(data stored in ACNUC7421 zone)

EMBL: CP000552

ID   CP000552; SV 1; circular; genomic DNA; STD; PRO; 1704176 BP.
XX
AC   CP000552;
XX
PR   Project:PRJNA13617;
XX
DT   21-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Prochlorococcus marinus str. MIT 9515, complete genome.
XX
KW   .
XX
OS   Prochlorococcus marinus str. MIT 9515
OC   Bacteria; Cyanobacteria; Synechococcales; Prochloraceae; Prochlorococcus.
XX
RN   [1]
RP   1-1704176
RX   DOI; 10.1371/journal.pgen.0030231.
RX   PUBMED; 18159947.
RA   Kettler G.C., Martiny A.C., Huang K., Zucker J., Coleman M.L., Rodrigue S.,
RA   Chen F., Lapidus A., Ferriera S., Johnson J., Steglich C., Church G.M.,
RA   Richardson P., Chisholm S.W.;
RT   "Patterns and implications of gene gain and loss in the evolution of
RT   Prochlorococcus";
RL   PloS Genet. 3(12):E231-E231(2007).
XX
RN   [2]
RP   1-1704176
RA   Chisholm S., Huang K., Martiny A., Kettler G., Coleman M., Keller K.,
RA   Arkin A., Coe A., Rodrigue S., Ferriera S., Johnson J., Kravitz S.,
RA   Beeson K., Sutton G., Rogers Y.-H., Friedman R., Frazier M., Venter J.C.;
RT   ;
RL   Submitted (06-NOV-2006) to the INSDC.
RL   J Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; 0dee4b19937b44366e82a472c0c13ba6.
DR   BioSample; SAMN02603924.
DR   EnsemblGenomes-Gn; EBG00001122862.
DR   EnsemblGenomes-Gn; EBG00001122863.
DR   EnsemblGenomes-Gn; EBG00001122864.
DR   EnsemblGenomes-Gn; EBG00001122865.
DR   EnsemblGenomes-Gn; EBG00001122866.
DR   EnsemblGenomes-Gn; EBG00001122867.
DR   EnsemblGenomes-Gn; EBG00001122868.
DR   EnsemblGenomes-Gn; EBG00001122869.
DR   EnsemblGenomes-Gn; EBG00001122870.
DR   EnsemblGenomes-Gn; EBG00001122871.
DR   EnsemblGenomes-Gn; EBG00001122872.
DR   EnsemblGenomes-Gn; EBG00001122873.
DR   EnsemblGenomes-Gn; EBG00001122874.
DR   EnsemblGenomes-Gn; EBG00001122875.
DR   EnsemblGenomes-Gn; EBG00001122876.
DR   EnsemblGenomes-Gn; EBG00001122877.
DR   EnsemblGenomes-Gn; EBG00001122878.
DR   EnsemblGenomes-Gn; EBG00001122879.
DR   EnsemblGenomes-Gn; EBG00001122880.
DR   EnsemblGenomes-Gn; EBG00001122881.
DR   EnsemblGenomes-Gn; EBG00001122882.
DR   EnsemblGenomes-Gn; EBG00001122883.
DR   EnsemblGenomes-Gn; EBG00001122884.
DR   EnsemblGenomes-Gn; EBG00001122885.
DR   EnsemblGenomes-Gn; EBG00001122886.
DR   EnsemblGenomes-Gn; EBG00001122887.
DR   EnsemblGenomes-Gn; EBG00001122888.
DR   EnsemblGenomes-Gn; EBG00001122889.
DR   EnsemblGenomes-Gn; EBG00001122890.
DR   EnsemblGenomes-Gn; EBG00001122891.
DR   EnsemblGenomes-Gn; EBG00001122892.
DR   EnsemblGenomes-Gn; EBG00001122893.
DR   EnsemblGenomes-Gn; EBG00001122894.
DR   EnsemblGenomes-Gn; EBG00001122895.
DR   EnsemblGenomes-Gn; EBG00001122896.
DR   EnsemblGenomes-Gn; EBG00001122897.
DR   EnsemblGenomes-Gn; EBG00001122898.
DR   EnsemblGenomes-Gn; EBG00001122899.
DR   EnsemblGenomes-Gn; EBG00001122900.
DR   EnsemblGenomes-Gn; EBG00001122901.
DR   EnsemblGenomes-Gn; EBG00001122902.
DR   EnsemblGenomes-Gn; EBG00001122903.
DR   EnsemblGenomes-Gn; EBG00001122904.
DR   EnsemblGenomes-Gn; EBG00001122905.
DR   EnsemblGenomes-Gn; EBG00001122906.
DR   EnsemblGenomes-Gn; EBG00001122907.
DR   EnsemblGenomes-Gn; EBG00001122908.
DR   EnsemblGenomes-Gn; EBG00001122909.
DR   EnsemblGenomes-Gn; EBG00001122910.
DR   EnsemblGenomes-Gn; EBG00001122911.
DR   EnsemblGenomes-Gn; EBG00001122912.
DR   EnsemblGenomes-Gn; EBG00001122913.
DR   EnsemblGenomes-Gn; EBG00001122914.
DR   EnsemblGenomes-Gn; EBG00001122915.
DR   EnsemblGenomes-Gn; EBG00001122916.
DR   EnsemblGenomes-Gn; EBG00001122917.
DR   EnsemblGenomes-Gn; EBG00001122918.
DR   EnsemblGenomes-Gn; P9515_rrfVIMSS1309393.
DR   EnsemblGenomes-Gn; P9515_rrlVIMSS1365721.
DR   EnsemblGenomes-Gn; P9515_rrsVIMSS1309392.
DR   EnsemblGenomes-Gn; P9515_tRNAAlaVIMSS1309124.
DR   EnsemblGenomes-Gn; P9515_tRNAAlaVIMSS1309140.
DR   EnsemblGenomes-Gn; P9515_tRNAArgVIMSS1309117.
DR   EnsemblGenomes-Gn; P9515_tRNAArgVIMSS1309121.
DR   EnsemblGenomes-Gn; P9515_tRNAArgVIMSS1309129.
DR   EnsemblGenomes-Gn; P9515_tRNAArgVIMSS1309135.
DR   EnsemblGenomes-Gn; P9515_tRNAAsnVIMSS1309137.
DR   EnsemblGenomes-Gn; P9515_tRNAAspVIMSS1309111.
DR   EnsemblGenomes-Gn; P9515_tRNACysVIMSS1309136.
DR   EnsemblGenomes-Gn; P9515_tRNAGlnVIMSS1309134.
DR   EnsemblGenomes-Gn; P9515_tRNAGluVIMSS1309126.
DR   EnsemblGenomes-Gn; P9515_tRNAGlyVIMSS1309120.
DR   EnsemblGenomes-Gn; P9515_tRNAGlyVIMSS1309123.
DR   EnsemblGenomes-Gn; P9515_tRNAHisVIMSS1309131.
DR   EnsemblGenomes-Gn; P9515_tRNAIleVIMSS1309139.
DR   EnsemblGenomes-Gn; P9515_tRNALeuVIMSS1309118.
DR   EnsemblGenomes-Gn; P9515_tRNALeuVIMSS1309130.
DR   EnsemblGenomes-Gn; P9515_tRNALeuVIMSS1309138.
DR   EnsemblGenomes-Gn; P9515_tRNALeuVIMSS1309141.
DR   EnsemblGenomes-Gn; P9515_tRNALysVIMSS1309127.
DR   EnsemblGenomes-Gn; P9515_tRNAMetVIMSS1309107.
DR   EnsemblGenomes-Gn; P9515_tRNAMetVIMSS1309108.
DR   EnsemblGenomes-Gn; P9515_tRNAMetVIMSS1309116.
DR   EnsemblGenomes-Gn; P9515_tRNAPheVIMSS1309115.
DR   EnsemblGenomes-Gn; P9515_tRNAProVIMSS1309128.
DR   EnsemblGenomes-Gn; P9515_tRNAProVIMSS1309142.
DR   EnsemblGenomes-Gn; P9515_tRNASerVIMSS1309106.
DR   EnsemblGenomes-Gn; P9515_tRNASerVIMSS1309109.
DR   EnsemblGenomes-Gn; P9515_tRNASerVIMSS1309122.
DR   EnsemblGenomes-Gn; P9515_tRNASerVIMSS1309125.
DR   EnsemblGenomes-Gn; P9515_tRNAThrVIMSS1309113.
DR   EnsemblGenomes-Gn; P9515_tRNAThrVIMSS1309114.
DR   EnsemblGenomes-Gn; P9515_tRNAThrVIMSS1309133.
DR   EnsemblGenomes-Gn; P9515_tRNATrpVIMSS1309110.
DR   EnsemblGenomes-Gn; P9515_tRNATyrVIMSS1309112.
DR   EnsemblGenomes-Gn; P9515_tRNAValVIMSS1309119.
DR   EnsemblGenomes-Gn; P9515_tRNAValVIMSS1309132.
DR   EnsemblGenomes-Tr; EBT00001714082.
DR   EnsemblGenomes-Tr; EBT00001714083.
DR   EnsemblGenomes-Tr; EBT00001714084.
DR   EnsemblGenomes-Tr; EBT00001714085.
DR   EnsemblGenomes-Tr; EBT00001714088.
DR   EnsemblGenomes-Tr; EBT00001714089.
DR   EnsemblGenomes-Tr; EBT00001714091.
DR   EnsemblGenomes-Tr; EBT00001714094.
DR   EnsemblGenomes-Tr; EBT00001714095.
DR   EnsemblGenomes-Tr; EBT00001714097.
DR   EnsemblGenomes-Tr; EBT00001714098.
DR   EnsemblGenomes-Tr; EBT00001714100.
DR   EnsemblGenomes-Tr; EBT00001714101.
DR   EnsemblGenomes-Tr; EBT00001714102.
DR   EnsemblGenomes-Tr; EBT00001714104.
DR   EnsemblGenomes-Tr; EBT00001714106.
DR   EnsemblGenomes-Tr; EBT00001714107.
DR   EnsemblGenomes-Tr; EBT00001714108.
DR   EnsemblGenomes-Tr; EBT00001714109.
DR   EnsemblGenomes-Tr; EBT00001714112.
DR   EnsemblGenomes-Tr; EBT00001714113.
DR   EnsemblGenomes-Tr; EBT00001714114.
DR   EnsemblGenomes-Tr; EBT00001714116.
DR   EnsemblGenomes-Tr; EBT00001714118.
DR   EnsemblGenomes-Tr; EBT00001714121.
DR   EnsemblGenomes-Tr; EBT00001714123.
DR   EnsemblGenomes-Tr; EBT00001714126.
DR   EnsemblGenomes-Tr; EBT00001714127.
DR   EnsemblGenomes-Tr; EBT00001714128.
DR   EnsemblGenomes-Tr; EBT00001714130.
DR   EnsemblGenomes-Tr; EBT00001714131.
DR   EnsemblGenomes-Tr; EBT00001714133.
DR   EnsemblGenomes-Tr; EBT00001714135.
DR   EnsemblGenomes-Tr; EBT00001714138.
DR   EnsemblGenomes-Tr; EBT00001714140.
DR   EnsemblGenomes-Tr; EBT00001714142.
