept        343362..343799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03851"
FT                   /product="Class I peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69673"
FT                   /db_xref="GOA:A2BPG2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPG2"
FT                   /protein_id="ABM69673.1"
FT   gene            343854..344102
FT                   /locus_tag="A9601_03861"
FT   CDS_pept        343854..344102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03861"
FT                   /product="possible TIR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69674"
FT                   /db_xref="InterPro:IPR012447"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPG3"
FT                   /protein_id="ABM69674.1"
FT   gene            complement(344208..344336)
FT                   /locus_tag="A9601_03871"
FT   CDS_pept        complement(344208..344336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03871"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69675"
FT                   /db_xref="GOA:A2BPG4"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPG4"
FT                   /protein_id="ABM69675.1"
FT   gene            complement(344383..345249)
FT                   /locus_tag="A9601_03881"
FT   CDS_pept        complement(344383..345249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03881"
FT                   /product="Abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69676"
FT                   /db_xref="GOA:A2BPG5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPG5"
FT                   /protein_id="ABM69676.1"
FT                   KKNQKFN"
FT   gene            complement(345345..346178)
FT                   /locus_tag="A9601_03891"
FT   CDS_pept        complement(345345..346178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03891"
FT                   /product="Glycosyl transferase family 11"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69677"
FT                   /db_xref="GOA:A2BPG6"
FT                   /db_xref="InterPro:IPR002516"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPG6"
FT                   /protein_id="ABM69677.1"
FT   gene            346275..347042
FT                   /locus_tag="A9601_03901"
FT   CDS_pept        346275..347042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03901"
FT                   /product="possible Glycosyl transferase"
FT                   /note="COG463 Glycosyltransferases involved in cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69678"
FT                   /db_xref="GOA:A2BPG7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPG7"
FT                   /protein_id="ABM69678.1"
FT   gene            348325..349275
FT                   /locus_tag="A9601_03911"
FT   CDS_pept        348325..349275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03911"
FT                   /product="proline iminopeptidase"
FT                   /EC_number=""
FT                   /note="COG596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69679"
FT                   /db_xref="GOA:A2BPG8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPG8"
FT                   /protein_id="ABM69679.1"
FT   gene            complement(349299..349472)
FT                   /locus_tag="A9601_03921"
FT   CDS_pept        complement(349299..349472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03921"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69680"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPG9"
FT                   /protein_id="ABM69680.1"
FT                   RSIAQNIEDNGL"
FT   gene            complement(349600..351096)
FT                   /locus_tag="A9601_03931"
FT   CDS_pept        complement(349600..351096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03931"
FT                   /product="putative deoxyribodipyrimidine photolyase"
FT                   /EC_number=""
FT                   /note="COG415 Deoxyribodipyrimidine photolyase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69681"
FT                   /db_xref="GOA:A2BPH0"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPH0"
FT                   /protein_id="ABM69681.1"
FT   gene            351184..351807
FT                   /locus_tag="A9601_03941"
FT   CDS_pept        351184..351807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03941"
FT                   /product="TENA/THI-4 protein"
FT                   /note="COG819 Putative transcription activator
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69682"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPH1"
FT                   /protein_id="ABM69682.1"
FT   gene            351857..352636
FT                   /gene="thiD"
FT                   /locus_tag="A9601_03951"
FT   CDS_pept        351857..352636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="A9601_03951"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG351
FT                   Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69683"
FT                   /db_xref="GOA:A2BPH2"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPH2"
FT                   /protein_id="ABM69683.1"
FT   gene            complement(352655..352813)
FT                   /locus_tag="A9601_03961"
FT   CDS_pept        complement(352655..352813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03961"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69684"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPH3"
FT                   /protein_id="ABM69684.1"
FT                   PYRKWWF"
FT   gene            353023..353166
FT                   /locus_tag="A9601_03971"
FT   CDS_pept        353023..353166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03971"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69685"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPH4"
FT                   /protein_id="ABM69685.1"
FT                   CA"
FT   gene            353246..353713
FT                   /locus_tag="A9601_03981"
FT   CDS_pept        353246..353713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03981"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG3542 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69686"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPH5"
FT                   /protein_id="ABM69686.1"
FT   gene            353784..354161
FT                   /locus_tag="A9601_03991"
FT   CDS_pept        353784..354161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_03991"
FT                   /product="possible Phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_03991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69687"
FT                   /db_xref="GOA:A2BPH6"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPH6"
FT                   /protein_id="ABM69687.1"
FT   gene            complement(354198..354380)
FT                   /locus_tag="A9601_04001"
FT   CDS_pept        complement(354198..354380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04001"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69688"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPH7"
FT                   /protein_id="ABM69688.1"
FT                   STRNLTIGSSDNFHW"
FT   gene            354616..354900
FT                   /locus_tag="A9601_04011"
FT   CDS_pept        354616..354900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04011"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69689"
FT                   /db_xref="InterPro:IPR022240"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPH8"
FT                   /protein_id="ABM69689.1"
FT   gene            355379..355678
FT                   /locus_tag="A9601_04021"
FT   CDS_pept        355379..355678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04021"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69690"
FT                   /db_xref="GOA:A2BPH9"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPH9"
FT                   /protein_id="ABM69690.1"
FT   gene            complement(355675..355860)
FT                   /locus_tag="A9601_04031"
FT   CDS_pept        complement(355675..355860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04031"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69691"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPI0"
FT                   /protein_id="ABM69691.1"
FT                   DTIQAQDVLMLERISI"
FT   gene            complement(355889..356023)
FT                   /locus_tag="A9601_04041"
FT   CDS_pept        complement(355889..356023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04041"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69692"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPI1"
FT                   /protein_id="ABM69692.1"
FT   gene            complement(356249..356440)
FT                   /locus_tag="A9601_04051"
FT   CDS_pept        complement(356249..356440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04051"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69693"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPI2"
FT                   /protein_id="ABM69693.1"
FT                   PIKKGIFLNWDTTVGMDK"
FT   gene            complement(356528..356599)
FT                   /locus_tag="A9601_tRNAThrVIMSS1309082"
FT                   /note="tRNA-Thr"
FT   tRNA            complement(356528..356599)
FT                   /locus_tag="A9601_tRNAThrVIMSS1309082"
FT                   /product="tRNA-Thr"
FT   gene            356786..357037
FT                   /locus_tag="A9601_04061"
FT   CDS_pept        356786..357037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04061"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69694"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPI3"
FT                   /protein_id="ABM69694.1"
FT   gene            357102..357530
FT                   /locus_tag="A9601_04071"
FT   CDS_pept        357102..357530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04071"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69695"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPI4"
FT                   /protein_id="ABM69695.1"
FT   gene            complement(357437..357571)
FT                   /locus_tag="A9601_04081"
FT   CDS_pept        complement(357437..357571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04081"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69696"
FT                   /db_xref="GOA:A2BPI5"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPI5"
FT                   /protein_id="ABM69696.1"
FT   gene            complement(357578..357733)
FT                   /locus_tag="A9601_04091"
FT   CDS_pept        complement(357578..357733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04091"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69697"
FT                   /db_xref="GOA:A2BPI6"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPI6"
FT                   /protein_id="ABM69697.1"
FT                   WMCLFR"
FT   gene            357864..358115
FT                   /locus_tag="A9601_04101"
FT   CDS_pept        357864..358115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04101"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69698"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPI7"
FT                   /protein_id="ABM69698.1"
FT   gene            358105..358314
FT                   /locus_tag="A9601_04111"
FT   CDS_pept        358105..358314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04111"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69699"
FT                   /db_xref="GOA:A2BPI8"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPI8"
FT                   /protein_id="ABM69699.1"
FT   gene            358557..358919
FT                   /locus_tag="A9601_04121"
FT   CDS_pept        358557..358919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04121"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69700"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPI9"
FT                   /protein_id="ABM69700.1"
FT                   FFRIGSGCYGGRINKV"
FT   gene            complement(359042..359296)
FT                   /locus_tag="A9601_04131"
FT   CDS_pept        complement(359042..359296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04131"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69701"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPJ0"
FT                   /protein_id="ABM69701.1"
FT   gene            359367..359603
FT                   /locus_tag="A9601_04141"
FT   CDS_pept        359367..359603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04141"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69702"
FT                   /db_xref="GOA:A2BPJ1"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPJ1"
FT                   /protein_id="ABM69702.1"
FT   gene            359740..359934
FT                   /locus_tag="A9601_04151"
FT   CDS_pept        359740..359934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04151"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69703"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPJ2"
FT                   /protein_id="ABM69703.1"
FT   gene            complement(360061..360825)
FT                   /locus_tag="A9601_04161"
FT   CDS_pept        complement(360061..360825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04161"
FT                   /product="Putative dehydrogenase"
FT                   /EC_number=""
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69704"
FT                   /db_xref="GOA:A2BPJ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPJ3"
FT                   /protein_id="ABM69704.1"
FT   gene            361007..361858
FT                   /locus_tag="A9601_04171"
FT   CDS_pept        361007..361858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04171"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69705"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPJ4"
FT                   /protein_id="ABM69705.1"
FT                   LF"
FT   gene            361948..362202
FT                   /locus_tag="A9601_04181"
FT   CDS_pept        361948..362202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04181"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69706"
FT                   /db_xref="GOA:A2BPJ5"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPJ5"
FT                   /protein_id="ABM69706.1"
FT   gene            complement(362468..362695)
FT                   /locus_tag="A9601_04191"
FT   CDS_pept        complement(362468..362695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04191"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69707"
FT                   /db_xref="GOA:A2BPJ6"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPJ6"
FT                   /protein_id="ABM69707.1"
FT   gene            complement(362696..362956)
FT                   /locus_tag="A9601_04201"
FT   CDS_pept        complement(362696..362956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04201"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69708"
FT                   /db_xref="GOA:A2BPJ7"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPJ7"
FT                   /protein_id="ABM69708.1"
FT   gene            complement(362956..363165)
FT                   /locus_tag="A9601_04211"
FT   CDS_pept        complement(362956..363165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04211"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69709"
FT                   /db_xref="GOA:A2BPJ8"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPJ8"
FT                   /protein_id="ABM69709.1"
FT   gene            363383..363529
FT                   /locus_tag="A9601_04221"
FT   CDS_pept        363383..363529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04221"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69710"
FT                   /db_xref="GOA:A2BPJ9"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPJ9"
FT                   /protein_id="ABM69710.1"
FT                   KAG"
FT   gene            complement(363566..364066)
FT                   /locus_tag="A9601_04231"
FT   CDS_pept        complement(363566..364066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04231"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69711"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPK0"
FT                   /protein_id="ABM69711.1"
FT                   NKD"
FT   gene            complement(364066..364260)
FT                   /locus_tag="A9601_04241"
FT   CDS_pept        complement(364066..364260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04241"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69712"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPK1"
FT                   /protein_id="ABM69712.1"
FT   gene            364502..365284
FT                   /locus_tag="A9601_04251"
FT   CDS_pept        364502..365284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04251"
FT                   /product="probable periplasmic protein"
FT                   /note="COG2859 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69713"
FT                   /db_xref="GOA:A2BPK2"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="InterPro:IPR016907"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPK2"
FT                   /protein_id="ABM69713.1"
FT   gene            complement(365384..365572)
FT                   /locus_tag="A9601_04261"