DR   EnsemblGenomes-Tr; EBT00001714143.
DR   EnsemblGenomes-Tr; EBT00001714144.
DR   EnsemblGenomes-Tr; EBT00001714146.
DR   EnsemblGenomes-Tr; EBT00001714147.
DR   EnsemblGenomes-Tr; EBT00001714148.
DR   EnsemblGenomes-Tr; EBT00001714150.
DR   EnsemblGenomes-Tr; EBT00001714153.
DR   EnsemblGenomes-Tr; EBT00001714154.
DR   EnsemblGenomes-Tr; EBT00001714155.
DR   EnsemblGenomes-Tr; EBT00001714157.
DR   EnsemblGenomes-Tr; EBT00001714159.
DR   EnsemblGenomes-Tr; EBT00001714160.
DR   EnsemblGenomes-Tr; EBT00001714161.
DR   EnsemblGenomes-Tr; EBT00001714162.
DR   EnsemblGenomes-Tr; EBT00001714164.
DR   EnsemblGenomes-Tr; EBT00001714165.
DR   EnsemblGenomes-Tr; EBT00001714166.
DR   EnsemblGenomes-Tr; EBT00001714167.
DR   EnsemblGenomes-Tr; EBT00001714168.
DR   EnsemblGenomes-Tr; EBT00001714169.
DR   EnsemblGenomes-Tr; EBT00001714170.
DR   EnsemblGenomes-Tr; P9515_rrfVIMSS1309393-1.
DR   EnsemblGenomes-Tr; P9515_rrlVIMSS1365721-1.
DR   EnsemblGenomes-Tr; P9515_rrsVIMSS1309392-1.
DR   EnsemblGenomes-Tr; P9515_tRNAAlaVIMSS1309124-1.
DR   EnsemblGenomes-Tr; P9515_tRNAAlaVIMSS1309140-1.
DR   EnsemblGenomes-Tr; P9515_tRNAArgVIMSS1309117-1.
DR   EnsemblGenomes-Tr; P9515_tRNAArgVIMSS1309121-1.
DR   EnsemblGenomes-Tr; P9515_tRNAArgVIMSS1309129-1.
DR   EnsemblGenomes-Tr; P9515_tRNAArgVIMSS1309135-1.
DR   EnsemblGenomes-Tr; P9515_tRNAAsnVIMSS1309137-1.
DR   EnsemblGenomes-Tr; P9515_tRNAAspVIMSS1309111-1.
DR   EnsemblGenomes-Tr; P9515_tRNACysVIMSS1309136-1.
DR   EnsemblGenomes-Tr; P9515_tRNAGlnVIMSS1309134-1.
DR   EnsemblGenomes-Tr; P9515_tRNAGluVIMSS1309126-1.
DR   EnsemblGenomes-Tr; P9515_tRNAGlyVIMSS1309120-1.
DR   EnsemblGenomes-Tr; P9515_tRNAGlyVIMSS1309123-1.
DR   EnsemblGenomes-Tr; P9515_tRNAHisVIMSS1309131-1.
DR   EnsemblGenomes-Tr; P9515_tRNAIleVIMSS1309139-1.
DR   EnsemblGenomes-Tr; P9515_tRNALeuVIMSS1309118-1.
DR   EnsemblGenomes-Tr; P9515_tRNALeuVIMSS1309130-1.
DR   EnsemblGenomes-Tr; P9515_tRNALeuVIMSS1309138-1.
DR   EnsemblGenomes-Tr; P9515_tRNALeuVIMSS1309141-1.
DR   EnsemblGenomes-Tr; P9515_tRNALysVIMSS1309127-1.
DR   EnsemblGenomes-Tr; P9515_tRNAMetVIMSS1309107-1.
DR   EnsemblGenomes-Tr; P9515_tRNAMetVIMSS1309108-1.
DR   EnsemblGenomes-Tr; P9515_tRNAMetVIMSS1309116-1.
DR   EnsemblGenomes-Tr; P9515_tRNAPheVIMSS1309115-1.
DR   EnsemblGenomes-Tr; P9515_tRNAProVIMSS1309128-1.
DR   EnsemblGenomes-Tr; P9515_tRNAProVIMSS1309142-1.
DR   EnsemblGenomes-Tr; P9515_tRNASerVIMSS1309106-1.
DR   EnsemblGenomes-Tr; P9515_tRNASerVIMSS1309109-1.
DR   EnsemblGenomes-Tr; P9515_tRNASerVIMSS1309122-1.
DR   EnsemblGenomes-Tr; P9515_tRNASerVIMSS1309125-1.
DR   EnsemblGenomes-Tr; P9515_tRNAThrVIMSS1309113-1.
DR   EnsemblGenomes-Tr; P9515_tRNAThrVIMSS1309114-1.
DR   EnsemblGenomes-Tr; P9515_tRNAThrVIMSS1309133-1.
DR   EnsemblGenomes-Tr; P9515_tRNATrpVIMSS1309110-1.
DR   EnsemblGenomes-Tr; P9515_tRNATyrVIMSS1309112-1.
DR   EnsemblGenomes-Tr; P9515_tRNAValVIMSS1309119-1.
DR   EnsemblGenomes-Tr; P9515_tRNAValVIMSS1309132-1.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC2518516; 18769676.
DR   EuropePMC; PMC3390001; 22768379.
DR   EuropePMC; PMC6102989; 29915114.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01067; ATPC.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01704; Downstream-peptide.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000552.
DR   SILVA-SSU; CP000552.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1704176
FT                   /organism="Prochlorococcus marinus str. MIT 9515"
FT                   /strain="MIT 9515"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:167542"
FT   gene            171..1328
FT                   /gene="dnaN"
FT                   /locus_tag="P9515_00001"
FT   CDS_pept        171..1328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="P9515_00001"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG592 DNA polymerase sliding clamp subunit (PCNA
FT                   homolog) [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71209"
FT                   /db_xref="GOA:A2BTU8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTU8"
FT                   /protein_id="ABM71209.1"
FT                   /translation="MEIVCNQNEFNYAIQLVSKAVSSRPTHPILANLLLTADQGTNKIS
FT                   LTGFDLNLGIQTSFDATVKKSGAITIPSKLLAEIVNKLPSETPVSLDVDDSSDNILIKS
FT                   DRGSFNIKGIPSDDYPNLPFVESGTSLNIDPSSFLKALKLTIFASSSDDSKQLLTGVNF
FT                   TFNLKFLESAATDGHRLAVVLVDKKENFDEVADLSSNEDNLSVTIPTRSLREIEKLVSL
FT                   RTSENSIKLFYDKGQVVFISSNQIITTRTLEGSYPNYSQLIPDDFSKLFTFNTKILIDS
FT                   LERIAVLADQQSSVVKIKLEEKGLALISADAQDIGNASEIVPVSYDFDQFDIAFNVRYL
FT                   LEGLKVISSENVLFKCNLSTTPAVLVPEDNISSFTYLVMPVQVRS"
FT   gene            1330..2037
FT                   /locus_tag="P9515_00011"
FT   CDS_pept        1330..2037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71210"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTU9"
FT                   /protein_id="ABM71210.1"
FT                   /translation="MKLPKEFLLSELLSHNVKGNATLNYGIGENVWMHPPVHRILGWYS
FT                   RPSNLDLKRNVWKLNQISQIIDNDIYVKGVPAISDLATLNRFPNLIEANLVNSEGSKIG
FT                   VIADFLFEIKTGNIKFYLISRSNPRIPGSSRWKLNIQNIVDQQPGLVFCSCVSLDDLPL
FT                   IKSSLKYQFLKKGKKIFDRFDEFKNTATNRLENWLEEDEDIIQKEEFNRNSFYNKDDEI
FT                   RSFRNKREDDPWI"
FT   gene            2041..4380
FT                   /locus_tag="P9515_00021"
FT   CDS_pept        2041..4380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00021"
FT                   /product="phosphoribosylformylglycinamidine synthetase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="COG46 Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, synthetase domain [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71211"
FT                   /db_xref="GOA:A2BTV9"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BTV9"
FT                   /protein_id="ABM71211.1"
FT                   /translation="MIDSLNNYNYDVNDSLKVENLTTEDYEEICKRLGRKPNRTELGMF
FT                   GVMWSEHCCYRNSKPLLANFPTTGKNVLVGPGENAGVIDVGNDQKLVFKIESHNHPSAI
FT                   EPFQGAATGVGGILRDIFTMGARPIAVLNSLRFGNLDKSSNISLLRGVVSGISHYGNCV
FT                   GVPTVGGEIYFDDSYSGNPLVNVMALGLLETDEIVCSGAKEVGYPVLYVGNTTGKDGVG
FT                   GASFASSELNTNSLDNRPAVQVGDPFIEKSLIEACLDAFKTGDVIAAQDMGAAGLTCSS
FT                   AEMAANGGLGISINLDLVPARENDMTAYQYLLSESQERMLLVVKEEKLNILIEQFKKWG
FT                   LFANVIGEVISKKEVIISQKNQIVAQIPTSALSDETPINIHKVIKEPPDYLQKKWKWSE
FT                   DELPIITNNKILSFKDKKQYSLSEIILNLLSNPSIASKSWIYKQYDSQVQSNTVFKPGE
FT                   ADAALLRLRAQDERNKNNNFSGVAASVDCNSRWVLLDPYRGSIAAVAESARNVSCVGAE
FT                   PLAITNNLNFSSPNTEIGYWQLSSACDGISKACIALETPVTGGNVSLYNESKNKNNQVT
FT                   PIYPTPVIGMVGKIQNVDKAVSSGWKNINDQIWLIGSYRSESSIGGSSYLDYFHGLITG
FT                   RPPKINLQDEKYCQTFLRDAISKNYISSSHDISDGGLAIALSECCILSSKGANIQLEEK
FT                   NARKDNILFSEGGSRIIFSLNKMEETNFLNFVSINNKNFGSNIYVKKIGFVSEANLTIN
FT                   VQDEELCNLRVDELAEKFNNSISNSF"
FT   gene            4428..5888
FT                   /gene="purF"
FT                   /locus_tag="P9515_00031"
FT   CDS_pept        4428..5888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="P9515_00031"
FT                   /product="Glutamine amidotransferase
FT                   class-II:Phosphoribosyl transferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="COG34 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71212"
FT                   /db_xref="GOA:A2BTW0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTW0"
FT                   /protein_id="ABM71212.1"
FT                   /translation="MCGIVGIVSSDDVNQQIYDSLLLLQHRGQDSTGIATMENTIFHIH
FT                   KAKGYVNTAYRTRDMRNLVGKIGLGHVRYATKGTAESVEEAQPFYVNAPYGIVLIHNGN
FT                   LTNTRDIEKQLFNVDKRHTNSSSDTEMLLNIFATELQEQIRTKELQPEIIFNAVKNLHK
FT                   RIQGSYASIALISGHGLLAFRDPFGIRPLVIGKRISQSNQKNEWMVASESLVLENNDYE
FT                   VVRDVEPGEAIFITQNGEFYSKQCSENPSLFPCAFEYVYLARPDSVMNGISVYKARLKM
FT                   GDYLAETIKKTINSGEVDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRYVGRTFIMP
FT                   GHQKRKQSVRQKLNAMSTEFKNKNVLIVDDSIVRGTTSKQIVQMAKDAGANKVFFTSAA
FT                   PPVRFPHVYGINMPNRDELIAHDRTIAEIAKKLEIDNLVYQSVDNLRKSIINDSSVKDL
FT                   EMSCFTGSYVTGTVNHEYLKWVENEYKS"
FT   gene            complement(5892..8333)
FT                   /locus_tag="P9515_00041"
FT   CDS_pept        complement(5892..8333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00041"
FT                   /product="DNA gyrase/topoisomerase IV, subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="COG188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71213"
FT                   /db_xref="GOA:A2BTW1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTW1"
FT                   /protein_id="ABM71213.1"
FT                   /translation="MTKEKFTSISLQEEMQRSYLEYAMSVIVGRALPDARDGLKPVQRR
FT                   ILFAMHELGLTPDRPFRKCARVVGDVLGKYHPHGDQAVYEALVRLVQDFSTKYPTLDGH
FT                   GNFGSVDNDPPAAMRYTETRLAPIAHECFLQEIETDTVSYSNNFDGSQKEPDILPAQLP
FT                   FLLLNGSSGIAVGMATNIPPHNLGEIIDGLIALIRDKDISDSKLSKIILGPDFPTGGEL
FT                   LYNNGIKNVYLEGRGSITIRGVIKSEEINLGKGKHKRNALIISELPYQISKAGWIEKLA
FT                   ELVNIGKIDGISDIRDESDRDGMRIVIELKKDSNPEIVISNLYKKTTLQSNFGAILLAL
FT                   VNGKPVQLTLRKYLNYFLEFREETIRKRTKYFLKIASEKLEILEGFSIATKNIKNIIEI
FT                   IQNSENVSEAKSILIPKLDLSNKQADAVLSMPLKKLTNLEKKQVENEINQLFEKKKYLS
FT                   TLLNNRSLLLETLIKELIELKKKFNVKRKTKILKDINQSEELDTINNQILEDLIIKDAK
FT                   ISIDNRFYFKKLIYYNYKKLLDQENKFIENKNVQKFICNIKKSLRIIGVTSSGKVLQIN
FT                   WKSIINNVYKLDNKILGNINPKEIINFHDLDSNLENYICIICSDGKFKKVLLDKDMIRS
FT                   TRIFSITKLKNSTKIIDSFIYSQEENIIILTSIGRIFKFNLSNEYLKPSSKQSQGILLV
FT                   NLLPKEQIVSCCKSKEKDLLYLISNKGKFFELKINEVYNSYNSKLGYINEKIQLNNDHF
FT                   IKVLTNNQYIDFETNKNKSARINLTKFSSKPNKNILNVDFLNLEKDEFLENCSSLDNLL
FT                   N"
FT   gene            complement(8421..9275)
FT                   /locus_tag="P9515_00051"
FT   CDS_pept        complement(8421..9275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00051"
FT                   /product="Flp pilus assembly protein TadD, contains TPR
FT                   repeats"
FT                   /note="COG5010 Flp pilus assembly protein TadD, contains
FT                   TPR repeats [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71214"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTW2"
FT                   /protein_id="ABM71214.1"
FT                   /translation="MQKSFIKLLFFSIISCHIFNTQNLRALVPYYHFPDAKHLEQEALS
FT                   IGKQAYQLLYFGQIKDSLNFAKLAVKINDKNENLWLILAEAQTANELYEDAFNSLNNAQ
FT                   KINPKMSEIYFAKSAIYLKQAKIKKAKISLELGIQIAPENFNAIFQLGNIYLMEKDYEK
FT                   ALKEFDKAIEIKKDFWQAINNKGLAYYELNNINLSIISFKKAISIEENAEPLLALASCL
FT                   SIKDINEAIFLAKKALIKEPNYVKYNYRKEQLWGEKLQNSTEKLFENNKLKEEIFIART
FT                   KIN"
FT   gene            complement(9280..10224)
FT                   /locus_tag="P9515_00061"
FT   CDS_pept        complement(9280..10224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00061"
FT                   /product="Uncharacterized Fe-S protein"
FT                   /note="COG1600 Uncharacterized Fe-S protein [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71215"
FT                   /db_xref="GOA:A2BTW3"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTW3"
FT                   /protein_id="ABM71215.1"
FT                   /translation="MKEIIQNKDELSYELKKRAISEGFAVSAIASIPGSSRLKLRTIAL
FT                   ERWLEKNYHGEMKWMEAEKRKNIESLLNGAKSVLTVGFNYLNEEQKEKTKFKVGKFGQG
FT                   EDYHKVIYKKLKNIGKWINNEIPDCKWRICVDTSPLLEKAWAEEAGLGWVGKNSNLINK
FT                   KYGSWLTLGFIILTKDFTPDNSSQSLCGKCEKCIEKCPTNAITEPFVINSDLCIAYHTI
FT                   ENRAQKLPDYIEKNLNGWVAGCDICQDVCPWNKRVPFNKSIEAAPRKWIRNLNIDSLSW
FT                   DEEKWKKNLQGSTLKRIKPWMWKRNIKAILKQE"
FT   gene            10373..11110
FT                   /locus_tag="P9515_00071"
FT   CDS_pept        10373..11110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00071"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG2928 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71216"
FT                   /db_xref="GOA:A2BTW4"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTW4"
FT                   /protein_id="ABM71216.1"
FT                   /translation="MVESTQSQDSNLGTRLQQDLKNDLIAGLLVVIPLATTIWLSSIVS
FT                   KFVLTLVTSVPKQLNPFITLNPLLQDLINLALGLTVPLLAILLIGLMARNFVGRWLLEF
FT                   GEGTLSKIPVAGAVYKTLKQLLETFLSNKSNKFRRVVLVEYPREGLFSVGFVTGDVGPS
FT                   LQSELDKKLLSVFIPTAPNPTTGWYTLVPEASVKDLDISVEDAFRTIISVGIVNPDQKD
FT                   NSSNPTFSKLFSQLRASSNTSST"
FT   gene            11114..11740
FT                   /gene="nusB"
FT                   /locus_tag="P9515_00081"
FT   CDS_pept        11114..11740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="P9515_00081"
FT                   /product="Antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71217"
FT                   /db_xref="GOA:A2BTW5"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTW5"
FT                   /protein_id="ABM71217.1"
FT                   /translation="MHNRSLSRELALLSLGIIKDKGDLVLSNCQIEEIFESALDSLINH
FT                   CRDELDDCEADLENVSQNLLDSELKEGSDSSFANVRDELKKAFHKIESVMNSLSVTLDF
FT                   PKLVVSSNQNDIREDVNHRIKSIIDNLQTIDSEIDEVMDGWRLKRLPRIDRDILRLAYI
FT                   DIHLLDTPIAVACDEAVNLANKYSDTQGRKMINGVLRRLQKVKVK"
FT   gene            11800..13047
FT                   /gene="ftsY"
FT                   /locus_tag="P9515_00091"
FT   CDS_pept        11800..13047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="P9515_00091"
FT                   /product="signal recognition particle docking protein FtsY"
FT                   /note="COG552 Signal recognition particle GTPase
FT                   [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71218"
FT                   /db_xref="GOA:A2BTW6"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTW6"
FT                   /protein_id="ABM71218.1"
FT                   /translation="MTNNESDNAREWASQAYALLKQKQEEQKQEEQKQEEQKQQEQKQQ
FT                   EQKQQEQKQQEQKQEEVYKQDFSNVKYETAAKLGEFDDEFTWSAMVLAAQGKKANEISI
FT                   DEIDWLSKLRKGLEETRKGFVTELLDKLGDDPLTPESLDDLETLLIRADVGIDSTDKVI
FT                   DSLRKKLNEEVVGGEEGIKFLKGELRAIIDKPIKDSGINILVPQKGKLNVWLIVGVNGV
FT                   GKTTTLGKLAYLSSKSNYKTLIAAADTFRAAAVEQLQVWGHRSKVEVISNQSKNADPAA
FT                   VVFDALNAANKRNSDLLLVDTAGRLQTKNNLMDELSKIKRIIDKKVPDAIVESLLVLDA
FT                   SQGQNGLKQAKSFAKSANLSGAVITKLDGTSRGGVSLAVSAEVNLPIRFIGAGEGIKDL
FT                   RPFNSFEFVEALLADR"
FT   gene            13190..14461
FT                   /gene="rsbU"
FT                   /locus_tag="P9515_00101"
FT   CDS_pept        13190..14461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /locus_tag="P9515_00101"
FT                   /product="Protein phosphatase 2C domain"
FT                   /note="COG2208 Serine phosphatase RsbU, regulator of sigma
FT                   subunit [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71219"
FT                   /db_xref="GOA:A2BTW7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTW7"
FT                   /protein_id="ABM71219.1"
FT                   /translation="MPIDKNDKFVEIASSLAYYLKSFSNIKRFLDYISLILKHIFNEQL
FT                   SLIIPLNEKGEIWKENIKFSGDTKNFKIDSEIKSYLKNFDFSKNFRFKEIDSLEKIFNN
FT                   KFKEYVIKSHKILSRGKCRGFLYTFNYGIYDESLINERNLKFIISCLAVGLENYWLLKT
FT                   KKKHENVDREISIGAEIQSQLLPDYCPIIFGVDLAAHCRPALQLGGDYYDFMSLKTNIS
FT                   EKRREKARWALVIGDVMGKGIPAGLLMTMLRGMLRAEVLTGLPPDRILHDLNQLAIYDL
FT                   DQSHRFVTLFYSDYDPRTRKLRYANAAHNPPLLWKSSEQKIIKLDSEGFVLGLQNDAEY
FT                   QCGQIQLSKNDAILYYTDGVTETSNALGERFDEERLMKSFSKLCKQSLKSKEILHKIFK
FT                   ILDEFTGKNRQLEDDASIVVFQLD"
FT   gene            14522..15901
FT                   /gene="argH"
FT                   /locus_tag="P9515_00111"
FT   CDS_pept        14522..15901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="P9515_00111"
FT                   /product="Fumarate lyase:Delta crystallin"
FT                   /EC_number="4.3.2.1"
FT                   /note="COG165 Argininosuccinate lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71220"
FT                   /db_xref="GOA:A2BTV0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BTV0"
FT                   /protein_id="ABM71220.1"
FT                   /translation="MSKVWSNRFESSLNPFIEEFNASIGFDKTLIFEDIDCSIAHAKML
FT                   GKTKVLSADESQKIIEGLENIKQDFIKGEFSPGAPSEDIHYSIEEKLIDLIGDTGKKLH
FT                   TGRSRNDQVGTDIRLWLRKKIDTIDNLLAELQNSLFAVAESNIYTLIPGYTHMQRAQPL
FT                   SLAHHFLAYLEMFQRDRERLREVRARVNISPLGAAALAGTKIKIDRYFTASELGFDNIY
FT                   KNSIDAVSDRDFCIEFASASALIMSHLSRISEEIILWVTDEFSFAKLTDKCATGSSLMP
FT                   QKKNPDVPELIRGKTGRVYGNLHTLLTLIKGVPLAYNKDFQEDKEPIFDTVDTISSCLK
FT                   AMRILLDEGIEFNVDKLIDSVNNDFSNATDLADYLVSKQVPFRKAYQIVGDIVKYCLTK
FT                   NILFKDLNLSEFQTFHDEFKEDIYENLNPMNVVKSRNSVGGTGFEQVEIELNNWKKKLF
FT                   T"
FT   gene            16018..16686
FT                   /locus_tag="P9515_00121"
FT   CDS_pept        16018..16686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00121"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71221"
FT                   /db_xref="GOA:A2BTV1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTV1"
FT                   /protein_id="ABM71221.1"
FT                   /translation="MSIFVGNLPFRAEREDILELFTPYGEVMNCSLPLERDTGRKRGFA
FT                   FVEMADEALETTAIEGLQGTELMGRPLRINKAEPRGGGGQRRGGGGGRGGGYGGGGNGG
FT                   GYGGGGNGGGYGGGGNGGGYGGGGNGGGYGGGGNGGGYGGGGNGGGYGGGGNGGGYGGG
FT                   GYGGGYSEPASNYANKSSGAEGWEDRSYGNSSENSEFENGRSRRKRSVINNSEISQEGN
FT                   "
FT   gene            complement(16683..17687)
FT                   /locus_tag="P9515_00131"
FT   CDS_pept        complement(16683..17687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00131"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /note="COG42 tRNA-dihydrouridine synthase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71222"
FT                   /db_xref="GOA:A2BTV2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTV2"