FT   CDS_pept        complement(365384..365572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04261"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69714"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPK3"
FT                   /protein_id="ABM69714.1"
FT                   AVKKGIPLTWDIPDGMD"
FT   gene            365886..366299
FT                   /gene="vsr"
FT                   /locus_tag="A9601_04271"
FT   CDS_pept        365886..366299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vsr"
FT                   /locus_tag="A9601_04271"
FT                   /product="Hypothetical protein"
FT                   /note="COG3727 DNA G:T-mismatch repair endonuclease [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69715"
FT                   /db_xref="GOA:A2BPK4"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPK4"
FT                   /protein_id="ABM69715.1"
FT   gene            366365..369070
FT                   /locus_tag="A9601_04281"
FT   CDS_pept        366365..369070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04281"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69716"
FT                   /db_xref="InterPro:IPR018310"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPK5"
FT                   /protein_id="ABM69716.1"
FT   gene            369074..370048
FT                   /locus_tag="A9601_04291"
FT   CDS_pept        369074..370048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04291"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69717"
FT                   /db_xref="InterPro:IPR025534"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPK6"
FT                   /protein_id="ABM69717.1"
FT   gene            370048..372033
FT                   /locus_tag="A9601_04301"
FT   CDS_pept        370048..372033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04301"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69718"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPK7"
FT                   /protein_id="ABM69718.1"
FT   gene            372036..372920
FT                   /locus_tag="A9601_04311"
FT   CDS_pept        372036..372920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04311"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69719"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPK8"
FT                   /protein_id="ABM69719.1"
FT                   NDFNCECQSIFCD"
FT   gene            372921..373733
FT                   /locus_tag="A9601_04321"
FT   CDS_pept        372921..373733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04321"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69720"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPK9"
FT                   /protein_id="ABM69720.1"
FT   gene            complement(373751..375847)
FT                   /gene="dcm"
FT                   /locus_tag="A9601_04331"
FT   CDS_pept        complement(373751..375847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcm"
FT                   /locus_tag="A9601_04331"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number=""
FT                   /note="COG270 Site-specific DNA methylase [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69721"
FT                   /db_xref="GOA:A2BPL0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPL0"
FT                   /protein_id="ABM69721.1"
FT                   RDVS"
FT   gene            complement(375844..376557)
FT                   /locus_tag="A9601_04341"
FT   CDS_pept        complement(375844..376557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04341"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69722"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPL1"
FT                   /protein_id="ABM69722.1"
FT                   EQLQQLIDTQSEEVA"
FT   gene            complement(376554..377585)
FT                   /locus_tag="A9601_04351"
FT   CDS_pept        complement(376554..377585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04351"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69723"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPL2"
FT                   /protein_id="ABM69723.1"
FT                   EVA"
FT   gene            complement(377588..379552)
FT                   /locus_tag="A9601_04361"
FT   CDS_pept        complement(377588..379552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04361"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69724"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPL3"
FT                   /protein_id="ABM69724.1"
FT   gene            complement(379721..380686)
FT                   /locus_tag="A9601_04371"
FT   CDS_pept        complement(379721..380686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04371"
FT                   /product="Hypothetical protein"
FT                   /note="COG4974 Site-specific recombinase XerD [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69725"
FT                   /db_xref="GOA:A2BPL4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPL4"
FT                   /protein_id="ABM69725.1"
FT   gene            complement(380827..380898)
FT                   /locus_tag="A9601_tRNAThrVIMSS1309081"
FT                   /note="tRNA-Thr"
FT   tRNA            complement(380827..380898)
FT                   /locus_tag="A9601_tRNAThrVIMSS1309081"
FT                   /product="tRNA-Thr"
FT   gene            complement(380909..380990)
FT                   /locus_tag="A9601_tRNATyrVIMSS1309080"
FT                   /note="tRNA-Tyr"
FT   tRNA            complement(380909..380990)
FT                   /locus_tag="A9601_tRNATyrVIMSS1309080"
FT                   /product="tRNA-Tyr"
FT   gene            381090..381533
FT                   /gene="aroQ"
FT                   /locus_tag="A9601_04381"
FT   CDS_pept        381090..381533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="A9601_04381"
FT                   /product="Dehydroquinase class II"
FT                   /EC_number=""
FT                   /note="COG757 3-dehydroquinate dehydratase II [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69726"
FT                   /db_xref="GOA:A2BPL5"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPL5"
FT                   /protein_id="ABM69726.1"
FT   gene            381534..382142
FT                   /gene="miaE"
FT                   /locus_tag="A9601_04391"
FT   CDS_pept        381534..382142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaE"
FT                   /locus_tag="A9601_04391"
FT                   /product="putative tRNA-(MS[2]IO[6]A)-hydroxylase-like
FT                   protein"
FT                   /note="COG4445 Hydroxylase for synthesis of
FT                   2-methylthio-cis-ribozeatin in tRNA [Nucleotide transport
FT                   and metabolism / Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69727"
FT                   /db_xref="GOA:A2BPL6"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPL6"
FT                   /protein_id="ABM69727.1"
FT   gene            382159..382914
FT                   /gene="cobI"
FT                   /gene_synonym="cbiL"
FT                   /locus_tag="A9601_04401"
FT   CDS_pept        382159..382914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobI"
FT                   /gene_synonym="cbiL"
FT                   /locus_tag="A9601_04401"
FT                   /product="precorrin-2-C20-methyltransferase"
FT                   /EC_number=""
FT                   /note="COG2243 Precorrin-2 methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69728"
FT                   /db_xref="GOA:A2BPL7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPL7"
FT                   /protein_id="ABM69728.1"
FT   gene            382914..383399
FT                   /locus_tag="A9601_04411"
FT   CDS_pept        382914..383399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69729"
FT                   /db_xref="InterPro:IPR014952"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPL8"
FT                   /protein_id="ABM69729.1"
FT   gene            383474..384847
FT                   /locus_tag="A9601_04421"
FT   CDS_pept        383474..384847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04421"
FT                   /product="GTP-binding protein (HSR1-related)"
FT                   /EC_number=""
FT                   /note="COG1160 Predicted GTPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69730"
FT                   /db_xref="GOA:A2BPL9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPL9"
FT                   /protein_id="ABM69730.1"
FT   gene            384847..385761
FT                   /gene="cbiQ"
FT                   /locus_tag="A9601_04431"
FT   CDS_pept        384847..385761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="A9601_04431"
FT                   /product="possible cobalt transport protein"
FT                   /note="COG619 ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters [Inorganic ion
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69731"
FT                   /db_xref="GOA:A2BPM0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPM0"
FT                   /protein_id="ABM69731.1"
FT   gene            385781..385945
FT                   /locus_tag="A9601_04441"
FT   CDS_pept        385781..385945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04441"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69732"
FT                   /db_xref="InterPro:IPR021926"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPM1"
FT                   /protein_id="ABM69732.1"
FT                   EVFLRLYLI"
FT   gene            386113..386685
FT                   /locus_tag="A9601_04451"
FT   CDS_pept        386113..386685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04451"
FT                   /product="Predicted enzyme with a TIM-barrel fold"
FT                   /note="COG325 Predicted enzyme with a TIM-barrel fold
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69733"
FT                   /db_xref="GOA:A2BPM2"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPM2"
FT                   /protein_id="ABM69733.1"
FT   gene            386836..387411
FT                   /locus_tag="A9601_04461"
FT   CDS_pept        386836..387411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04461"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG1799 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69734"
FT                   /db_xref="GOA:A2BPM3"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPM3"
FT                   /protein_id="ABM69734.1"
FT   gene            387419..388231
FT                   /gene="proC"
FT                   /locus_tag="A9601_04471"
FT   CDS_pept        387419..388231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="A9601_04471"
FT                   /product="Delta 1-pyrroline-5-carboxylate reductase"
FT                   /EC_number=""
FT                   /note="COG345 Pyrroline-5-carboxylate reductase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69735"
FT                   /db_xref="GOA:A2BPM4"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPM4"
FT                   /protein_id="ABM69735.1"
FT   gene            complement(388237..389394)
FT                   /locus_tag="A9601_04481"
FT   CDS_pept        complement(388237..389394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04481"
FT                   /product="possible Glycosyl transferase, group 1"
FT                   /note="COG438 Glycosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69736"
FT                   /db_xref="GOA:A2BPM5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPM5"
FT                   /protein_id="ABM69736.1"
FT   gene            complement(389480..390265)
FT                   /gene="recO"
FT                   /locus_tag="A9601_04491"
FT   CDS_pept        complement(389480..390265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="A9601_04491"
FT                   /product="possible Recombination protein O (RecO)"
FT                   /note="COG1381 Recombinational DNA repair protein (RecF
FT                   pathway) [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69737"
FT                   /db_xref="GOA:A2BPM6"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPM6"
FT                   /protein_id="ABM69737.1"
FT   gene            complement(390266..390925)
FT                   /gene="deoC"
FT                   /locus_tag="A9601_04501"
FT   CDS_pept        complement(390266..390925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="A9601_04501"
FT                   /product="Putative deoxyribose-phosphate aldolase"
FT                   /EC_number=""
FT                   /note="COG274 Deoxyribose-phosphate aldolase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69738"
FT                   /db_xref="GOA:A2BPM7"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPM7"
FT                   /protein_id="ABM69738.1"
FT   gene            complement(390933..391517)
FT                   /gene="lrtA"
FT                   /locus_tag="A9601_04511"
FT   CDS_pept        complement(390933..391517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrtA"
FT                   /locus_tag="A9601_04511"
FT                   /product="light repressed protein A"
FT                   /note="COG1544 Ribosome-associated protein Y (PSrp-1)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69739"
FT                   /db_xref="GOA:A2BPM8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPM8"
FT                   /protein_id="ABM69739.1"
FT   gene            391562..392212
FT                   /gene="lipB"
FT                   /locus_tag="A9601_04521"
FT   CDS_pept        391562..392212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="A9601_04521"
FT                   /product="putative lipoate-protein ligase B"
FT                   /note="COG321 Lipoate-protein ligase B [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69740"
FT                   /db_xref="GOA:A2BPM9"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPM9"
FT                   /protein_id="ABM69740.1"
FT   gene            392240..394183
FT                   /gene="fadD"
FT                   /locus_tag="A9601_04531"
FT   CDS_pept        392240..394183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="A9601_04531"
FT                   /product="putative long-chain-fatty-acid--CoA ligase"
FT                   /EC_number=""
FT                   /note="COG1022 Long-chain acyl-CoA synthetases
FT                   (AMP-forming) [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69741"
FT                   /db_xref="GOA:A2BPN0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPN0"
FT                   /protein_id="ABM69741.1"
FT                   ENMYENKFSKKI"
FT   gene            394222..394665
FT                   /locus_tag="A9601_04541"
FT   CDS_pept        394222..394665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69742"
FT                   /db_xref="InterPro:IPR021297"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPN1"
FT                   /protein_id="ABM69742.1"
FT   gene            394884..396251
FT                   /gene="pdhC"
FT                   /locus_tag="A9601_04551"
FT   CDS_pept        394884..396251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /locus_tag="A9601_04551"
FT                   /product="Dihydrolipoamide acetyltransferase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69743"
FT                   /db_xref="GOA:A2BPN2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPN2"
FT                   /protein_id="ABM69743.1"
FT   gene            396258..397382
FT                   /gene="queA"
FT                   /locus_tag="A9601_04561"
FT   CDS_pept        396258..397382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="A9601_04561"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="COG809
FT                   S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
FT                   (queuine synthetase) [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69744"
FT                   /db_xref="GOA:A2BPN3"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPN3"
FT                   /protein_id="ABM69744.1"
FT   gene            complement(397385..398371)
FT                   /locus_tag="A9601_04571"
FT   CDS_pept        complement(397385..398371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04571"
FT                   /product="O-acetylserine (thiol)-lyase A"
FT                   /EC_number=""
FT                   /note="COG31 Cysteine synthase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69745"
FT                   /db_xref="GOA:A2BPN4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPN4"
FT                   /protein_id="ABM69745.1"
FT   gene            complement(398456..399925)
FT                   /locus_tag="A9601_04581"
FT   CDS_pept        complement(398456..399925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04581"
FT                   /product="possible Cystathionine gamma-synthase"
FT                   /EC_number=""
FT                   /note="COG626 Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69746"
FT                   /db_xref="GOA:A2BPN5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPN5"
FT                   /protein_id="ABM69746.1"
FT   gene            complement(399929..401092)
FT                   /gene="metB"
FT                   /locus_tag="A9601_04591"
FT   CDS_pept        complement(399929..401092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="A9601_04591"