FT                   /protein_id="ABM71222.1"
FT                   /translation="MKSYLPNSINNLHKISVAPMMDCTDKHFRMIIRQISSKALLYTEM
FT                   IVAQSLVYTDKKEKFLNFNKEEHPLSIQFGGDNPQMLKEAAKMAQDWGYDEINFNVGCP
FT                   SPRVCSGNFGASLMKEPAKVAKCIESLKNNCNLPITIKHRIGVDEEDSFDQLNTFVKEV
FT                   ANAGAERFTVHARKAILKGLNPKQNRTIPPLRYDVVQKLKENNPQLLIEINGGFTNIDQ
FT                   CIKALERLDGVMIGRSVYKYPLRWSQIDNKIYGKNITSKSASEIIFSLIPYIENHLQNG
FT                   GKTWDICKHLINLVEGIPNAKIWRNQISSRSIKQELSIDALIKLTLELKKLGY"
FT   gene            17715..18209
FT                   /locus_tag="P9515_00141"
FT   CDS_pept        17715..18209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00141"
FT                   /product="Domain of unknown function DUF25"
FT                   /EC_number="1.8.4.11"
FT                   /note="COG229 Conserved domain frequently associated with
FT                   peptide methionine sulfoxide reductase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71223"
FT                   /db_xref="GOA:A2BTV3"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTV3"
FT                   /protein_id="ABM71223.1"
FT                   /translation="MNQFLSRRSFILIPAMSILKFFLKPKKVLASSTASEEDWNLSKEE
FT                   WKNKLSPESYYILREEGTERAFSSQLNNEKRKGIFACAGCNQHLFTSDTKFDSGTGWPS
FT                   FWDPINGSVETKVDFKLIVPRTEYHCSRCEGHQGHVFNDGPLPTGKRYCNNGLALKFIA
FT                   E"
FT   gene            18286..19005
FT                   /gene="grpE"
FT                   /locus_tag="P9515_00151"
FT   CDS_pept        18286..19005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="P9515_00151"
FT                   /product="Heat shock protein GrpE"
FT                   /note="COG576 Molecular chaperone GrpE (heat shock protein)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71224"
FT                   /db_xref="GOA:A2BTV4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BTV4"
FT                   /protein_id="ABM71224.1"
FT                   /translation="MIEEQSDNVENKDENVSMDNNISENLPIAEEQTNEDKKLPDDNNE
FT                   KIDAEDLKNTITNNDARLEQLEKEHETLKSQYVRIAADFDNFRKRQSRDQDDLKIQLVS
FT                   KALTAILPIVDNFERARQQLKPEGDEAQTLHRSYQGLYKQLVEVLKQQGVAPMRVVGQQ
FT                   FDPNLHEAVLREPSEEQNEDIIIEELQRGYHLEGKVLRHALVKVSMGPGQQISQESEEK
FT                   DKVDKDIDSEGSISEEN"
FT   gene            19037..20161
FT                   /gene="dnaJ"
FT                   /locus_tag="P9515_00161"
FT   CDS_pept        19037..20161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="P9515_00161"
FT                   /product="DnaJ protein"
FT                   /note="COG484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71225"
FT                   /db_xref="GOA:A2BTV5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTV5"
FT                   /protein_id="ABM71225.1"
FT                   /translation="MADFYQILGVSRDADANTLKSAYRKLARQYHPDVNKDPGAEDKFK
FT                   EIGKAYEALADPETRARYDQFGEAGIGGAAGMPDMGDMGGFGDLFETFFNGFGGQSSQG
FT                   GRSQRRGPQQGDDLRYDLNIDFKDAIFGQQREIKIPHLETCDICRGSGAKKGTGPINCT
FT                   TCGGSGQVRRATRTPFGNFTQVAECPTCNGVGQVISDPCASCGGNGVKQVRKKLRINIP
FT                   AGVDSGTKLRVSGEGNVGLKGGPPGDLYVFIKVKSDPNLKRDGINIYSEISVSYLQAIL
FT                   GDTLDIMTVDGKVNLKIPSGTQPNSTLSLENKGVPRLGNPVARGNHQVLVKVKLPTRIT
FT                   DEERNLLENLASKYSEHNSNSNSGLFSKLFGKES"
FT   gene            20158..20391
FT                   /locus_tag="P9515_00171"
FT   CDS_pept        20158..20391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71226"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTV6"
FT                   /protein_id="ABM71226.1"
FT                   /translation="MKEVSKILNLESIPCPLNVVKCKLALEKLSKNEALIVHLDKGEPE
FT                   VMVKRALKEMKFFIKTIEEDQKSIKFKILHES"
FT   gene            20381..21298
FT                   /locus_tag="P9515_00181"
FT   CDS_pept        20381..21298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00181"
FT                   /product="Predicted GTPase"
FT                   /note="COG1162 Predicted GTPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71227"
FT                   /db_xref="GOA:A2BTV7"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTV7"
FT                   /protein_id="ABM71227.1"
FT                   /translation="MKVEKKYKGLVIKKFNEFFLVESYQKYNSDSNKNFLCKIRKSVNF
FT                   RNQLVFVGDEVILSQIDTTRKRAIIESLVKRKNLLERPSVANISNIYVICSVQEPKLNL
FT                   SQVNRFLISAEQMGVEVSLVLTKCDLITEQKRILLVEKFKKWGYQAITLNLNSPKNFTN
FT                   LMIELKKKKCSIFIGPSGVGKTTLLNMIIPGLNNTTASVSSKIKRGKNTTRNVELFSLS
FT                   SKSYIVDTPGFNMQTLEIDIRELPNLYPEIYRQVVIKGIHCKFRNCLHINDQGCNLNKN
FT                   FERYTFYKEMIESFKSHYCPIQAD"
FT   gene            complement(21264..21614)
FT                   /locus_tag="P9515_00191"
FT   CDS_pept        complement(21264..21614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00191"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG718 Uncharacterized protein conserved in bacteria
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71228"
FT                   /db_xref="GOA:A2BTV8"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BTV8"
FT                   /protein_id="ABM71228.1"
FT                   /translation="MAGFGLPNFGQLTEAFKKAKEIQQNAQKLQDELESMEIEGKSDDE
FT                   MIKVWISGNQLPLRVEVKDTIAESNKEEIEKNILEAIKKAHETSTTTMKERMNDLTGGL
FT                   NLNLPGLDNNDS"
FT   gene            complement(21636..22526)
FT                   /gene="murB"
FT                   /locus_tag="P9515_00201"
FT   CDS_pept        complement(21636..22526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="P9515_00201"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="COG812 UDP-N-acetylmuramate dehydrogenase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71229"
FT                   /db_xref="GOA:A2BTW8"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTW8"
FT                   /protein_id="ABM71229.1"
FT                   /translation="MENINLEEKINLSNYTTIKVGGFAEYFSQPNDVDEFINLIKWAHV
FT                   NNQKCRIIGAGSNLLINNIFLKGLTICTKKMRSIKLQSETGIVVAEAGVMLPKMSNMLA
FT                   KHGLQGGEWTVGIPGTVGGAIYMNAGSEKMSLANNLISVQVIDTKTLKIFEIEKNDINF
FT                   QYRFSPFQQNNLLVISAKLLFEPNGNIEKLLETTKKNLKQKTDKQPYDLPSFGSVFKNP
FT                   TNTYAGQLIEELGLKGFKIGGAEISTMHGNFIVNKSSANSKDILDLITVIQQKVLQKKG
FT                   IFLQPEVRMIGFDYP"
FT   gene            complement(22542..23951)
FT                   /gene="murC"
FT                   /locus_tag="P9515_00211"
FT   CDS_pept        complement(22542..23951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="P9515_00211"
FT                   /product="Probable UDP-N-acetylmuramate-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="COG773 UDP-N-acetylmuramate-alanine ligase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71230"
FT                   /db_xref="GOA:A2BTW9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTW9"
FT                   /protein_id="ABM71230.1"
FT                   /translation="MNTNLIVRGHFHFIGIGGIGMSAIALALIKKGYSVSGSDLVKNEE
FT                   TNKLKEFGAIIFDSQISTNIQFVLSQFQNQTINFVISSAIKDDNEELCFCKKNNLLIKH
FT                   RSEILAMIMKSYITLSIAGSHGKTSTSTFLSTLLELCTHDSSSITGGIIPIYKSNAHIE
FT                   NTKYLVTEIDESDGTINNYTSNIGIINNIDFDHCDHYSNIDEILSSFKQFASNSKKLLI
FT                   NYDCKITRENFTSHNQWSIKEKNNITYSIIPNTINKDITIGKYYEHGDFVDSINIPIPG
FT                   LHNLSNITAAIAACRMIGVSFKEIKKNIKSLELPKKRFEFRGELNQRVFYDDYAHHPNE
FT                   IKATIDLARLFIIDNNINKNQKGRLIAIFQPHRFTRVKQFIHEFVQELSKADVIYLTNI
FT                   FGAGEENIDNINSQVIANLIYKKNKNVTCLKNNYEIKDKFFKLTKENDFILNMGAGDCH
FT                   KLWSILNNKNT"
FT   gene            24149..25171
FT                   /gene="gap2"
FT                   /locus_tag="P9515_00221"
FT   CDS_pept        24149..25171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap2"
FT                   /locus_tag="P9515_00221"
FT                   /product="Glyceraldehyde 3-phosphate
FT                   dehydrogenase(NADP+)(phosphorylating)"
FT                   /EC_number="1.2.1.12"
FT                   /EC_number="1.2.1.13"
FT                   /note="COG57 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71231"
FT                   /db_xref="GOA:A2BTX0"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTX0"
FT                   /protein_id="ABM71231.1"
FT                   /translation="MTLRVAINGFGRIGRNFMRCWLSRGSYTNIEVVGINVTSDPKTNA
FT                   HLLKYDSVLGKLDGVDIQYTDDTFVINNKTIKCFSDRNPMNLPWKDWGVDLVIESTGVF
FT                   NTDVGASKHLEVGAKKVILTAPGKGSGVGTYVVGVNADQYNHSDYDILSNASCTTNCLA
FT                   PVVKVLDQTFGINKGLMTTIHSYTGDQRILDNSHRDLRRARAAATNIVPTSTGAAKAVA
FT                   LVYPEMTGKLTGIAMRVPTPNVSAVDFVFESSKSVTSEEVNNALKESSLSSMKGIIKYG
FT                   DEPLVSSDYAGTNESSIVDADLTMSIGDNLVKVLAWYDNEWGYSQRVVDLAEIVAKKWE
FT                   "
FT   gene            complement(25172..26158)
FT                   /gene="thiL"
FT                   /locus_tag="P9515_00231"
FT   CDS_pept        complement(25172..26158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="P9515_00231"
FT                   /product="putative thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="COG611 Thiamine monophosphate kinase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71232"
FT                   /db_xref="GOA:A2BTX1"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTX1"
FT                   /protein_id="ABM71232.1"
FT                   /translation="MHKELLEDIGEKELIKRLAEFMPENQVSDDCAFVKTKNTNLLINT
FT                   DSLVENIHFNNDTISAIDIGWKAVACNVSDLISSGCNKIIGITIGLVVPSNTDWIWIKD
FT                   LYTGINLALDHFGGLILGGDCSVGKEKVISVTALGTQGELKLRRNSCKPKEIILTTGIH
FT                   GLSKLGLMIKNKTNFDKNISLTKSLVNSSLQQFRKPKLKTEFLKKVLKARPNKSIDTIG
FT                   CTDSSDGLFQALLDLATESNCKAIIDYKKIPKHKNWPKGDKWDEYYFFGGEDYELVFSL
FT                   PRKWADNLLCTDKTITEIGYFINGDAAIDFKNCNNKNLFTNKSFSHF"
FT   gene            complement(26151..27242)
FT                   /locus_tag="P9515_00241"
FT   CDS_pept        complement(26151..27242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00241"
FT                   /product="Cyclophilin-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /note="COG652 Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) - cyclophilin family [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71233"
FT                   /db_xref="GOA:A2BTX2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTX2"
FT                   /protein_id="ABM71233.1"
FT                   /translation="MQNFLSNQNKRYLLLFLILIQVCFLKPTQVLADLPTGNAVKDPNA
FT                   ILRNALPIKQVELQEIQHKLEDTSDLVRGGRWPALSKTVTKCQSLLKKYKNRIIEELPI
FT                   EKQKSVEKTFLDLKNDFDNLQDQAKSKDKYSFITTRKEALEKIGGIEEYFLPNEFPYSI
FT                   PSEFDDLPRLLGRAKVKIKTSKGDMQAIIDGFNAPLTAGAFIDLSSKNFYSNLPINRAE
FT                   EFFVLQTGDPVGNEIGYVDPETNLERHVPLEIRIPDESETFYNETFEELGLYTETPTLP
FT                   FATLGTLGWSHSSTSVNDGSSQFFFFLYEAELNPAGRNLIDGRNAAFGYVIEGSEVLEE
FT                   LTKDDTIISIDVLSGMDKLKLNA"
FT   gene            27286..27846
FT                   /gene="efp"
FT                   /locus_tag="P9515_00251"
FT   CDS_pept        27286..27846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="P9515_00251"
FT                   /product="Elongation factor P (EF-P)"
FT                   /note="COG231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71234"
FT                   /db_xref="GOA:A2BTX3"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BTX3"
FT                   /protein_id="ABM71234.1"
FT                   /translation="MISSNDFRTGTTIEIDGQVWRVVEFLHVKPGKGSAFVRTKLKSVR
FT                   NGNVVEKTFRAGESVQQAVLEKSNLQHTYVESGDYVFMDMTSFEETRLSSDQIGRGSKY
FT                   LKEGMEVNVIFYKDKVLEVELPISITLKVTETDPGVKGDTASGGTKPAILETGAQVMVP
FT                   LFISVGEMIKVDTRNDSYLGREN"
FT   gene            27846..28352
FT                   /gene="accB"
FT                   /locus_tag="P9515_00261"
FT   CDS_pept        27846..28352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="P9515_00261"
FT                   /product="Biotin / Lipoyl attachment:Acetyl-CoA biotin
FT                   carboxyl carrier subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG511 Biotin carboxyl carrier protein [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71235"
FT                   /db_xref="GOA:A2BTX4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTX4"
FT                   /protein_id="ABM71235.1"
FT                   /translation="MAMKLDHDDLDRLIEKISTSDIQEFSLEGEDFKLEIKRNLFDKNY
FT                   LNTNSTTNNSSEKQIIAPPIAPIDSISLSDNATATPTAPPGRSDLTDIVSPMVGTFYRA
FT                   AAPGEDPFVELGSKINVGQTICILEAMKLMNEIESEFNAEIVEILVENGTPVEFGQVLM
FT                   RVKQS"
FT   gene            complement(28329..29369)
FT                   /gene="pdxA"
FT                   /locus_tag="P9515_00271"
FT   CDS_pept        complement(28329..29369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="P9515_00271"
FT                   /product="putative pyridoxal phosphate biosynthetic protein
FT                   PdxA"
FT                   /EC_number="1.1.1.262"
FT                   /note="COG1995 Pyridoxal phosphate biosynthesis protein
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71236"
FT                   /db_xref="GOA:A2BTX5"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTX5"
FT                   /protein_id="ABM71236.1"
FT                   /translation="MSNKRNTIDDRLKVIISVGDDSGIGPEIILKALSSKEIPNNIDTL
FT                   IVGSKINLKNTYKKLKSLGVQNIVDPSNYQIHDIEIPFEINKPKQSNGNSSFFYLKKAI
FT                   EIVQKYRNAALVTGPICKKSWALAGHNYSGQTELLAESCQVNNFGMLFTAKSPITNWRF
FT                   NTLLATTHIPLCEVPKQLSTKLIHSKLNLLATFCKNYVEKPILKIAGLNPHAGEEGILG
FT                   SEEHDWINDAVNSWSEQNKDVHLLGPISPDTCWNSSAKAWREDKAPTHNGILAMYHDQG
FT                   LIPIKVIALNYSVNTTLGLPFIRTSPDHGTGFDIAGKGIAQSQSMVEAIKTAIDLTKGS
FT                   RLFNAH"
FT   gene            complement(29462..30343)
FT                   /locus_tag="P9515_00281"
FT   CDS_pept        complement(29462..30343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00281"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71237"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTX6"
FT                   /protein_id="ABM71237.1"
FT                   /translation="MIDLASPLTIKNKFVIFGGGFSGDYFAKSIRKLGCTALTSSRSAN
FT                   NDPNSFIFNSENNLLPEDSILDGVTHILSCIPPDKNGNDPVLKSLKNKINNLSVKWVGY
FT                   LSTTGVYGNTHGDWVSEKDEPNPLQQRSQRRLNCEKEWIHSNLPIQIFRLPGIYGPGRS
FT                   TLEAITTKKIKVIHKDNQVFSRIHVADIANAIIYLIQNKNKLDFHQIINIADDEPCSQI
FT                   EVIRYGYQLLGLRMPKKILFEEAKKDLSPIAQSFWLENRRVSNKLLCEELGYKLIYKNY
FT                   QVGLDNCLINIK"
FT   gene            30372..30617
FT                   /locus_tag="P9515_00291"
FT   CDS_pept        30372..30617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00291"
FT                   /product="possible Transcription factor TFIID (or TATA-b"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71238"
FT                   /db_xref="GOA:A2BTX7"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTX7"
FT                   /protein_id="ABM71238.1"
FT                   /translation="MKKMQTLNQPEVKVKIASFDNSTYKVKRKLNKTKFGLFFKFYQKL
FT                   FPILLSSCAFLIFPEAPKHSEVLCQKYHSIEACNVW"
FT   gene            complement(30618..31019)
FT                   /locus_tag="P9515_00301"
FT   CDS_pept        complement(30618..31019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00301"
FT                   /product="HNH endonuclease:HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71239"
FT                   /db_xref="GOA:A2BTX8"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTX8"
FT                   /protein_id="ABM71239.1"
FT                   /translation="MHINDAIFLEDLCPKFRLRQWRKSIHQFTGDSCIYCGKPSESIDH
FT                   VIPRSQGGQSTTENCVPACLPCNGDKSNENALYWYRKQKFYDPRRAMAIRAWLDGDLRL
FT                   AIRLLQWANPSFKDKTENYKIAENKYNTA"
FT   gene            complement(31190..31609)
FT                   /locus_tag="P9515_00311"
FT   CDS_pept        complement(31190..31609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00311"
FT                   /product="type II secretion system protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71240"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTX9"
FT                   /protein_id="ABM71240.1"
FT                   /translation="MKRCIKVKLLLPIVAIFVPTLLFIPKASAGSFGAEIFCTMRDGGN
FT                   DHESSWQSAYSYIKKQKGGLFKTSPKQAAGQIIETVVRERDKFSYCVEYLDQLHPDRKL
FT                   QMENNRKEKRKKQEERLREKENINYSEESFDRYSY"
FT   gene            complement(31667..32179)
FT                   /locus_tag="P9515_00321"
FT   CDS_pept        complement(31667..32179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71241"
FT                   /db_xref="GOA:A2BTY0"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTY0"
FT                   /protein_id="ABM71241.1"
FT                   /translation="MSNINLIYYLIAGATFGAFALKTGIPAAPLAGALIGTSILSISGK
FT                   IEAATWPNGTRTLLEIAIGTVIGTSLTKNSLFELQNLWKPAILITFTLVLTGLAIGLWT
FT                   SRLLKVDIITTILGAAPGGISGMSLVGSEYGVGTAVAALHAVRLVTVLLILPLIVKMLT
FT                   LAGVIKS"
FT   gene            32452..32649
FT                   /locus_tag="P9515_00331"
FT   CDS_pept        32452..32649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71242"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTY1"
FT                   /protein_id="ABM71242.1"
FT                   /translation="MASQISYKGNKNPIKKKLSFFEGGHQLEKLEFALAVAQTQGDLEK
FT                   ARSLRKKIVELGGNVEEPGT"
FT   gene            complement(32651..33814)
FT                   /gene="dhsS"
FT                   /locus_tag="P9515_00341"
FT   CDS_pept        complement(32651..33814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhsS"
FT                   /locus_tag="P9515_00341"
FT                   /product="soluble hydrogenase small subunit"
FT                   /EC_number="1.12.1.2"
FT                   /note="COG75 Serine-pyruvate aminotransferase/archaeal
FT                   aspartate aminotransferase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71243"
FT                   /db_xref="GOA:A2BTY2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTY2"