FT                   /product="putative Cystathionine gamma-synthase"
FT                   /EC_number=""
FT                   /note="COG626 Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69747"
FT                   /db_xref="GOA:A2BPN6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPN6"
FT                   /protein_id="ABM69747.1"
FT   gene            complement(401169..401777)
FT                   /gene="rpsD"
FT                   /locus_tag="A9601_04601"
FT   CDS_pept        complement(401169..401777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="A9601_04601"
FT                   /product="30S ribosomal protein S4"
FT                   /note="COG522 Ribosomal protein S4 and related proteins
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69748"
FT                   /db_xref="GOA:A2BPN7"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPN7"
FT                   /protein_id="ABM69748.1"
FT   gene            401918..402109
FT                   /locus_tag="A9601_04611"
FT   CDS_pept        401918..402109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04611"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG759 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69749"
FT                   /db_xref="GOA:A2BPN8"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPN8"
FT                   /protein_id="ABM69749.1"
FT                   RLSRCHPLTPCGCDPVPD"
FT   gene            402114..402416
FT                   /locus_tag="A9601_04621"
FT   CDS_pept        402114..402416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04621"
FT                   /product="Thioredoxin family protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69750"
FT                   /db_xref="GOA:A2BPN9"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPN9"
FT                   /protein_id="ABM69750.1"
FT   gene            402426..403961
FT                   /gene="murE"
FT                   /locus_tag="A9601_04631"
FT   CDS_pept        402426..403961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="A9601_04631"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /EC_number=""
FT                   /note="COG769 UDP-N-acetylmuramyl tripeptide synthase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69751"
FT                   /db_xref="GOA:A2BPP0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPP0"
FT                   /protein_id="ABM69751.1"
FT   gene            404043..404747
FT                   /locus_tag="A9601_04641"
FT   CDS_pept        404043..404747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04641"
FT                   /product="putative short chain dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69752"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPP1"
FT                   /protein_id="ABM69752.1"
FT                   KFIAWDNSEIPW"
FT   gene            complement(404775..405950)
FT                   /locus_tag="A9601_04651"
FT   CDS_pept        complement(404775..405950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04651"
FT                   /product="putative L-cysteine/cystine lyase"
FT                   /note="COG520 Selenocysteine lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69753"
FT                   /db_xref="GOA:A2BPP2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPP2"
FT                   /protein_id="ABM69753.1"
FT   gene            complement(405987..406781)
FT                   /locus_tag="A9601_04661"
FT   CDS_pept        complement(405987..406781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04661"
FT                   /product="putative methyltransferase"
FT                   /note="COG500 SAM-dependent methyltransferases [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69754"
FT                   /db_xref="GOA:A2BPP3"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPP3"
FT                   /protein_id="ABM69754.1"
FT   gene            complement(406859..407050)
FT                   /locus_tag="A9601_04671"
FT   CDS_pept        complement(406859..407050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04671"
FT                   /product="Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69755"
FT                   /db_xref="InterPro:IPR025458"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPP4"
FT                   /protein_id="ABM69755.1"
FT                   SSSNEKAELNYRGVNYTK"
FT   gene            407289..407546
FT                   /locus_tag="A9601_04681"
FT   CDS_pept        407289..407546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69756"
FT                   /db_xref="GOA:A2BPP5"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPP5"
FT                   /protein_id="ABM69756.1"
FT   gene            complement(407569..407814)
FT                   /locus_tag="A9601_04691"
FT   CDS_pept        complement(407569..407814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04691"
FT                   /product="NifU-like protein"
FT                   /note="COG694 Thioredoxin-like proteins and domains
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69757"
FT                   /db_xref="GOA:A2BPP6"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPP6"
FT                   /protein_id="ABM69757.1"
FT   gene            407885..409381
FT                   /gene="mqo"
FT                   /locus_tag="A9601_04701"
FT   CDS_pept        407885..409381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqo"
FT                   /locus_tag="A9601_04701"
FT                   /product="putative malate/quinone oxidoreductase"
FT                   /EC_number=""
FT                   /note="COG579 Predicted dehydrogenase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69758"
FT                   /db_xref="GOA:A2BPP7"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPP7"
FT                   /protein_id="ABM69758.1"
FT   gene            409437..411245
FT                   /gene="lepA"
FT                   /locus_tag="A9601_04711"
FT   CDS_pept        409437..411245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="A9601_04711"
FT                   /product="GTP-binding protein LepA"
FT                   /EC_number=""
FT                   /note="COG481 Membrane GTPase LepA [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69759"
FT                   /db_xref="GOA:A2BPP8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027518"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPP8"
FT                   /protein_id="ABM69759.1"
FT   gene            411415..412170
FT                   /gene="dppC"
FT                   /locus_tag="A9601_04721"
FT   CDS_pept        411415..412170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="A9601_04721"
FT                   /product="putative ABC transporter, oligopeptides"
FT                   /note="COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components [Amino acid
FT                   transport and metabolism / Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69760"
FT                   /db_xref="GOA:A2BPP9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPP9"
FT                   /protein_id="ABM69760.1"
FT   gene            complement(412173..412844)
FT                   /locus_tag="A9601_04731"
FT   CDS_pept        complement(412173..412844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04731"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /EC_number=""
FT                   /note="COG566 rRNA methylases [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69761"
FT                   /db_xref="GOA:A2BPQ0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPQ0"
FT                   /protein_id="ABM69761.1"
FT                   N"
FT   gene            412941..413144
FT                   /locus_tag="A9601_04741"
FT   CDS_pept        412941..413144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04741"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69762"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPQ1"
FT                   /protein_id="ABM69762.1"
FT   gene            413320..413712
FT                   /locus_tag="A9601_04751"
FT   CDS_pept        413320..413712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04751"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3011 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69763"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPQ2"
FT                   /protein_id="ABM69763.1"
FT   gene            413715..413951
FT                   /locus_tag="A9601_04761"
FT   CDS_pept        413715..413951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04761"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69764"
FT                   /db_xref="InterPro:IPR019882"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPQ3"
FT                   /protein_id="ABM69764.1"
FT   gene            414001..414123
FT                   /locus_tag="A9601_04771"
FT   CDS_pept        414001..414123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04771"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69765"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPQ4"
FT                   /protein_id="ABM69765.1"
FT   gene            414083..415573
FT                   /locus_tag="A9601_04781"
FT   CDS_pept        414083..415573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04781"
FT                   /product="Uncharacterized deoxyribodipyrimidine
FT                   photolyase-like protein"
FT                   /note="COG3046 Uncharacterized protein related to
FT                   deoxyribodipyrimidine photolyase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69766"
FT                   /db_xref="GOA:A2BPQ5"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR007357"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPQ5"
FT                   /protein_id="ABM69766.1"
FT   gene            415679..415858
FT                   /locus_tag="A9601_04791"
FT   CDS_pept        415679..415858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04791"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69767"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPQ6"
FT                   /protein_id="ABM69767.1"
FT                   LDAGCINIGCRLKS"
FT   gene            415878..416021
FT                   /locus_tag="A9601_04801"
FT   CDS_pept        415878..416021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04801"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69768"
FT                   /db_xref="GOA:A2BPQ7"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPQ7"
FT                   /protein_id="ABM69768.1"
FT                   VV"
FT   gene            416073..417389
FT                   /gene="sun"
FT                   /locus_tag="A9601_04811"
FT   CDS_pept        416073..417389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="A9601_04811"
FT                   /product="Sun protein (Fmu protein)"
FT                   /note="COG144 tRNA and rRNA cytosine-C5-methylases
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69769"
FT                   /db_xref="GOA:A2BPQ8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPQ8"
FT                   /protein_id="ABM69769.1"
FT   gene            complement(417399..419168)
FT                   /gene="mrcB"
FT                   /locus_tag="A9601_04821"
FT   CDS_pept        complement(417399..419168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="A9601_04821"
FT                   /product="putative penicillin binding protein"
FT                   /note="COG744 Membrane carboxypeptidase (penicillin-binding
FT                   protein) [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69770"
FT                   /db_xref="GOA:A2BPQ9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPQ9"
FT                   /protein_id="ABM69770.1"
FT                   KFISEIYKIQIKK"
FT   gene            complement(419170..420117)
FT                   /gene="chlG"
FT                   /locus_tag="A9601_04831"
FT   CDS_pept        complement(419170..420117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlG"
FT                   /locus_tag="A9601_04831"
FT                   /product="chlorophyll synthase 33 kD subunit"
FT                   /EC_number=""
FT                   /note="COG382 4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69771"
FT                   /db_xref="GOA:A2BPR0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="InterPro:IPR011799"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPR0"
FT                   /protein_id="ABM69771.1"
FT   gene            complement(420126..420350)
FT                   /locus_tag="A9601_04841"
FT   CDS_pept        complement(420126..420350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69772"
FT                   /db_xref="InterPro:IPR021291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPR1"
FT                   /protein_id="ABM69772.1"
FT   gene            420410..421180
FT                   /gene="hisF"
FT                   /locus_tag="A9601_04851"
FT   CDS_pept        420410..421180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="A9601_04851"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   HisF (cyclase)"
FT                   /note="COG107 Imidazoleglycerol-phosphate synthase [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69773"
FT                   /db_xref="GOA:A2BPR2"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPR2"
FT                   /protein_id="ABM69773.1"
FT   gene            421224..421925
FT                   /gene="ubiE"
FT                   /locus_tag="A9601_04861"
FT   CDS_pept        421224..421925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="A9601_04861"
FT                   /product="Ubiquinone/menaquinone biosynthesis
FT                   methyltransferases"
FT                   /note="COG2226 Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69774"
FT                   /db_xref="GOA:A2BPR3"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032904"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPR3"
FT                   /protein_id="ABM69774.1"
FT                   GGQMGILILTK"
FT   gene            complement(421931..422416)
FT                   /locus_tag="A9601_04871"
FT   CDS_pept        complement(421931..422416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04871"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69775"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPR4"
FT                   /protein_id="ABM69775.1"
FT   gene            422492..423241
FT                   /gene="birA"
FT                   /locus_tag="A9601_04881"
FT   CDS_pept        422492..423241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="A9601_04881"
FT                   /product="putative Biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number=""
FT                   /note="COG340 Biotin-(acetyl-CoA carboxylase) ligase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69776"
FT                   /db_xref="GOA:A2BPR5"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPR5"
FT                   /protein_id="ABM69776.1"
FT   gene            complement(423244..423930)
FT                   /gene="salX"
FT                   /locus_tag="A9601_04891"
FT   CDS_pept        complement(423244..423930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="salX"
FT                   /locus_tag="A9601_04891"
FT                   /product="possible ABC transporter, ATP binding protein"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69777"
FT                   /db_xref="GOA:A2BPR6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPR6"
FT                   /protein_id="ABM69777.1"
FT                   VELKVN"
FT   gene            complement(423947..425467)
FT                   /gene="ndhB"
FT                   /locus_tag="A9601_04901"
FT   CDS_pept        complement(423947..425467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhB"
FT                   /locus_tag="A9601_04901"
FT                   /product="putative NADH dehydrogenase (complex I) subunit
FT                   (chain 2)"
FT                   /EC_number=""
FT                   /note="COG1007 NADH:ubiquinone oxidoreductase subunit 2
FT                   (chain N) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69778"
FT                   /db_xref="GOA:A2BPR7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPR7"
FT                   /protein_id="ABM69778.1"
FT   gene            425643..428249
FT                   /gene="topA"
FT                   /locus_tag="A9601_04911"
FT   CDS_pept        425643..428249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="A9601_04911"
FT                   /product="Prokaryotic DNA topoisomerase"
FT                   /EC_number=""
FT                   /note="COG550 Topoisomerase IA [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69779"
FT                   /db_xref="GOA:A2BPR8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPR8"
FT                   /protein_id="ABM69779.1"
FT   gene            428257..428859
FT                   /locus_tag="A9601_04921"
FT   CDS_pept        428257..428859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04921"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69780"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPR9"
FT                   /protein_id="ABM69780.1"
FT   gene            428880..429518
FT                   /locus_tag="A9601_04931"
FT   CDS_pept        428880..429518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04931"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4241 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69781"
FT                   /db_xref="GOA:A2BPS0"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPS0"
FT                   /protein_id="ABM69781.1"
FT   gene            429531..430688
FT                   /gene="cobT"
FT                   /locus_tag="A9601_04941"
FT   CDS_pept        429531..430688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="A9601_04941"
FT                   /product="NaMN:DMB phosphoribosyltransferase"
FT                   /note="COG2038 NaMN:DMB phosphoribosyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69782"
FT                   /db_xref="GOA:A2BPS1"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPS1"
FT                   /protein_id="ABM69782.1"
FT   gene            430689..431687
FT                   /locus_tag="A9601_04951"
FT   CDS_pept        430689..431687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04951"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69783"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPS2"
FT                   /protein_id="ABM69783.1"
FT   gene            complement(431676..432773)
FT                   /locus_tag="A9601_04961"
FT   CDS_pept        complement(431676..432773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04961"
FT                   /product="Aldo/keto reductase family"
FT                   /note="COG1453 Predicted oxidoreductases of the aldo/keto
FT                   reductase family [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69784"
FT                   /db_xref="GOA:A2BPS3"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPS3"
FT                   /protein_id="ABM69784.1"
FT   gene            432932..433585
FT                   /gene="ribE"
FT                   /locus_tag="A9601_04971"
FT   CDS_pept        432932..433585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="A9601_04971"
FT                   /product="Putative Riboflavin synthase alpha chain"
FT                   /EC_number=""
FT                   /note="COG307 Riboflavin synthase alpha chain [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69785"
FT                   /db_xref="GOA:A2BPS4"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPS4"
FT                   /protein_id="ABM69785.1"
FT   gene            complement(433596..433949)
FT                   /locus_tag="A9601_04981"
FT   CDS_pept        complement(433596..433949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_04981"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69786"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPS5"
FT                   /protein_id="ABM69786.1"
FT                   KKESKTIYLIPLN"
FT   gene            complement(434046..434648)
FT                   /gene="ctaE"
FT                   /locus_tag="A9601_04991"
FT   CDS_pept        complement(434046..434648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaE"
FT                   /locus_tag="A9601_04991"
FT                   /product="Cytochrome c oxidase, subunit III"
FT                   /EC_number=""
FT                   /note="COG1845 Heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 3 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_04991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69787"
FT                   /db_xref="GOA:A2BPS6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPS6"
FT                   /protein_id="ABM69787.1"
FT   gene            complement(434649..436274)
FT                   /gene="cyoB"
FT                   /locus_tag="A9601_05001"
FT   CDS_pept        complement(434649..436274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="A9601_05001"
FT                   /product="Cytochrome c oxidase, subunit I"
FT                   /EC_number=""
FT                   /note="COG843 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 1 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69788"
FT                   /db_xref="GOA:A2BPS7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPS7"
FT                   /protein_id="ABM69788.1"
FT   gene            complement(436271..437074)
FT                   /gene="ctaC"
FT                   /locus_tag="A9601_05011"
FT   CDS_pept        complement(436271..437074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaC"
FT                   /locus_tag="A9601_05011"
FT                   /product="putative cytochrome c oxidase, subunit 2"
FT                   /EC_number=""
FT                   /note="COG1622 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 2 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69789"
FT                   /db_xref="GOA:A2BPS8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPS8"
FT                   /protein_id="ABM69789.1"
FT   gene            437338..438264
FT                   /gene="ctaA"
FT                   /locus_tag="A9601_05021"
FT   CDS_pept        437338..438264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="A9601_05021"
FT                   /product="Uncharacterized protein required for cytochrome
FT                   oxidase assembly"
FT                   /note="COG1612 Uncharacterized protein required for
FT                   cytochrome oxidase assembly [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69790"
FT                   /db_xref="GOA:A2BPS9"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPS9"
FT                   /protein_id="ABM69790.1"
FT   gene            438261..439262
FT                   /gene="cyoE"
FT                   /locus_tag="A9601_05031"
FT   CDS_pept        438261..439262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="A9601_05031"
FT                   /product="putative protoheme IX farnesyltransferase"
FT                   /note="COG109 Polyprenyltransferase (cytochrome oxidase
FT                   assembly factor) [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69791"
FT                   /db_xref="GOA:A2BPT0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPT0"
FT                   /protein_id="ABM69791.1"
FT   gene            439302..440318
FT                   /gene="ccmA"
FT                   /locus_tag="A9601_05041"
FT   CDS_pept        439302..440318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="A9601_05041"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /note="COG1131 ABC-type multidrug transport system, ATPase
FT                   component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69792"
FT                   /db_xref="GOA:A2BPT1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPT1"
FT                   /protein_id="ABM69792.1"
FT   gene            440366..441190
FT                   /locus_tag="A9601_05051"
FT   CDS_pept        440366..441190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05051"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /note="COG1682 ABC-type polysaccharide/polyol phosphate
FT                   export systems, permease component [Carbohydrate transport
FT                   and metabolism / Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69793"
FT                   /db_xref="GOA:A2BPT2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPT2"
FT                   /protein_id="ABM69793.1"
FT   gene            441198..441713
FT                   /locus_tag="A9601_05061"
FT   CDS_pept        441198..441713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05061"
FT                   /product="possible glycoprotein"
FT                   /note="similar to Arenavirus glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69794"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPT3"
FT                   /protein_id="ABM69794.1"
FT                   INNDKKAS"
FT   gene            complement(441717..443462)
FT                   /gene="groL"
FT                   /locus_tag="A9601_05071"
FT   CDS_pept        complement(441717..443462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="A9601_05071"
FT                   /product="GroEL2 protein (Chaperonin cpn60 2)"
FT                   /EC_number=""
FT                   /note="COG459 Chaperonin GroEL (HSP60 family)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69795"
FT                   /db_xref="GOA:A2BPT4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPT4"
FT                   /protein_id="ABM69795.1"
FT                   MPGMM"
FT   gene            443594..443773
FT                   /locus_tag="A9601_05081"
FT   CDS_pept        443594..443773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05081"
FT                   /product="Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69796"
FT                   /db_xref="GOA:A2BPT5"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPT5"
FT                   /protein_id="ABM69796.1"
FT                   RKLRDELGQPYEST"
FT   gene            complement(443774..444523)
FT                   /locus_tag="A9601_05091"
FT   CDS_pept        complement(443774..444523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05091"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number=""
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69797"
FT                   /db_xref="GOA:A2BPT6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPT6"
FT                   /protein_id="ABM69797.1"
FT   gene            444615..445286
FT                   /gene="ispD"
FT                   /locus_tag="A9601_05101"
FT   CDS_pept        444615..445286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="A9601_05101"
FT                   /product="putative 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number=""
FT                   /note="COG1211 4-diphosphocytidyl-2-methyl-D-erithritol
FT                   synthase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69798"
FT                   /db_xref="GOA:A2BPT7"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPT7"
FT                   /protein_id="ABM69798.1"
FT                   P"
FT   gene            complement(445287..446156)
FT                   /locus_tag="A9601_05111"
FT   CDS_pept        complement(445287..446156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05111"
FT                   /product="Putative carboxypeptidase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1619 Uncharacterized proteins, homologs of
FT                   microcin C7 resistance protein MccF [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69799"
FT                   /db_xref="GOA:A2BPT8"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPT8"
FT                   /protein_id="ABM69799.1"
FT                   ILSIYTSF"
FT   gene            complement(446166..447074)
FT                   /gene="ubiA"
FT                   /locus_tag="A9601_05121"
FT   CDS_pept        complement(446166..447074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="A9601_05121"
FT                   /product="probable 4-hydroxybenzoate-octaprenyltransferase"
FT                   /note="COG382 4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69800"
FT                   /db_xref="GOA:A2BPT9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPT9"
FT                   /protein_id="ABM69800.1"
FT   gene            447179..448774
FT                   /gene="ppx"
FT                   /locus_tag="A9601_05131"
FT   CDS_pept        447179..448774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="A9601_05131"
FT                   /product="putative exopolyphosphatase"
FT                   /EC_number=""
FT                   /note="COG248 Exopolyphosphatase [Nucleotide transport and
FT                   metabolism / Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69801"
FT                   /db_xref="GOA:A2BPU0"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPU0"
FT                   /protein_id="ABM69801.1"
FT                   NVIKELKNLELKVI"
FT   gene            complement(448771..449262)
FT                   /locus_tag="A9601_05141"
FT   CDS_pept        complement(448771..449262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69802"
FT                   /db_xref="GOA:A2BPU1"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPU1"
FT                   /protein_id="ABM69802.1"
FT                   "
FT   gene            complement(449318..450073)
FT                   /gene="cobM"
FT                   /locus_tag="A9601_05151"
FT   CDS_pept        complement(449318..450073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /locus_tag="A9601_05151"
FT                   /product="putative precorrin-4 C11-methyltransferase"
FT                   /EC_number=""
FT                   /note="COG2875 Precorrin-4 methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69803"
FT                   /db_xref="GOA:A2BPU2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPU2"
FT                   /protein_id="ABM69803.1"
FT   gene            complement(450066..450959)
FT                   /gene="lgt"
FT                   /locus_tag="A9601_05161"
FT   CDS_pept        complement(450066..450959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="A9601_05161"
FT                   /product="putative prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /note="COG682 Prolipoprotein diacylglyceryltransferase
FT                   [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69804"
FT                   /db_xref="GOA:A2BPU3"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPU3"
FT                   /protein_id="ABM69804.1"
FT                   FFLRLRTYIGKNRKNG"
FT   gene            complement(450970..451923)
FT                   /gene="petA"
FT                   /locus_tag="A9601_05171"
FT   CDS_pept        complement(450970..451923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="A9601_05171"
FT                   /product="Cytochrome f"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69805"
FT                   /db_xref="GOA:A2BPU4"
FT                   /db_xref="InterPro:IPR002325"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR024058"
FT                   /db_xref="InterPro:IPR024094"
FT                   /db_xref="InterPro:IPR036826"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPU4"
FT                   /protein_id="ABM69805.1"
FT   gene            complement(451929..452465)
FT                   /gene="petC"
FT                   /locus_tag="A9601_05181"
FT   CDS_pept        complement(451929..452465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="A9601_05181"
FT                   /product="Rieske iron-sulfur protein"
FT                   /EC_number=""
FT                   /note="COG723 Rieske Fe-S protein [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69806"
FT                   /db_xref="GOA:A2BPU5"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023960"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPU5"
FT                   /protein_id="ABM69806.1"
FT                   WSETDFRTNENPWWA"
FT   gene            452589..452906
FT                   /locus_tag="A9601_05191"
FT   CDS_pept        452589..452906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69807"
FT                   /db_xref="InterPro:IPR021420"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPU6"
FT                   /protein_id="ABM69807.1"
FT                   T"
FT   gene            complement(452875..453633)
FT                   /gene="tatC"
FT                   /locus_tag="A9601_05201"
FT   CDS_pept        complement(452875..453633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="A9601_05201"
FT                   /product="protein secretion component, Tat family"
FT                   /note="COG805 Sec-independent protein secretion pathway
FT                   component TatC [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69808"
FT                   /db_xref="GOA:A2BPU7"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPU7"
FT                   /protein_id="ABM69808.1"
FT   gene            complement(453714..453974)
FT                   /locus_tag="A9601_05211"
FT   CDS_pept        complement(453714..453974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69809"
FT                   /db_xref="GOA:A2BPU8"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPU8"
FT                   /protein_id="ABM69809.1"
FT   gene            complement(454004..455704)
FT                   /locus_tag="A9601_05221"
FT   CDS_pept        complement(454004..455704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05221"
FT                   /product="possible secreted protein MPB70 precursor"
FT                   /note="COG1293 Predicted RNA-binding protein homologous to
FT                   eukaryotic snRNP [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69810"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPU9"
FT                   /protein_id="ABM69810.1"
FT   gene            455778..456332
FT                   /gene="gmk"
FT                   /locus_tag="A9601_05231"
FT   CDS_pept        455778..456332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="A9601_05231"
FT                   /product="Guanylate kinase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG194 Guanylate kinase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69811"
FT                   /db_xref="GOA:A2BPV0"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPV0"
FT                   /protein_id="ABM69811.1"
FT   gene            complement(456510..457064)
FT                   /gene="psaF"