FT                   /protein_id="ABM71243.1"
FT                   /translation="MAIQQKLSLMIPGPTPVPEKVLEALGRHPIGHRSKDFQDLVEITT
FT                   KNLQWLHQTKNDVLTITGSGTAAMEAGIISTLSKGDKVICGENGKFGQRWVKVAQEFGL
FT                   EVIKIDAKWGSPLDPENFKKILEKDYKKEIKAVILTHSETSTGVINDLKTISSHIRNHK
FT                   KALSIIDCVTSIGACDVPVDEWELDIVASGSQKGYMIPPGLSFVSMSQKAWKASEASNL
FT                   PKFYLNLKSYKKSLSSNSNPYTPAVNLVFALNEALNMMKDEGLDSIFARHKKHRLAVSE
FT                   AAKTLNLQLFADENHLSPSVTAIQIKDIDAEQFRKTIKTKYDILLAGGQDHLKGKIFRV
FT                   GHLGYINDRDVISVIAAIGNTLVELNKISTEQVGEALKIASFHLKVT"
FT   gene            33875..34993
FT                   /gene="cbiD"
FT                   /locus_tag="P9515_00351"
FT   CDS_pept        33875..34993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiD"
FT                   /locus_tag="P9515_00351"
FT                   /product="CbiD protein"
FT                   /note="COG1903 Cobalamin biosynthesis protein CbiD
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71244"
FT                   /db_xref="GOA:A2BTY3"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BTY3"
FT                   /protein_id="ABM71244.1"
FT                   /translation="MKKGFSLPLWVTGAAKSAVKKLTGLPFEDYELIKIPNDKNLIKIK
FT                   VHSAGLIKDESHALGISFADSGLDLDVTQNLEIWTIAFLEKTYEKDNNSLDLINIIPGY
FT                   GVGIDQKTSEICISKFAKEVLFENLLEILPAGYKLNLEIIFPNGKFLAERTSNQSFGIV
FT                   QGLSIIGTSAETFSSASPDQLKNAKAQLEKIVSHDFYETIIFVIGENGLHLAKSSNIKF
FT                   PIIKVGNWIGPLLVDAALKKIKRVILFGYHGKLIKLAGGIFHTHNHLADARIEILVYLA
FT                   VKEEVPIEMIKKLSLASNVEDALLLLESSSPSLADKLWNKLSDTVEKRSSEYLKRYITT
FT                   DMKVAAIIFDRQRKIRWSGDNGKDYISSFKGF"
FT   gene            35042..36628
FT                   /locus_tag="P9515_00361"
FT   CDS_pept        35042..36628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00361"
FT                   /product="Glutamine amidotransferase class-I:GMP synthase"
FT                   /EC_number="6.3.4.1"
FT                   /EC_number="6.3.5.2"
FT                   /note="COG519 GMP synthase, PP-ATPase domain/subunit
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71245"
FT                   /db_xref="GOA:A2BTY4"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BTY4"
FT                   /protein_id="ABM71245.1"
FT                   /translation="MGKNLLKKERDPSILILDFGSQYSELIARRIREANVFSLVVSNFI
FT                   STKEIQDINPQGIILSGGPNSVYEDNAPKCDQNIFNLGIPVLGICYGMQLMVKELGGTV
FT                   TPANNRSEYGRAPIKIDFESDLLSSVKDKSIMWMSHGDSINHLPNGFIKIAHTENTLHA
FT                   AISNKEKKLFGVQFHPEVIHSEYGMTVIKNFVYSISKCKADWNTETFLEETIPRIKEQV
FT                   GDKKVLLALSGGVDSSTLAFLLNKAIGKQLTCMFIDQGFMRKGEPEFLMEFFAKKFHIK
FT                   VEYINARERFLHKLNGVTDPEEKRKIIGGEFIRVFEEESHRLGPFEYLAQGTLYPDVIE
FT                   SAGTNLDPKTGERIAVKIKSHHNVGGLPKDLQFKLVEPLRKLFKDEVRKLGNALGLPDE
FT                   IIKRHPFPGPGLAIRILGEVSIEKLNCLRDADWIVRDEIKKAGLYNDIWQAFAVLLPVK
FT                   TVGVMGDKRTYAWPVVLRCVSSEDGMTADWSRIPYETLERISNRIVNEVAQVNRVVFDI
FT                   TSKPPGTIEWE"
FT   gene            complement(36830..39763)
FT                   /locus_tag="P9515_00371"
FT   CDS_pept        complement(36830..39763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00371"
FT                   /product="Hypothetical protein"
FT                   /note="COG1061 DNA or RNA helicases of superfamily II
FT                   [Transcription / DNA replication, recombination, and
FT                   repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71246"
FT                   /db_xref="GOA:A2BTY5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039442"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTY5"
FT                   /protein_id="ABM71246.1"
FT                   /translation="MATFDEFYASLDPDIGIRGKQFEKFVKWFLKTDPTWASQIDEVWL
FT                   WNDYPKRWGADCGIDLIFTQKNGKTWAVQSKCVSPNNDIKKSEIDSFLSESSDSKIDGR
FT                   LLIASTDGIGKNAQQVINRQEKQVVCFLLEQFRQSEIEFPSSMEDLNQGKRKKKKTPRP
FT                   HQIEAIEKVSERLKTADRGQVLMACGTGKTLTSLWIKEKMKAKQVLVLVPSLSLLSQTL
FT                   KEWNSEANHDFKWICVCSDKSVAKDKKEDEWISNTSEIGVPVTNDPLEIKLFLDESSPK
FT                   VVFSTYQSAQLIVEAQEHHDTDDFDLVIADEAHRCAGKVSDSFGSVLDERKIKASKRLF
FT                   FTATPRILSKQIKTQAKINEISVISMDDKSLFGDIFYQLNFSKAIEKKLLSDYQVVVVG
FT                   VDDPMVHEKINNRDLVTIPDELNTDAETLASHIALAKATKDHKLNRLITFHSRINSARE
FT                   FAHQHNKIINWLSQFENFQSNNFITNISGDMPAKERNKRINKLKNIDGNELGILCNARC
FT                   LSEGVDVPNLDGIAFIDPRKSQIDIIQAVGRAIRKSEDKSIGTIVIPVYLADMDKPEEK
FT                   ILESKFKDVWQIILALKCQDDSLLQTIDLLRVNLGIDQRQTGGKSGLEKIIFDLPNKIS
FT                   KNFANSIQTLLIRNTSDDWLEKFGEYKSFVDTNNLMIANRDPAFLNWVKDQRKFKNKGF
FT                   LSKDRINLLDSINFNWKPDEENWENKLKQLKEFKLKHGHVIPPHRSEVGRWLHGQKKLY
FT                   KNGKLPKKYINLLNNLNINWDIKISEGWDSNFEKLKLFKLEHGHSNPPKEHSLYLWTMS
FT                   ERSRSKGKNYPKKRLELLRDIGFVFDLRKDYFNQKIKDLKEFKLKYGHANPPQSDEALG
FT                   KWVNRLRNDYKKNKLLQSEINLLEELGFVFDTQKEFLNRKIKDLREFQSSNGNTFPPKY
FT                   SPLGKWVTRRRLDYKNGKLSKEIKNLLESIRGWVWEEKKSHEFPKRK"
FT   gene            39856..40464
FT                   /locus_tag="P9515_00381"
FT   CDS_pept        39856..40464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00381"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71247"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTY6"
FT                   /protein_id="ABM71247.1"
FT                   /translation="MEGSVYVLTNPAMPNMVKIGKTTRDVELRLADLYSTGVPLPFECE
FT                   YAAKVKDVDKTEKAFHTAFEPSRVNPKREFFNINPEQAIAVLSLMAIEDVTPSVQDEAK
FT                   KIDVEASASAEKFKKKRRPTINYFEMGLKEGDILKFGRNEEFCKVLNGRQVSYQGEPWF
FT                   LSNLTNKLLDRTGPMDGSPYWYFNGKNLKDIYNETYSID"
FT   gene            complement(40817..41134)
FT                   /locus_tag="P9515_00391"
FT   CDS_pept        complement(40817..41134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00391"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71248"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTY7"
FT                   /protein_id="ABM71248.1"
FT                   /translation="MLRLLPLPIFICIYLFSWWRCKKNIIASDKQLKPCIDWAYLKNLP
FT                   LPPKPSFIEFYIVYVSSFLKFPFGIIIQQLPFAKKVRYYEREMKLIFDKWNLEKIKKIK
FT                   N"
FT   gene            41351..41818
FT                   /locus_tag="P9515_00401"
FT   CDS_pept        41351..41818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00401"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTY8"
FT                   /protein_id="ABM71249.1"
FT                   /translation="MGKETYQITEYVHDQVIAHCIAFGLIGTDEPKEDKNNLIDFYELE
FT                   SFNPPDTIQVATFFLEKTSTKKIYYYVCSFPEEPFKASHQEGYVLFSIMWLDYDKYWSR
FT                   VPWYSCSASSEQPLPPLHKEAANWMLEQITKKGCWNAEADFFKMGKLEILI"
FT   gene            complement(42380..44248)
FT                   /locus_tag="P9515_00411"
FT   CDS_pept        complement(42380..44248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00411"
FT                   /product="Hypothetical protein"
FT                   /note="COG1835 Predicted acyltransferases [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71250"
FT                   /db_xref="GOA:A2BTY9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTY9"
FT                   /protein_id="ABM71250.1"
FT                   /translation="MSVKIKDNKSYIKNRYRSEIDGLRAFAVITVIINHFNKEILPGGY
FT                   LGVDIFFVISGFVITSSLYQRPSKNFRDFISGFYERRIKRLVPALSVFVFITSIFICLF
FT                   NPVPRSSLLTGLTSLFGLSNLYLLKQSTDYFAQSIELNIFTHTWSLGVEEQFYILFPFL
FT                   IWFSGFGRQTKNGARNLFLTVGALTITSLIGFLYLYQINQSTAYFSMPTRFWEMALGCL
FT                   LFIELQKRKSTGEFLEKVPPLLVLALIVGIMFLPMSWATESTVAVVGLSAVLIASMTKG
FT                   TVAYTFFTNPKVVYVGLISYSLYLWHWGILSISRWTIGIHWWSVPFQIALIFGTAIASY
FT                   RYVETPLRKGNWYGKRWKTIIFGGGMIVTVASVLITLGKPLKGKLFIGNQYNKWNMKNY
FT                   RETKITHNSTLPTIYLIGDSHTGHYGAVMTHLANKKEFNFIMHPQGDGLKLLNTGMEEH
FT                   VLAPLREYKNNFKKEDIIIFSAHIDKYRNGRDWTKQYQTFVNQTQNIGMKFFLISPTPT
FT                   FTKLKGGYTCQEEWFRPSWAISPLCFGELKKSEWFASNKISIGKIKQFLLKNKKISYVD
FT                   IFSILCPEQYCKNHNNNTIRYRDENHLTSEEAMKLSDTIETFIRSK"
FT   gene            45009..45191
FT                   /locus_tag="P9515_00421"
FT   CDS_pept        45009..45191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00421"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71251"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTZ0"
FT                   /protein_id="ABM71251.1"
FT                   /translation="MKLFNQFNILPRYLTAFNYAGLNLNETPKELDKCTPEFQNFWDKE
FT                   CREHPTNQNCLIYCD"
FT   gene            complement(45328..45432)
FT                   /locus_tag="P9515_00431"
FT   CDS_pept        complement(45328..45432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00431"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71252"
FT                   /db_xref="GOA:A2BTZ1"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTZ1"
FT                   /protein_id="ABM71252.1"
FT                   /translation="MILPSPQIAIGLLLISIGTVVTFNIKINLFQGKE"