FT                   /locus_tag="A9601_05241"
FT   CDS_pept        complement(456510..457064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaF"
FT                   /locus_tag="A9601_05241"
FT                   /product="Photosystem I PsaF protein (subunit III)"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69812"
FT                   /db_xref="GOA:A2BPV1"
FT                   /db_xref="InterPro:IPR003666"
FT                   /db_xref="InterPro:IPR036577"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPV1"
FT                   /protein_id="ABM69812.1"
FT   gene            457139..458209
FT                   /gene="qri7"
FT                   /locus_tag="A9601_05251"
FT   CDS_pept        457139..458209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qri7"
FT                   /locus_tag="A9601_05251"
FT                   /product="probable o-sialoglycoprotein endopeptidase"
FT                   /EC_number=""
FT                   /note="COG533 Metal-dependent proteases with possible
FT                   chaperone activity [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69813"
FT                   /db_xref="GOA:A2BPV2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPV2"
FT                   /protein_id="ABM69813.1"
FT                   LSIEQADNLYEETPPF"
FT   gene            458215..458391
FT                   /locus_tag="A9601_05261"
FT   CDS_pept        458215..458391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05261"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69814"
FT                   /db_xref="GOA:A2BPV3"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPV3"
FT                   /protein_id="ABM69814.1"
FT                   IIFIIIALISKFS"
FT   gene            458552..459757
FT                   /gene="nhaP"
FT                   /locus_tag="A9601_05271"
FT   CDS_pept        458552..459757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaP"
FT                   /locus_tag="A9601_05271"
FT                   /product="putative Na+/H+ antiporter, CPA1 family"
FT                   /note="COG25 NhaP-type Na+/H+ and K+/H+ antiporters
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69815"
FT                   /db_xref="GOA:A2BPV4"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPV4"
FT                   /protein_id="ABM69815.1"
FT                   FD"
FT   gene            complement(459758..461188)
FT                   /gene="gltX"
FT                   /locus_tag="A9601_05281"
FT   CDS_pept        complement(459758..461188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="A9601_05281"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG8 Glutamyl- and glutaminyl-tRNA synthetases
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69816"
FT                   /db_xref="GOA:A2BPV5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPV5"
FT                   /protein_id="ABM69816.1"
FT                   WELFAESKTDRTRIERCL"
FT   gene            complement(461206..461279)
FT                   /locus_tag="A9601_tRNAAspVIMSS1309079"
FT                   /note="tRNA-Asp"
FT   tRNA            complement(461206..461279)
FT                   /locus_tag="A9601_tRNAAspVIMSS1309079"
FT                   /product="tRNA-Asp"
FT   gene            complement(461429..461623)
FT                   /locus_tag="A9601_05291"
FT   CDS_pept        complement(461429..461623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05291"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69817"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPV6"
FT                   /protein_id="ABM69817.1"
FT   gene            complement(461659..461731)
FT                   /locus_tag="A9601_tRNATrpVIMSS1309078"
FT                   /note="tRNA-Trp"
FT   tRNA            complement(461659..461731)
FT                   /locus_tag="A9601_tRNATrpVIMSS1309078"
FT                   /product="tRNA-Trp"
FT   gene            complement(461785..462264)
FT                   /gene="rplS"
FT                   /locus_tag="A9601_05301"
FT   CDS_pept        complement(461785..462264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="A9601_05301"
FT                   /product="Ribosomal protein L19"
FT                   /note="COG335 Ribosomal protein L19 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69818"
FT                   /db_xref="GOA:A2BPV7"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPV7"
FT                   /protein_id="ABM69818.1"
FT   gene            complement(462288..462596)
FT                   /locus_tag="A9601_05311"
FT   CDS_pept        complement(462288..462596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69819"
FT                   /db_xref="GOA:A2BPV8"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPV8"
FT                   /protein_id="ABM69819.1"
FT   gene            462692..463531
FT                   /gene="map"
FT                   /locus_tag="A9601_05321"
FT   CDS_pept        462692..463531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="A9601_05321"
FT                   /product="putative methionine aminopeptidase"
FT                   /EC_number=""
FT                   /note="COG24 Methionine aminopeptidase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69820"
FT                   /db_xref="GOA:A2BPV9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPV9"
FT                   /protein_id="ABM69820.1"
FT   gene            complement(463535..464254)
FT                   /locus_tag="A9601_05331"
FT   CDS_pept        complement(463535..464254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69821"
FT                   /db_xref="GOA:A2BPW0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPW0"
FT                   /protein_id="ABM69821.1"
FT                   KEFFNYLYCQIIYKYKS"
FT   gene            464410..465519
FT                   /gene="pta"
FT                   /locus_tag="A9601_05341"
FT   CDS_pept        464410..465519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="A9601_05341"
FT                   /product="BioD-like N-terminal domain of
FT                   phosphotransacetylase"
FT                   /note="COG857 BioD-like N-terminal domain of
FT                   phosphotransacetylase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69822"
FT                   /db_xref="GOA:A2BPW1"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPW1"
FT                   /protein_id="ABM69822.1"
FT   gene            465545..466057
FT                   /locus_tag="A9601_05351"
FT   CDS_pept        465545..466057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69823"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPW2"
FT                   /protein_id="ABM69823.1"
FT                   VSLLFFD"
FT   gene            466124..466621
FT                   /locus_tag="A9601_05361"
FT   CDS_pept        466124..466621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05361"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG1666 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69824"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPW3"
FT                   /protein_id="ABM69824.1"
FT                   FR"
FT   gene            466648..466857
FT                   /locus_tag="A9601_05371"
FT   CDS_pept        466648..466857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05371"
FT                   /product="Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69825"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPW4"
FT                   /protein_id="ABM69825.1"
FT   gene            466966..467769
FT                   /gene="hflC"
FT                   /locus_tag="A9601_05381"
FT   CDS_pept        466966..467769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="A9601_05381"
FT                   /product="Band 7 protein"
FT                   /note="COG330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69826"
FT                   /db_xref="GOA:A2BPW5"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPW5"
FT                   /protein_id="ABM69826.1"
FT   gene            complement(467841..469142)
FT                   /gene="hemL"
FT                   /locus_tag="A9601_05391"
FT   CDS_pept        complement(467841..469142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="A9601_05391"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number=""
FT                   /note="COG1 Glutamate-1-semialdehyde aminotransferase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69827"
FT                   /db_xref="GOA:A2BPW6"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPW6"
FT                   /protein_id="ABM69827.1"
FT   gene            complement(469369..470214)
FT                   /gene="xthA"
FT                   /locus_tag="A9601_05401"
FT   CDS_pept        complement(469369..470214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="A9601_05401"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number=""
FT                   /note="COG708 Exonuclease III [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69828"
FT                   /db_xref="GOA:A2BPW7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPW7"
FT                   /protein_id="ABM69828.1"
FT                   "
FT   gene            470287..470580
FT                   /locus_tag="A9601_05411"
FT   CDS_pept        470287..470580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69829"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPW8"
FT                   /protein_id="ABM69829.1"
FT   gene            470612..471211
FT                   /locus_tag="A9601_05421"
FT   CDS_pept        470612..471211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69830"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPW9"
FT                   /protein_id="ABM69830.1"
FT   gene            471263..472495
FT                   /locus_tag="A9601_05431"
FT   CDS_pept        471263..472495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05431"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG1641 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69831"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPX0"
FT                   /protein_id="ABM69831.1"
FT                   GEKFKAFENWK"
FT   gene            472492..473448
FT                   /locus_tag="A9601_05441"
FT   CDS_pept        472492..473448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69832"
FT                   /db_xref="GOA:A2BPX1"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPX1"
FT                   /protein_id="ABM69832.1"
FT   gene            complement(473445..474983)
FT                   /gene="thiP"
FT                   /locus_tag="A9601_05451"
FT   CDS_pept        complement(473445..474983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="A9601_05451"
FT                   /product="putative iron ABC transporter"
FT                   /note="COG1178 ABC-type Fe3+ transport system, permease
FT                   component [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69833"
FT                   /db_xref="GOA:A2BPX2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPX2"
FT                   /protein_id="ABM69833.1"
FT   gene            complement(475010..476161)
FT                   /locus_tag="A9601_05461"
FT   CDS_pept        complement(475010..476161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05461"
FT                   /product="Putative GTPases (G3E family)"
FT                   /note="COG523 Putative GTPases (G3E family) [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69834"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPX3"
FT                   /protein_id="ABM69834.1"
FT   gene            complement(476191..476481)
FT                   /locus_tag="A9601_05471"
FT   CDS_pept        complement(476191..476481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05471"
FT                   /product="4a-hydroxytetrahydrobiopterin dehydratase (PCD)"
FT                   /EC_number=""
FT                   /note="COG2154 Pterin-4a-carbinolamine dehydratase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69835"
FT                   /db_xref="GOA:A2BPX4"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPX4"
FT                   /protein_id="ABM69835.1"
FT   gene            complement(476518..476973)
FT                   /locus_tag="A9601_05481"
FT   CDS_pept        complement(476518..476973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05481"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG432 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69836"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPX5"
FT                   /protein_id="ABM69836.1"
FT   gene            477082..478586
FT                   /locus_tag="A9601_05491"
FT                   /note="carboxypeptidase Taq (M32) metallopeptidase;
FT                   contains frameshift"
FT   gene            478650..479237
FT                   /locus_tag="A9601_05511"
FT   CDS_pept        478650..479237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05511"
FT                   /product="putative inorganic pyrophosphatase"
FT                   /EC_number=""
FT                   /note="COG221 Inorganic pyrophosphatase [Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69837"
FT                   /db_xref="GOA:A2BPX6"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPX6"
FT                   /protein_id="ABM69837.1"
FT   gene            complement(479244..480194)
FT                   /gene="hemC"
FT                   /locus_tag="A9601_05521"
FT   CDS_pept        complement(479244..480194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="A9601_05521"
FT                   /product="Porphobilinogen deaminase"
FT                   /EC_number=""
FT                   /note="COG181 Porphobilinogen deaminase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69838"
FT                   /db_xref="GOA:A2BPX7"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPX7"
FT                   /protein_id="ABM69838.1"
FT   gene            complement(480292..481476)
FT                   /locus_tag="A9601_05531"
FT   CDS_pept        complement(480292..481476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05531"
FT                   /product="Putative principal RNA polymerase sigma factor"
FT                   /note="COG568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32) [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69839"
FT                   /db_xref="GOA:A2BPX8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPX8"
FT                   /protein_id="ABM69839.1"
FT   gene            481797..484073
FT                   /gene="priA"
FT                   /locus_tag="A9601_05541"
FT   CDS_pept        481797..484073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="A9601_05541"
FT                   /product="primosomal protein N' (replication factor Y)"
FT                   /note="COG1198 Primosomal protein N' (replication factor Y)
FT                   - superfamily II helicase [DNA replication, recombination,
FT                   and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69840"
FT                   /db_xref="GOA:A2BPX9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPX9"
FT                   /protein_id="ABM69840.1"
FT                   NPAEL"
FT   gene            complement(484074..485183)
FT                   /locus_tag="A9601_05551"
FT   CDS_pept        complement(484074..485183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69841"
FT                   /db_xref="GOA:A2BPY0"
FT                   /db_xref="InterPro:IPR021499"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPY0"
FT                   /protein_id="ABM69841.1"
FT   gene            complement(485187..486038)
FT                   /gene="argB"
FT                   /locus_tag="A9601_05561"
FT   CDS_pept        complement(485187..486038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="A9601_05561"
FT                   /product="Aspartokinase superfamily:Acetylglutamate kinase"
FT                   /EC_number=""
FT                   /note="COG548 Acetylglutamate kinase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69842"
FT                   /db_xref="GOA:A2BPY1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPY1"
FT                   /protein_id="ABM69842.1"
FT                   VA"
FT   gene            complement(486102..486632)
FT                   /locus_tag="A9601_05571"
FT   CDS_pept        complement(486102..486632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69843"
FT                   /db_xref="GOA:A2BPY2"
FT                   /db_xref="InterPro:IPR021275"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPY2"
FT                   /protein_id="ABM69843.1"
FT                   DDNKKEFDFILFY"
FT   gene            486647..486856
FT                   /locus_tag="A9601_05581"
FT   CDS_pept        486647..486856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69844"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPY3"
FT                   /protein_id="ABM69844.1"
FT   gene            complement(486858..487283)
FT                   /locus_tag="A9601_05591"
FT   CDS_pept        complement(486858..487283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05591"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /note="COG629 Single-stranded DNA-binding protein [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69845"
FT                   /db_xref="GOA:A2BPY4"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPY4"