FT   gene            46152..46868
FT                   /locus_tag="P9515_00441"
FT   CDS_pept        46152..46868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71253"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTZ2"
FT                   /protein_id="ABM71253.1"
FT                   /translation="MDEVIKLSRSTVEKYLNCPRCCVLDKKHKIKPPSLPFTLNIAVDN
FT                   LCKNEFDYYRDLQEPHPLFLKHNIEAVPFKHEDIDIWRSNFKGIRYKSFEHQYDFGGAV
FT                   DDVWQKKNGELIIVDVKATSRNNFDWLETFNKYDYAKAYKRQLEMYQWLFRKNGFKVAD
FT                   EAYLLYFNGKKNEKFFNNQLKFDVHFIKLDCSSLWVESKVIQTVKLLRSNDFPLPSLNC
FT                   EYCNYLKKRWQLSKIN"
FT   gene            46955..47563
FT                   /locus_tag="P9515_00451"
FT   CDS_pept        46955..47563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71254"
FT                   /db_xref="GOA:A2BTZ3"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTZ3"
FT                   /protein_id="ABM71254.1"
FT                   /translation="MVKPNSSNNKISNHLQQDIVKIGGKTIFINPFLYWRRFDENTNRW
FT                   LREPGQMSEEQIQPNRNRFYPEIDWADLSQDQKLIKDASIEMFLKTLELISTFHPQLNS
FT                   GQLLEVERKMAITKKLPFERWVKKSFAKKARAEESEKRKFQRDRFIRSWKEWLILENTQ
FT                   QALLPIIVIIFISAFIGWASGVSKNSCNPYFEPNLDQSI"
FT   gene            47676..47834
FT                   /locus_tag="P9515_00461"
FT   CDS_pept        47676..47834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00461"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71255"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTZ4"
FT                   /protein_id="ABM71255.1"
FT                   /translation="MFMDNKDKEQDISNSELNKENRQNDYKFLVHKLKSIKAIINMLEK
FT                   HFLEKEI"
FT   gene            47983..49629
FT                   /locus_tag="P9515_00471"
FT   CDS_pept        47983..49629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00471"
FT                   /product="Putative penicillin-binding protein"
FT                   /note="COG768 Cell division protein FtsI/penicillin-binding
FT                   protein 2 [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71256"
FT                   /db_xref="GOA:A2BTZ5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTZ5"
FT                   /protein_id="ABM71256.1"
FT                   /translation="MSDENRIRLIATQPIRGRIIDKNGFILADSRLIYSLIIKPQYVNE
FT                   RLWQKYKSNISKLLNISSDALQKKYSDGLENNQFSITLLDDLKVEQVIKFQENEKMLNG
FT                   LEISSKIIRNYPYKNVASHVIGYTQPITDSEFNILSKKGYKLNDLIGRTGIEFVFEDHI
FT                   RGEWGGEMIEVNSSGTFTKSLGTKPSKQGKDIELTIDLNLQLIAEDMLKDKKGGAIIVM
FT                   DPRDGAIIVMASKPSFDLNFFSKDFKPQKEYDALFNSPAKPLFNRALNAYDPGSVWKIV
FT                   TAIAGLESGKFPPETFLETKPCITYGSQCFREHNDLGFGTIGYEDALRVSSNTFFYQIG
FT                   YGVGVDEIYNASKKLGFASLSGIEISEQENIGLVASSQWAKEGRGWGEPGRTPWVPEDI
FT                   ASMSIGQFVVQVTPIQIARAYAAIANGGYLVTPYLVKKEGQPLSYQRPIKIDIDPNNIQ
FT                   IVKNGLRKVVESGTGVAINYGVSNLPPVSGKTGTAEDGEGGPDHAWFVCFTPSENSELL
FT                   IVAFAQNTPGGGSVHALPMAREILKVWNNKK"
FT   gene            complement(49663..50187)
FT                   /locus_tag="P9515_00481"
FT   CDS_pept        complement(49663..50187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00481"
FT                   /product="possible reductase"
FT                   /note="COG431 Predicted flavoprotein [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71257"
FT                   /db_xref="GOA:A2BTZ6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTZ6"
FT                   /protein_id="ABM71257.1"
FT                   /translation="MTTSKDLIIISASCGKNLELAQKFQEKSNELKINSEILDLTTFDI
FT                   PLFNPRFHSKEDIPVEIIEIKEKLFTIEKWIICAPEYNGSIPPILSNLIAWLSVSGDDF
FT                   RNLFNGQPIAIATFSGGVGLELLTTLRIQLVHLGSQVLGRQLLSSFSKPVDINTVEDII
FT                   KRLTQMKKLKL"
FT   gene            complement(50206..52008)
FT                   /locus_tag="P9515_00491"
FT   CDS_pept        complement(50206..52008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00491"
FT                   /product="flavoprotein"
FT                   /note="COG426 Uncharacterized flavoproteins [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71258"
FT                   /db_xref="GOA:A2BTZ7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTZ7"
FT                   /protein_id="ABM71258.1"
FT                   /translation="MSGINKGLLLQNKNLSTFEITDNITCIRFLDHNKERFELEFNLEK
FT                   GTSFNTFLIRSNDELFIIHPPEKNYSKTIIKIISTIFDNFNLDKVHIITGHINPKIIET
FT                   IKAISTKFNKLSITCSNPGFKLISELWNQKNPNSTKFIEVQLPIFNVIKKELHLELEST
FT                   GLELIPVPTARWPGGLIIYETDQEILISEKIFSAHIATTDWSETNRISTEIERKHFYDC
FT                   LMAPMSNQIVTIAEKISELEIKTIAPLHGPTIEYSLKSFLNDYIRWGENLSTNNPKISL
FT                   IYASAYGNTASIGDALAKGINRTAVEVDSINCEFTSNDELIQSIQNADGYLIGSPTLGG
FT                   HAPTPIVSALGTLLSEGNRDKPVGIFGSFGWSGEAIDLLETKLKDGGFKFSFDPIRIKF
FT                   SPNKPKIKELEEIGTHFGRKILKKAKQKIRKSDTGMISSKTDPTFQALGRVLGSLCVLT
FT                   ASKGTKENNIKGAMLASWVSQASFSPPGLSISVAKDRSVESLLQIGDSFALNILSDKDF
FT                   REPLKRFTKPFSPGEDRFEGLDIELTPNNQIIIPDSLAWLEASIKERMECGDHWVIYAE
FT                   VLHGNILKSDCLTAVHHRKSGANY"
FT   gene            complement(52026..53801)
FT                   /locus_tag="P9515_00501"
FT   CDS_pept        complement(52026..53801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00501"
FT                   /product="flavoprotein"
FT                   /note="COG426 Uncharacterized flavoproteins [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71259"
FT                   /db_xref="GOA:A2BTZ8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A2BTZ8"
FT                   /protein_id="ABM71259.1"
FT                   /translation="MITSAKTSTSDMIKVEQKLSVQYKTFAADSSAIRSLDWERSRFDI
FT                   EFGLRNGTTYNSFIIQGQKLAIIDTSHSKFKKLWFEQLLKEVNPEKIDYLITSHTEPDH
FT                   SGLIGNLLSLNPHITVVGSKLALKFIEDQIHVPFKSLEVKSGQYLDLGDNPTSGVNHNI
FT                   EFISAPNLHWPDTIFSYDHGTNVLYTCDAFGLHYCSDEFFDSNQKEIYDDFRFYYDCLM
FT                   GPNARSVLQAIKRINKLPELKTIAVGHGPLLHNQVNFWKDKYLEWSANKSKGNEFVSVC
FT                   YISDYGYCDRLSQAISHGISKADAQVQLIDLRSSDSQELTGLITESKAVVIPTWPVNSD
FT                   NDLKESLGTLFAALKPKQFTAVYDAFGGDDEPIDSLSNKLRELGQKEAFSPLRVRNIPD
FT                   PIIYQQFEEAGTDLGQLINKKKNIASMKSLDSNLDKALGRLSGGLYVVTASQGENSTFR
FT                   QSAMVASWVSQASFSPPGITVAVAKDRAIESFMQVGKGFVVNILREDNYQKMFRHFLKR
FT                   FAPGADRFADVDVISNIANGGPVLSDSLAFLDCKVSSRLETPDHWIIYGIVENGSVSDL
FT                   SCKTAVHHRKVANHY"
FT   gene            53916..56576
FT                   /gene="alaS"
FT                   /locus_tag="P9515_00511"
FT   CDS_pept        53916..56576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="P9515_00511"
FT                   /product="Alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="COG13 Alanyl-tRNA synthetase [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71260"
FT                   /db_xref="GOA:A2BTZ9"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BTZ9"
FT                   /protein_id="ABM71260.1"
FT                   /translation="MKSQSQATPITGDEIRKAFLDFYESKSHLIIPSSSLIPDDPTVML
FT                   TIAGMLPFKPVFLGLRNRPSPRASSSQKCLRTNDIENVGVTARHHTFFEMLGNFSFGDY
FT                   FKKEAIQWAWELITDIYHLKPENIIISVFHEDHESEKIWRDNIGIIPERIIRLDEKDNF
FT                   WSSGATGPCGPCSELYYDFNPEKGLKNIDLEDGDRFIEFYNLVFMQYNRDSNGMLSDLK
FT                   FKNIDTGMGLERMAQILQKKTNNYETDLILPIVKEAALIANIDYFSSDDRTKISLKILG
FT                   DHTRAIIHLISDGVVASNLGRGYILRRLLRRMIRHGRLLAIKDDFLSRLASIGISLMQN
FT                   TYPDLKNNKERILREINIEEKRFLETLDRGEKLLNDLIRSGEKLISGTKAFELYDTYGF
FT                   PLELTKEILEEKNINVDLEGFTREMEAQKERAKAASQKIDLTLKGSIEREIDLFDQTIF
FT                   EGYDSLNSQGIVKGIFFESNSVEKAIQGQTVQIILDQTSFYGESGGQVGDTGTISRNDA
FT                   EIDIDKVIRKKNIFLHCGTVRKGEICRNQLVETRVDKFNRAKAESNHTATHLLQSALKL
FT                   IIDKSVSQRGSLVGFNKLRFDFNSPQPLSKEQISQVESLVNSWISENHPIEVKNMDKDD
FT                   ALKAGALAMFGEKYGDIVRVVDVPGVSMELCGGTHVQTTSEVGSFKIISEIGISSGIRR
FT                   IEALSGQLVLDYFKERDETVNKLSDLLKARPSQLFERIDSLQTELVNKNKEIQRMKDEI
FT                   AYFKYSSLSSSAKKIGSFSLIINQIDGLDGSSLQSAALDLTSKLGDKSVVILGGIPDTE
FT                   KKKLLFVVSFGDDLVRRGMHAGKLINEISRICSGGGGGKPNFAQAGAKDIDKLNDALEY
FT                   ARKDLWEKLLSYSDK"
FT   gene            complement(56561..58507)
FT                   /gene="speA"
FT                   /locus_tag="P9515_00521"
FT   CDS_pept        complement(56561..58507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="P9515_00521"
FT                   /product="Orn/DAP/Arg decarboxylases family 2"
FT                   /EC_number="4.1.1.19"
FT                   /note="COG1166 Arginine decarboxylase (spermidine
FT                   biosynthesis) [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71261"
FT                   /db_xref="GOA:A2BU00"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BU00"
FT                   /protein_id="ABM71261.1"
FT                   /translation="MTNFDSKKLNKHWTIEDSISTYGIDKWGDQYFSINSLGNISITPN