FT                   /protein_id="ABM69845.1"
FT   gene            487312..488109
FT                   /gene="cobK"
FT                   /locus_tag="A9601_05601"
FT   CDS_pept        487312..488109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobK"
FT                   /locus_tag="A9601_05601"
FT                   /product="possible precorrin-6X reductase"
FT                   /EC_number=""
FT                   /note="COG2099 Precorrin-6x reductase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69846"
FT                   /db_xref="GOA:A2BPY5"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPY5"
FT                   /protein_id="ABM69846.1"
FT   gene            488123..488428
FT                   /gene="cutA"
FT                   /locus_tag="A9601_05611"
FT   CDS_pept        488123..488428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="A9601_05611"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="COG1324 Uncharacterized protein involved in
FT                   tolerance to divalent cations [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69847"
FT                   /db_xref="GOA:A2BPY6"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPY6"
FT                   /protein_id="ABM69847.1"
FT   gene            complement(488434..489435)
FT                   /locus_tag="A9601_05621"
FT   CDS_pept        complement(488434..489435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05621"
FT                   /product="Possible carbohydrate kinase"
FT                   /note="COG524 Sugar kinases, ribokinase family
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69848"
FT                   /db_xref="GOA:A2BPY7"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPY7"
FT                   /protein_id="ABM69848.1"
FT   gene            complement(489451..490761)
FT                   /gene="purA"
FT                   /locus_tag="A9601_05631"
FT   CDS_pept        complement(489451..490761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="A9601_05631"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number=""
FT                   /note="COG104 Adenylosuccinate synthase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69849"
FT                   /db_xref="GOA:A2BPY8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPY8"
FT                   /protein_id="ABM69849.1"
FT   gene            complement(490843..491280)
FT                   /gene="psb27"
FT                   /locus_tag="A9601_05641"
FT   CDS_pept        complement(490843..491280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psb27"
FT                   /locus_tag="A9601_05641"
FT                   /product="possible Photosystem II reaction center Psb27
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69850"
FT                   /db_xref="GOA:A2BPY9"
FT                   /db_xref="InterPro:IPR017488"
FT                   /db_xref="InterPro:IPR025585"
FT                   /db_xref="InterPro:IPR038450"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPY9"
FT                   /protein_id="ABM69850.1"
FT   gene            complement(491307..493109)
FT                   /gene="proS"
FT                   /locus_tag="A9601_05651"
FT   CDS_pept        complement(491307..493109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="A9601_05651"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG442 Prolyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69851"
FT                   /db_xref="GOA:A2BPZ0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BPZ0"
FT                   /protein_id="ABM69851.1"
FT   gene            493284..493634
FT                   /locus_tag="A9601_05661"
FT   CDS_pept        493284..493634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05661"
FT                   /product="possible Helix-turn-helix domain of resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69852"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPZ1"
FT                   /protein_id="ABM69852.1"
FT                   ELKSIRSLLEKE"
FT   gene            493731..493985
FT                   /locus_tag="A9601_05671"
FT   CDS_pept        493731..493985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05671"
FT                   /product="possible Reverse transcriptase (RNA-dependent)"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69853"
FT                   /db_xref="GOA:A2BPZ2"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPZ2"
FT                   /protein_id="ABM69853.1"
FT   gene            493975..494529
FT                   /locus_tag="A9601_05681"
FT   CDS_pept        493975..494529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05681"
FT                   /product="Inorganic pyrophosphatase"
FT                   /EC_number=""
FT                   /note="COG221 Inorganic pyrophosphatase [Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69854"
FT                   /db_xref="GOA:A2BPZ3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPZ3"
FT                   /protein_id="ABM69854.1"
FT   gene            494526..494882
FT                   /gene="arsC"
FT                   /locus_tag="A9601_05691"
FT   CDS_pept        494526..494882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="A9601_05691"
FT                   /product="putative arsenate reductase"
FT                   /EC_number=""
FT                   /note="COG1393 Arsenate reductase and related proteins,
FT                   glutaredoxin family [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69855"
FT                   /db_xref="GOA:A2BPZ4"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPZ4"
FT                   /protein_id="ABM69855.1"
FT                   ILGFNEIEYAKQFL"
FT   gene            494912..495571
FT                   /locus_tag="A9601_05701"
FT   CDS_pept        494912..495571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05701"
FT                   /product="Signal peptidase I"
FT                   /EC_number=""
FT                   /note="COG681 Signal peptidase I [Intracellular trafficking
FT                   and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69856"
FT                   /db_xref="GOA:A2BPZ5"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPZ5"
FT                   /protein_id="ABM69856.1"
FT   gene            complement(495625..496953)
FT                   /gene="gpmB"
FT                   /locus_tag="A9601_05711"
FT   CDS_pept        complement(495625..496953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="A9601_05711"
FT                   /product="possible alpha-ribazole-5'-P phosphatase"
FT                   /EC_number="5.4.2.-"
FT                   /note="COG406 Fructose-2,6-bisphosphatase [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69857"
FT                   /db_xref="GOA:A2BPZ6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPZ6"
FT                   /protein_id="ABM69857.1"
FT   gene            497070..498431
FT                   /locus_tag="A9601_05721"
FT   CDS_pept        497070..498431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05721"
FT                   /product="Possible membrane associated protease"
FT                   /note="COG1266 Predicted metal-dependent membrane protease
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69858"
FT                   /db_xref="GOA:A2BPZ7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPZ7"
FT                   /protein_id="ABM69858.1"
FT   gene            498516..498944
FT                   /locus_tag="A9601_05731"
FT   CDS_pept        498516..498944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69859"
FT                   /db_xref="GOA:A2BPZ8"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPZ8"
FT                   /protein_id="ABM69859.1"
FT   gene            498944..500695
FT                   /locus_tag="A9601_05741"
FT   CDS_pept        498944..500695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05741"
FT                   /product="putative peptidoglycan synthetase (pbp
FT                   transpeptidase domain)"
FT                   /EC_number=""
FT                   /note="COG768 Cell division protein FtsI/penicillin-binding
FT                   protein 2 [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69860"
FT                   /db_xref="GOA:A2BPZ9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A2BPZ9"
FT                   /protein_id="ABM69860.1"
FT                   GMIVKKP"
FT   gene            500762..501787
FT                   /gene="tal"
FT                   /locus_tag="A9601_05751"
FT   CDS_pept        500762..501787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="A9601_05751"
FT                   /product="Transaldolase"
FT                   /EC_number=""
FT                   /note="COG176 Transaldolase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69861"
FT                   /db_xref="GOA:A2BQ00"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ00"
FT                   /protein_id="ABM69861.1"
FT                   N"
FT   gene            complement(501812..502945)
FT                   /gene="fixC"
FT                   /locus_tag="A9601_05761"
FT   CDS_pept        complement(501812..502945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="A9601_05761"
FT                   /product="NAD binding site protein"
FT                   /note="COG644 Dehydrogenases (flavoproteins) [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69862"
FT                   /db_xref="GOA:A2BQ01"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ01"
FT                   /protein_id="ABM69862.1"
FT   gene            complement(502942..503490)
FT                   /gene="frr"
FT                   /locus_tag="A9601_05771"
FT   CDS_pept        complement(502942..503490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="A9601_05771"
FT                   /product="Ribosome recycling factor"
FT                   /note="COG233 Ribosome recycling factor [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69863"
FT                   /db_xref="GOA:A2BQ02"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ02"
FT                   /protein_id="ABM69863.1"
FT   gene            complement(503513..504217)
FT                   /gene="pyrH"
FT                   /locus_tag="A9601_05781"
FT   CDS_pept        complement(503513..504217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="A9601_05781"
FT                   /product="uridylate kinase"
FT                   /note="COG528 Uridylate kinase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69864"
FT                   /db_xref="GOA:A2BQ03"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ03"
FT                   /protein_id="ABM69864.1"
FT                   AVAGEPIGSLIS"
FT   gene            complement(504346..505038)
FT                   /gene="cobO"
FT                   /locus_tag="A9601_05791"
FT   CDS_pept        complement(504346..505038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /locus_tag="A9601_05791"
FT                   /product="possible cob(I)alamin adenosyltransferase"
FT                   /EC_number=""
FT                   /note="COG2109 ATP:corrinoid adenosyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69865"
FT                   /db_xref="GOA:A2BQ04"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ04"
FT                   /protein_id="ABM69865.1"
FT                   KAQKCVEF"
FT   gene            complement(505073..506242)
FT                   /locus_tag="A9601_05801"
FT   CDS_pept        complement(505073..506242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05801"
FT                   /product="Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69866"
FT                   /db_xref="GOA:A2BQ05"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ05"
FT                   /protein_id="ABM69866.1"
FT   gene            506309..507484
FT                   /gene="hemH"
FT                   /locus_tag="A9601_05811"
FT   CDS_pept        506309..507484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="A9601_05811"
FT                   /product="Ferrochelatase"
FT                   /EC_number=""
FT                   /note="COG276 Protoheme ferro-lyase (ferrochelatase)
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69867"
FT                   /db_xref="GOA:A2BQ06"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ06"
FT                   /protein_id="ABM69867.1"
FT   gene            507621..509384
FT                   /gene="ilvB"
FT                   /locus_tag="A9601_05821"
FT   CDS_pept        507621..509384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="A9601_05821"
FT                   /product="Acetolactate synthase large subunit"
FT                   /EC_number=""
FT                   /note="COG28 Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase] [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69868"
FT                   /db_xref="GOA:A2BQ07"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ07"
FT                   /protein_id="ABM69868.1"
FT                   AQMVGYVNCED"
FT   gene            509560..509802
FT                   /locus_tag="A9601_05831"
FT   CDS_pept        509560..509802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05831"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69869"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ08"
FT                   /protein_id="ABM69869.1"
FT   gene            complement(509809..510396)
FT                   /locus_tag="A9601_05841"
FT   CDS_pept        complement(509809..510396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05841"
FT                   /product="DUF152"
FT                   /note="COG1496 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69870"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ09"
FT                   /protein_id="ABM69870.1"
FT   gene            complement(510420..510596)
FT                   /pseudo
FT                   /locus_tag="A9601_pseudoVIMSS1362515"
FT                   /note="Pseudogene derived from P9312_05531"
FT   gene            complement(510614..511519)
FT                   /locus_tag="A9601_05851"
FT   CDS_pept        complement(510614..511519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05851"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69871"
FT                   /db_xref="GOA:A2BQ10"
FT                   /db_xref="InterPro:IPR009472"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ10"
FT                   /protein_id="ABM69871.1"
FT   gene            complement(511516..512721)
FT                   /gene="rps1b"
FT                   /gene_synonym="rpsA2"
FT                   /gene_synonym="nbp1"
FT                   /locus_tag="A9601_05861"
FT   CDS_pept        complement(511516..512721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps1b"
FT                   /gene_synonym="rpsA2"
FT                   /gene_synonym="nbp1"
FT                   /locus_tag="A9601_05861"
FT                   /product="30S ribosomal protein S1 protein B, putative
FT                   Nbp1"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69872"
FT                   /db_xref="GOA:A2BQ11"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ11"
FT                   /protein_id="ABM69872.1"
FT                   DK"
FT   gene            512788..513582
FT                   /locus_tag="A9601_05871"
FT   CDS_pept        512788..513582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05871"
FT                   /product="Creatininase"
FT                   /EC_number=""
FT                   /note="COG1402 Uncharacterized protein, putative amidase
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69873"
FT                   /db_xref="GOA:A2BQ12"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ12"
FT                   /protein_id="ABM69873.1"
FT   gene            513667..514422
FT                   /locus_tag="A9601_05881"
FT   CDS_pept        513667..514422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05881"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69874"
FT                   /db_xref="GOA:A2BQ13"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR022612"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ13"
FT                   /protein_id="ABM69874.1"
FT   gene            514532..515572
FT                   /locus_tag="A9601_05891"
FT   CDS_pept        514532..515572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05891"
FT                   /product="Predicted dehydrogenase"
FT                   /note="COG5322 Predicted dehydrogenase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69875"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR016836"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ14"
FT                   /protein_id="ABM69875.1"
FT                   PKVLTV"
FT   gene            515576..516583
FT                   /gene="accA"
FT                   /locus_tag="A9601_05901"
FT   CDS_pept        515576..516583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="A9601_05901"
FT                   /product="acetyl-CoA carboxylase, alpha subunit"
FT                   /EC_number=""
FT                   /note="COG825 Acetyl-CoA carboxylase alpha subunit [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69876"
FT                   /db_xref="GOA:A2BQ15"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ15"
FT                   /protein_id="ABM69876.1"
FT   gene            516558..517292
FT                   /locus_tag="A9601_05911"
FT   CDS_pept        516558..517292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05911"
FT                   /product="putative short-chain dehydrogenase"
FT                   /note="COG4221 Short-chain alcohol dehydrogenase of unknown
FT                   specificity [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69877"
FT                   /db_xref="GOA:A2BQ16"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ16"
FT                   /protein_id="ABM69877.1"
FT   gene            517446..518186
FT                   /gene="folE"
FT                   /locus_tag="A9601_05921"
FT   CDS_pept        517446..518186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="A9601_05921"
FT                   /product="putative GTP cyclohydrolase I"
FT                   /EC_number=""
FT                   /note="COG302 GTP cyclohydrolase I [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69878"
FT                   /db_xref="GOA:A2BQ17"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ17"
FT                   /protein_id="ABM69878.1"
FT   gene            complement(518183..518839)
FT                   /gene="trpF"
FT                   /locus_tag="A9601_05931"
FT   CDS_pept        complement(518183..518839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="A9601_05931"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number=""
FT                   /note="COG135 Phosphoribosylanthranilate isomerase [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69879"
FT                   /db_xref="GOA:A2BQ18"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ18"
FT                   /protein_id="ABM69879.1"
FT   gene            518895..520118
FT                   /locus_tag="A9601_05941"
FT   CDS_pept        518895..520118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05941"
FT                   /product="Zn-dependent proteases"
FT                   /note="COG1994 Zn-dependent proteases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69880"
FT                   /db_xref="GOA:A2BQ19"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ19"
FT                   /protein_id="ABM69880.1"
FT                   SMKQKGDL"
FT   gene            complement(520115..520774)
FT                   /gene="lplA"
FT                   /locus_tag="A9601_05951"
FT   CDS_pept        complement(520115..520774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /locus_tag="A9601_05951"
FT                   /product="Biotin/lipoate A/B protein ligase family"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69881"
FT                   /db_xref="GOA:A2BQ20"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ20"
FT                   /protein_id="ABM69881.1"
FT   gene            520941..521075
FT                   /locus_tag="A9601_05961"
FT   CDS_pept        520941..521075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05961"
FT                   /product="possible photosystem I reaction centre subunit
FT                   XII (PsaM)"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69882"
FT                   /db_xref="GOA:A2BQ21"
FT                   /db_xref="InterPro:IPR010010"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ21"
FT                   /protein_id="ABM69882.1"
FT   gene            521158..521505
FT                   /locus_tag="A9601_05971"
FT   CDS_pept        521158..521505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05971"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69883"
FT                   /db_xref="GOA:A2BQ22"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ22"
FT                   /protein_id="ABM69883.1"
FT                   ISRDIIRVIWR"
FT   gene            521559..522563
FT                   /locus_tag="A9601_05981"
FT   CDS_pept        521559..522563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_05981"
FT                   /product="Light dependent protochlorophyllide
FT                   oxido-reductase"
FT                   /EC_number=""
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69884"
FT                   /db_xref="GOA:A2BQ23"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR005979"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ23"
FT                   /protein_id="ABM69884.1"
FT   gene            complement(522570..523457)
FT                   /gene="chlL"
FT                   /locus_tag="A9601_05991"
FT   CDS_pept        complement(522570..523457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlL"
FT                   /locus_tag="A9601_05991"
FT                   /product="Protochlorophyllide reductase iron-sulfur
FT                   ATP-binding protein"
FT                   /EC_number=""
FT                   /note="COG1348 Nitrogenase subunit NifH (ATPase) [Inorganic
FT                   ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_05991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69885"
FT                   /db_xref="GOA:A2BQ24"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005971"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ24"
FT                   /protein_id="ABM69885.1"
FT                   PLKDREIFDLLGFD"
FT   gene            complement(523647..525218)
FT                   /gene="chlB"
FT                   /locus_tag="A9601_06001"
FT   CDS_pept        complement(523647..525218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlB"
FT                   /locus_tag="A9601_06001"
FT                   /product="Light-independent protochlorophyllide reductase
FT                   subunit B"
FT                   /note="COG2710 Nitrogenase molybdenum-iron protein, alpha
FT                   and beta chains [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69886"
FT                   /db_xref="GOA:A2BQ25"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005969"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ25"
FT                   /protein_id="ABM69886.1"
FT                   AKAYFN"
FT   gene            complement(525225..526481)
FT                   /gene="chlN"
FT                   /locus_tag="A9601_06011"
FT   CDS_pept        complement(525225..526481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlN"
FT                   /locus_tag="A9601_06011"
FT                   /product="Light-independent protochlorophyllide reductase
FT                   subunit N"
FT                   /note="COG2710 Nitrogenase molybdenum-iron protein, alpha
FT                   and beta chains [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69887"
FT                   /db_xref="GOA:A2BQ26"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005970"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ26"
FT                   /protein_id="ABM69887.1"
FT   gene            complement(526639..527007)
FT                   /locus_tag="A9601_06021"
FT   CDS_pept        complement(526639..527007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69888"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ27"
FT                   /protein_id="ABM69888.1"
FT                   RNVWKLSKISQGNSFYRN"
FT   gene            527105..527875
FT                   /locus_tag="A9601_06031"
FT   CDS_pept        527105..527875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69889"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ28"
FT                   /protein_id="ABM69889.1"
FT   gene            complement(527883..528467)
FT                   /locus_tag="A9601_06041"
FT   CDS_pept        complement(527883..528467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06041"
FT                   /product="HAM1 family protein"
FT                   /EC_number=""
FT                   /note="COG127 Xanthosine triphosphate pyrophosphatase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69890"
FT                   /db_xref="GOA:A2BQ29"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ29"
FT                   /protein_id="ABM69890.1"
FT   gene            528795..529106
FT                   /gene="ccmK"
FT                   /locus_tag="A9601_06051"
FT   CDS_pept        528795..529106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmK"
FT                   /locus_tag="A9601_06051"
FT                   /product="carboxysome shell protein CsoS1"
FT                   /note="COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein [Secondary metabolites
FT                   biosynthesis, transport, and catabolism / Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69891"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ30"
FT                   /protein_id="ABM69891.1"
FT   gene            529175..530590
FT                   /gene="rbcL"
FT                   /locus_tag="A9601_06061"
FT   CDS_pept        529175..530590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcL"
FT                   /locus_tag="A9601_06061"
FT                   /product="Ribulose bisphosphate carboxylase, large chain"
FT                   /EC_number=""
FT                   /note="COG1850 Ribulose 1,5-bisphosphate carboxylase, large
FT                   subunit [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69892"
FT                   /db_xref="GOA:A2BQ31"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ31"
FT                   /protein_id="ABM69892.1"
FT                   FEFDTVDKLDVQG"
FT   gene            530681..531022
FT                   /gene="rbcS"
FT                   /locus_tag="A9601_06071"
FT   CDS_pept        530681..531022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcS"
FT                   /locus_tag="A9601_06071"
FT                   /product="Ribulose bisphosphate carboxylase, small chain"
FT                   /EC_number=""
FT                   /note="COG4451 Ribulose bisphosphate carboxylase small
FT                   subunit [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69893"
FT                   /db_xref="GOA:A2BQ32"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ32"
FT                   /protein_id="ABM69893.1"
FT                   TAFVVFQGR"
FT   gene            531106..533403
FT                   /gene="csoS2"
FT                   /locus_tag="A9601_06081"
FT   CDS_pept        531106..533403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csoS2"
FT                   /locus_tag="A9601_06081"
FT                   /product="carboxysome shell protein CsoS2"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69894"
FT                   /db_xref="InterPro:IPR020990"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ33"
FT                   /protein_id="ABM69894.1"
FT                   GQLVTFSGGARG"
FT   gene            533411..534940
FT                   /gene="csoS3"
FT                   /locus_tag="A9601_06091"
FT   CDS_pept        533411..534940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csoS3"
FT                   /locus_tag="A9601_06091"
FT                   /product="carboxysome shell protein CsoS3"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69895"
FT                   /db_xref="InterPro:IPR014074"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ34"
FT                   /protein_id="ABM69895.1"
FT   gene            534943..535194
FT                   /locus_tag="A9601_06101"
FT   CDS_pept        534943..535194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06101"
FT                   /product="putative carboxysome peptide A"
FT                   /note="COG4576 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein [Secondary metabolites
FT                   biosynthesis, transport, and catabolism / Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69896"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR014076"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ35"
FT                   /protein_id="ABM69896.1"
FT   gene            535213..535461
FT                   /locus_tag="A9601_06111"
FT   CDS_pept        535213..535461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06111"
FT                   /product="putative carboxysome peptide B"
FT                   /note="COG4576 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein [Secondary metabolites
FT                   biosynthesis, transport, and catabolism / Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69897"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR014077"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ36"
FT                   /protein_id="ABM69897.1"
FT   gene            535536..535775
FT                   /locus_tag="A9601_06121"
FT   CDS_pept        535536..535775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69898"
FT                   /db_xref="GOA:A2BQ37"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ37"
FT                   /protein_id="ABM69898.1"
FT   gene            complement(535782..536009)
FT                   /locus_tag="A9601_06131"
FT   CDS_pept        complement(535782..536009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69899"
FT                   /db_xref="InterPro:IPR021483"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ38"
FT                   /protein_id="ABM69899.1"
FT   gene            complement(536095..536487)
FT                   /gene="tdcF"
FT                   /locus_tag="A9601_06141"
FT   CDS_pept        complement(536095..536487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdcF"
FT                   /locus_tag="A9601_06141"
FT                   /product="Putative translation initiation inhibitor, yjgF
FT                   family"
FT                   /note="COG251 Putative translation initiation inhibitor,
FT                   yjgF family [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69900"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ39"
FT                   /protein_id="ABM69900.1"
FT   gene            complement(536512..537423)
FT                   /locus_tag="A9601_06151"
FT   CDS_pept        complement(536512..537423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06151"
FT                   /product="Putative hydroxyacylglutathione hydrolase"
FT                   /EC_number=""
FT                   /note="COG491 Zn-dependent hydrolases, including
FT                   glyoxylases [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69901"
FT                   /db_xref="GOA:A2BQ40"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ40"
FT                   /protein_id="ABM69901.1"
FT   gene            537293..537931
FT                   /gene="hisG"
FT                   /locus_tag="A9601_06161"
FT   CDS_pept        537293..537931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="A9601_06161"
FT                   /product="possible ATP phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="COG40 ATP phosphoribosyltransferase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69902"
FT                   /db_xref="GOA:A2BQ41"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ41"
FT                   /protein_id="ABM69902.1"
FT   gene            537944..539740
FT                   /locus_tag="A9601_06171"
FT   CDS_pept        537944..539740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06171"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69903"
FT                   /db_xref="GOA:A2BQ42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ42"
FT                   /protein_id="ABM69903.1"
FT   gene            539740..540270
FT                   /locus_tag="A9601_06181"
FT   CDS_pept        539740..540270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06181"
FT                   /product="possible acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69904"
FT                   /db_xref="GOA:A2BQ43"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ43"
FT                   /protein_id="ABM69904.1"
FT                   EPRGSKCAFWYAN"
FT   gene            complement(540271..540954)
FT                   /locus_tag="A9601_06191"
FT   CDS_pept        complement(540271..540954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06191"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69905"
FT                   /db_xref="GOA:A2BQ44"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ44"
FT                   /protein_id="ABM69905.1"
FT                   DYYKK"
FT   gene            complement(540960..541571)
FT                   /locus_tag="A9601_06201"
FT   CDS_pept        complement(540960..541571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06201"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3222 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69906"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ45"
FT                   /protein_id="ABM69906.1"
FT   gene            541765..543159
FT                   /gene="dnaA"
FT                   /locus_tag="A9601_06211"
FT   CDS_pept        541765..543159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="A9601_06211"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COG593 ATPase involved in DNA replication initiation
FT                   [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69907"
FT                   /db_xref="GOA:A2BQ46"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ46"
FT                   /protein_id="ABM69907.1"
FT                   DSRKNL"
FT   gene            complement(543162..544397)
FT                   /locus_tag="A9601_06221"
FT   CDS_pept        complement(543162..544397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06221"
FT                   /product="Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69908"
FT                   /db_xref="GOA:A2BQ47"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ47"
FT                   /protein_id="ABM69908.1"
FT                   DQDPINFISSYK"
FT   gene            544450..545814
FT                   /gene="gor"
FT                   /locus_tag="A9601_06231"
FT   CDS_pept        544450..545814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="A9601_06231"
FT                   /product="probable glutathione reductase (NADPH)"
FT                   /EC_number=""
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69909"
FT                   /db_xref="GOA:A2BQ48"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ48"
FT                   /protein_id="ABM69909.1"
FT   gene            complement(545817..546896)
FT                   /gene="ecm27"
FT                   /locus_tag="A9601_06241"
FT   CDS_pept        complement(545817..546896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecm27"
FT                   /locus_tag="A9601_06241"
FT                   /product="putative CaCA family sodium/calcium exchanger"
FT                   /note="COG530 Ca2+/Na+ antiporter [Inorganic ion transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69910"
FT                   /db_xref="GOA:A2BQ49"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ49"
FT                   /protein_id="ABM69910.1"
FT   gene            547016..548065
FT                   /locus_tag="A9601_06251"
FT   CDS_pept        547016..548065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06251"
FT                   /product="Dihydroorotase"
FT                   /EC_number=""
FT                   /note="COG418 Dihydroorotase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69911"
FT                   /db_xref="GOA:A2BQ50"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ50"
FT                   /protein_id="ABM69911.1"
FT                   QWQVEGIAN"
FT   gene            548165..548250
FT                   /locus_tag="A9601_tRNALeuVIMSS1309090"
FT                   /note="tRNA-Leu"
FT   tRNA            548165..548250
FT                   /locus_tag="A9601_tRNALeuVIMSS1309090"
FT                   /product="tRNA-Leu"
FT   gene            548329..548562
FT                   /locus_tag="A9601_06261"
FT   CDS_pept        548329..548562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06261"
FT                   /product="NADH dehydrogenase subunit NdhL (ndhL)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69912"
FT                   /db_xref="GOA:A2BQ51"
FT                   /db_xref="InterPro:IPR019654"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ51"
FT                   /protein_id="ABM69912.1"
FT   gene            548567..548887
FT                   /locus_tag="A9601_06271"
FT   CDS_pept        548567..548887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69913"
FT                   /db_xref="GOA:A2BQ52"
FT                   /db_xref="InterPro:IPR021562"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ52"
FT                   /protein_id="ABM69913.1"
FT                   NP"
FT   gene            548973..549758
FT                   /gene="trpA"
FT                   /locus_tag="A9601_06281"
FT   CDS_pept        548973..549758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="A9601_06281"
FT                   /product="Tryptophan synthase, alpha subunit"
FT                   /EC_number=""
FT                   /note="COG159 Tryptophan synthase alpha chain [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69914"
FT                   /db_xref="GOA:A2BQ53"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ53"
FT                   /protein_id="ABM69914.1"
FT   gene            complement(549840..550196)
FT                   /locus_tag="A9601_06291"
FT   CDS_pept        complement(549840..550196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06291"
FT                   /product="AbrB family transciptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69915"
FT                   /db_xref="GOA:A2BQ54"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ54"
FT                   /protein_id="ABM69915.1"
FT                   LGRKQIRLLPTEES"
FT   gene            550250..550564
FT                   /locus_tag="A9601_06301"
FT   CDS_pept        550250..550564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06301"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG2350 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69916"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ55"
FT                   /protein_id="ABM69916.1"
FT                   "
FT   gene            complement(550759..551079)
FT                   /locus_tag="A9601_06311"
FT   CDS_pept        complement(550759..551079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69917"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ56"
FT                   /protein_id="ABM69917.1"
FT                   SK"
FT   gene            complement(551080..551448)
FT                   /locus_tag="A9601_06321"
FT   CDS_pept        complement(551080..551448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69918"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ57"
FT                   /protein_id="ABM69918.1"
FT                   PSIRARAENKLNKLFPFY"
FT   gene            complement(551486..552409)
FT                   /locus_tag="A9601_06331"
FT   CDS_pept        complement(551486..552409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06331"
FT                   /product="Putative type II alternative sigma factor,
FT                   sigma70 family"
FT                   /note="COG568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32) [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69919"
FT                   /db_xref="GOA:A2BQ58"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ58"
FT                   /protein_id="ABM69919.1"
FT   gene            complement(552585..553244)
FT                   /gene="hisI"
FT                   /locus_tag="A9601_06341"
FT   CDS_pept        complement(552585..553244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="A9601_06341"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG139 Phosphoribosyl-AMP cyclohydrolase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69920"
FT                   /db_xref="GOA:A2BQ59"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ59"
FT                   /protein_id="ABM69920.1"
FT   gene            553306..553776
FT                   /locus_tag="A9601_06351"
FT   CDS_pept        553306..553776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06351"
FT                   /product="6-pyruvoyl-tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69921"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ60"
FT                   /protein_id="ABM69921.1"
FT   gene            complement(553825..556407)
FT                   /gene="clpB"
FT                   /locus_tag="A9601_06361"
FT   CDS_pept        complement(553825..556407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="A9601_06361"
FT                   /product="ATP-dependent Clp protease, Hsp 100, ATP-binding
FT                   subunit ClpB"
FT                   /EC_number=""
FT                   /note="COG542 ATPases with chaperone activity, ATP-binding
FT                   subunit [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69922"
FT                   /db_xref="GOA:A2BQ61"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ61"
FT                   /protein_id="ABM69922.1"
FT   gene            complement(556474..556824)
FT                   /gene="petE"
FT                   /locus_tag="A9601_06371"
FT   CDS_pept        complement(556474..556824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petE"
FT                   /locus_tag="A9601_06371"
FT                   /product="plastocyanin"
FT                   /note="COG3794 Plastocyanin [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69923"
FT                   /db_xref="GOA:A2BQ62"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR001235"
FT                   /db_xref="InterPro:IPR002387"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ62"
FT                   /protein_id="ABM69923.1"
FT                   RGAGMVGKVIVE"
FT   gene            complement(556884..557867)
FT                   /locus_tag="A9601_06381"
FT   CDS_pept        complement(556884..557867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06381"
FT                   /product="Nucleoside-diphosphate-sugar epimerases"
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69924"
FT                   /db_xref="GOA:A2BQ63"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ63"
FT                   /protein_id="ABM69924.1"
FT   gene            complement(557876..558916)
FT                   /gene="hemE"
FT                   /locus_tag="A9601_06391"
FT   CDS_pept        complement(557876..558916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="A9601_06391"
FT                   /product="Uroporphyrinogen decarboxylase (URO-D)"
FT                   /EC_number=""
FT                   /note="COG407 Uroporphyrinogen-III decarboxylase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69925"
FT                   /db_xref="GOA:A2BQ64"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ64"
FT                   /protein_id="ABM69925.1"
FT                   GKKLTY"
FT   gene            complement(559033..561297)
FT                   /gene="glgB"
FT                   /locus_tag="A9601_06401"
FT   CDS_pept        complement(559033..561297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="A9601_06401"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number=""
FT                   /note="COG296 1,4-alpha-glucan branching enzyme
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69926"
FT                   /db_xref="GOA:A2BQ65"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ65"
FT                   /protein_id="ABM69926.1"
FT                   K"
FT   gene            complement(561350..562930)
FT                   /locus_tag="A9601_06411"
FT   CDS_pept        complement(561350..562930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06411"
FT                   /product="Predicted acyl esterases"
FT                   /note="COG2936 Predicted acyl esterases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69927"
FT                   /db_xref="GOA:A2BQ66"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ66"
FT                   /protein_id="ABM69927.1"
FT                   MKMTPFFYK"
FT   gene            complement(562937..563203)
FT                   /pseudo
FT                   /locus_tag="A9601_pseudoVIMSS1362516"
FT                   /note="Pseudogene derived from P9301_06121"
FT   gene            complement(563258..563665)
FT                   /locus_tag="A9601_06421"
FT   CDS_pept        complement(563258..563665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69928"
FT                   /db_xref="InterPro:IPR025567"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ67"
FT                   /protein_id="ABM69928.1"
FT   gene            complement(563677..564120)
FT                   /locus_tag="A9601_06431"
FT   CDS_pept        complement(563677..564120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69929"
FT                   /db_xref="GOA:A2BQ68"
FT                   /db_xref="InterPro:IPR019664"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ68"
FT                   /protein_id="ABM69929.1"
FT   gene            complement(564139..564264)
FT                   /locus_tag="A9601_06441"
FT   CDS_pept        complement(564139..564264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06441"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69930"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ69"
FT                   /protein_id="ABM69930.1"
FT   gene            564236..568132
FT                   /locus_tag="A9601_06451"
FT   CDS_pept        564236..568132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69931"
FT                   /db_xref="GOA:A2BQ70"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ70"
FT                   /protein_id="ABM69931.1"
FT                   NGDWKSQVQLFFRY"
FT   gene            568199..569509
FT                   /gene="proA"
FT                   /locus_tag="A9601_06461"
FT   CDS_pept        568199..569509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="A9601_06461"
FT                   /product="Gamma-glutamyl phosphate reductase"
FT                   /EC_number=""
FT                   /note="COG14 Gamma-glutamyl phosphate reductase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69932"
FT                   /db_xref="GOA:A2BQ71"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ71"
FT                   /protein_id="ABM69932.1"
FT   gene            569521..569883
FT                   /gene="folB"
FT                   /locus_tag="A9601_06471"
FT   CDS_pept        569521..569883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="A9601_06471"
FT                   /product="Possible dihydroneopterin aldolase"
FT                   /EC_number=""
FT                   /note="COG1539 Dihydroneopterin aldolase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69933"
FT                   /db_xref="GOA:A2BQ72"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ72"
FT                   /protein_id="ABM69933.1"
FT                   TGFDGKVSIVRILENK"
FT   gene            569870..570481
FT                   /locus_tag="A9601_06481"
FT   CDS_pept        569870..570481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06481"
FT                   /product="lipase family protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69934"
FT                   /db_xref="GOA:A2BQ73"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ73"
FT                   /protein_id="ABM69934.1"
FT   gene            complement(570474..572561)
FT                   /gene="prlC"
FT                   /locus_tag="A9601_06491"
FT   CDS_pept        complement(570474..572561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="A9601_06491"
FT                   /product="Peptidase family M3"
FT                   /EC_number=""
FT                   /note="COG339 Zn-dependent oligopeptidases [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69935"
FT                   /db_xref="GOA:A2BQ74"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ74"
FT                   /protein_id="ABM69935.1"
FT                   T"
FT   gene            complement(572575..574116)
FT                   /locus_tag="A9601_06501"
FT   CDS_pept        complement(572575..574116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A9601_06501"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 4)"
FT                   /EC_number=""
FT                   /note="COG1008 NADH:ubiquinone oxidoreductase subunit 4
FT                   (chain M) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69936"
FT                   /db_xref="GOA:A2BQ75"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ75"
FT                   /protein_id="ABM69936.1"
FT   gene            complement(574196..575104)
FT                   /gene="thrB"
FT                   /locus_tag="A9601_06511"
FT   CDS_pept        complement(574196..575104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="A9601_06511"
FT                   /product="Homoserine kinase:GHMP kinases putative
FT                   ATP-binding domain-containing protein"
FT                   /EC_number=""
FT                   /note="COG83 Homoserine kinase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69937"
FT                   /db_xref="GOA:A2BQ76"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ76"
FT                   /protein_id="ABM69937.1"
FT   gene            complement(575153..576187)
FT                   /gene="glk"
FT                   /locus_tag="A9601_06521"
FT   CDS_pept        complement(575153..576187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="A9601_06521"
FT                   /product="Putative glucokinase"
FT                   /EC_number=""
FT                   /note="COG837 Glucokinase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69938"
FT                   /db_xref="GOA:A2BQ77"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:A2BQ77"
FT                   /protein_id="ABM69938.1"
FT                   LLKT"
FT   gene            complement(576198..578114)
FT                   /gene="thrS"
FT                   /locus_tag="A9601_06531"
FT   CDS_pept        complement(576198..578114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="A9601_06531"
FT                   /product="Threonyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG441 Threonyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:A9601_06531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM69939"
FT                   /db_xref="GOA:A2BQ78"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BQ78"
FT                   /protein_id="ABM69939.1"
FT                   RTE"
FT   gene            complement(578118..579134)
FT                   /gene="trpS"
FT                   /locus_tag="A9601_06541"
FT   CDS_pept        complement(578118..579134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="A9601_06541"
FT                   /product="Tryptophanyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG180 Tryptophanyl-tRNA synthetase [Translat