FT                   RNSKKTIDLFKLVNEIKSREINTPLILRFNDILKDRITELNNAFSQAIETYNYKNIFQG
FT                   VFPIKCNQQKNVLEKIIEYGDYWDFGLEVGSKSELLIGLSLLENKKSLLICNGYKDKKY
FT                   IEIAILARKLGKQPIIVIEQIDEVQRIIEAVKNLRSTPILGIRSKLSSKSSGRWGKSVG
FT                   DNSKFGLSIPEIMLTIKELKEASLINEMKLLHFHIGSQISDISVIKDALQEASQIFVEL
FT                   SKLGAPMKYIDVGGGLGIDFDGTKTSSNTSTNYSLQNYANDVVATIKDSCEVNNIQHPI
FT                   IISESGRAIVSHCSVLIFDVLGTSHVSSQIKVSHQKKTSLIIKNLIDTHNQLKNLRNKK
FT                   EDLSEIIELWNDAKKFKKDCLVAFRLGFISLGERAYAEELTWACAKEISSHLDNEKIIH
FT                   PDLSEITETLSSTYYANLSVFKSIPDTWAINQIFPIIPIHRHLEEPICKGNFADLTCDS
FT                   DGKLNNFIDNGKIKSLLNLHRPEENNDYLIGIFMAGAYQEALGNFHNLFGNTNVIHIDI
FT                   NEDNTYKIKNIIKENSKSEILELLDYSSDNLVESIRINTEFAINNKTLSIEEARKLIDQ
FT                   IETSLRKSSYLSE"
FT   gene            58628..59086
FT                   /gene="ndk"
FT                   /locus_tag="P9515_00531"
FT   CDS_pept        58628..59086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="P9515_00531"
FT                   /product="Nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="COG105 Nucleoside diphosphate kinase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71262"
FT                   /db_xref="GOA:A2BU01"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BU01"
FT                   /protein_id="ABM71262.1"
FT                   /translation="MIKERTFLAIKPDGVQRGYIAEIIGRFEKKGFKLVGLKQLIPSKQ
FT                   LAQDHYGVHRERPFFKDLVNFISSGPVVAMIWEGEGVILSARKIIGATKPLEAEPGTIR
FT                   GDLAIDIGRNIIHGSDGEETAKFEINLWFDQHEICDWETSDSEWRVES"
FT   gene            complement(59099..60202)
FT                   /gene="dadA"
FT                   /locus_tag="P9515_00541"
FT   CDS_pept        complement(59099..60202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /locus_tag="P9515_00541"
FT                   /product="putative thiamine biosynthesis oxidoreductase"
FT                   /EC_number="1.4.3.19"
FT                   /EC_number="1.4.99.1"
FT                   /note="COG665 Glycine/D-amino acid oxidases (deaminating)
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71263"
FT                   /db_xref="GOA:A2BU02"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU02"
FT                   /protein_id="ABM71263.1"
FT                   /translation="MKSEPENSILIIGGGLIGLSIAYEFARNKFKVEVLSKNRGESAGF
FT                   VAAGMLATHAEGLEDELFVFGQQSQNLIPEWIRNIEQDSGIDCGLKKCGIIVPFKNIKN
FT                   LKKFKTYKYGKYLNQQTLRKEIRGINGNWEHGLLFEQDGQIDNRRRLMRALERACSLHG
FT                   VKFQEGADVKELILERNTILGAKVLNATGKIKNIFGEKVILCCGAWSKKLLNNLPIFPV
FT                   KGQMLSIQGPENSIKRVLFGPNTYLVPRDDGLIVVGATVEDKAEFNQGNTPTGIKQLQE
FT                   GIKSLLPEALNWPQMEHWWGFRPCTPDFKPIIGKSDICNLYLATGHYRNGVLFSAITSD
FT                   IMFKLIQDKTLDKIETNFLEKFSFNRF"
FT   gene            60285..61757
FT                   /gene="gatB"
FT                   /locus_tag="P9515_00551"
FT   CDS_pept        60285..61757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="P9515_00551"
FT                   /product="Glutamyl-tRNA (Gln) amidotransferase subunit B"
FT                   /EC_number="6.3.5.7"
FT                   /note="COG64 Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog) [Translation, ribosomal structure
FT                   and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71264"
FT                   /db_xref="GOA:A2BU03"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BU03"
FT                   /protein_id="ABM71264.1"
FT                   /translation="MKNLDPWEAVIGLETHVQLNTKSKIFTSASTAFGDEPNTHVDPVV
FT                   CGLPGTLPVLNETVLEYAVKTSLALNLNVAEHCKFDRKQYFYPDLPKNYQISQFDEPLA
FT                   ENGWLEVEIAEKDKETYLKKIGIERLHMEEDAGKLVHAGSDRLAGSKYSLVDYNRAGIA
FT                   LVEIVSKPDIRTGREASEYASEIRRTVRYLGVSDGNMQEGSLRCDVNISVRRGPDSPFG
FT                   TKVEIKNMNSFSAIQKACEYEIKRQIDVYENGGEIFQETRLWDEAKQLTKSMRLKEGSS
FT                   DYRYFPDPDLGPIEISKEQKDQWLNELPELPSKKRHKYVKEFGLSPYDSRVISDEVFMA
FT                   NFFEETVANGADPKLASNWITSDIVGYLKSNKQIFADLKLSPIYLAEMINLISEKVISG
FT                   KIAKDILPELIKKNISPQKLVKEKGLAMISDSDSILPIIEDLINEFPKEVASFKEGKTK
FT                   LLGFFVGQLMKKTKGKVDPKLANKLLAEKLNS"
FT   gene            complement(61761..62375)
FT                   /gene="coaE"
FT                   /locus_tag="P9515_00561"
FT   CDS_pept        complement(61761..62375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="P9515_00561"
FT                   /product="putative dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COG237 Dephospho-CoA kinase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71265"
FT                   /db_xref="GOA:A2BU04"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU04"
FT                   /protein_id="ABM71265.1"
FT                   /translation="MSIQQKLIKNQRRIGLTGGIASGKSTIANYIKNYKGIPILDADEY
FT                   SKELIKPTSNSYKKILEYFGHQIVDNYSSEKEINRQLLKKIIFNDSIHRKWIQNLLHPL
FT                   IKEKMIEKCNQFGKNKILLLVIPLLFEAKFTDLCSEIWLVSCPREIQKKRLMKRDNIEN
FT                   NEAEKIINLQFNFEDKSKLSNVILDNSKDQKLWIKTIQKLL"
FT   gene            62442..63689
FT                   /gene="argJ"
FT                   /locus_tag="P9515_00571"
FT   CDS_pept        62442..63689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="P9515_00571"
FT                   /product="ArgJ family"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /note="COG1364 N-acetylglutamate synthase
FT                   (N-acetylornithine aminotransferase) [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71266"
FT                   /db_xref="GOA:A2BU05"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU05"
FT                   /protein_id="ABM71266.1"
FT                   /translation="MRKLSQFDTNWSLVSDGKETPNGFSFAGISAGLKDSKKKDLALIV
FT                   APKNSICSGLFTQSRVRASCVDICEQRIKNSSGQIRAILINSGQANACTGDFGIKHTLI
FT                   ATKEVSQLLGIKDEEVLMCSTGVIGIPIQIKKLVDNLSGLVKDLKINNLQNAAEAILTT
FT                   DLVEKKITLETLIEGRKIKISGFAKGSGMIYPNMATMLAFLTCDVGVEKKEWDKMISLA
FT                   VKKSFNAISVDGETSTNDSFIGINAGKKIDKKYLSKIQLGVDIACQHLAKNIARDGEGA
FT                   NCLLEVLVEGAKNNSDAIKMAKSICNSSLVKTAIHGCDPNWGRIISAAGNSGIDFKLDV
FT                   VDLYIGNFQILKKGKLNQFDSDKVENYMRTKMNGKYLVEDIISIVLKLNLGKAKGTAWG
FT                   CDLSKKYVEINSEYTT"
FT   gene            complement(63858..64529)
FT                   /locus_tag="P9515_00581"
FT   CDS_pept        complement(63858..64529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00581"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /note="COG1192 ATPases involved in chromosome partitioning
FT                   [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71267"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU06"
FT                   /protein_id="ABM71267.1"
FT                   /translation="MFITVCGQKGGVAKTCTSIHLASVWHSQGKKVCIVDADKNRSALA
FT                   YSSRGNLPFPVFPVSSAAKASRSSEIVITDGQASSDKEELKHLAYGSDLVILPTTAKAR
FT                   SVELTVELASLLNSLKVNHAVTIVKVDFRQQKAAKQAKAALENFGLHVFDTFIPLLSAF
FT                   DKAEASGNAVFEAVDDLGRSDPRRMAGWSAYCSIASQIPCLISKHSSDTNNLNNQKLIS
FT                   A"
FT   gene            64683..65645
FT                   /gene="tas"
FT                   /locus_tag="P9515_00591"
FT   CDS_pept        64683..65645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tas"
FT                   /locus_tag="P9515_00591"
FT                   /product="Aldo/keto reductase family"
FT                   /note="COG667 Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases) [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71268"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU07"
FT                   /protein_id="ABM71268.1"
FT                   /translation="MNKRIGLGTWSWGNKVFWDYQACNDNSLRETYNEALQRGFKLIDT
FT                   ADSYGTGKLNGRSEELLGKFLLDTSSYQKRRIKIATKLAPYPWRVGNKGFTRPFLNSLE
FT                   RLNNKLDIVQIHWSTAKYNPWQELQLLNNLCDLIDQGFNFEIGLSNIGPQRLETIIKYL
FT                   SKRGKKVKSVQVQFSLLSPDYLKQINVKKICENNDIDFLAYSPLSFGILCIDPEKNEDN
FT                   QSSFIRNLIFKNYKKSTIQLRKCLKNIAVSRSVSQAQVAINWCCYQGAIPLVGMRKKSQ
FT                   VIDISNVFKWNLNKKEFDKLQKASKHCLRKMPRNPFSSL"
FT   gene            complement(65665..65805)
FT                   /locus_tag="P9515_00601"
FT   CDS_pept        complement(65665..65805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00601"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71269"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU08"
FT                   /protein_id="ABM71269.1"
FT                   /translation="MKMSTKNNINDLLINFKPKVLRFTGSNFPTELWGNNHFKKNKKIS
FT                   A"
FT   gene            66282..67406
FT                   /locus_tag="P9515_00611"
FT   CDS_pept        66282..67406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00611"
FT                   /product="Putative RNA methylase family UPF0020"
FT                   /note="COG116 Predicted N6-adenine-specific DNA methylase
FT                   [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71270"
FT                   /db_xref="GOA:A2BU09"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU09"
FT                   /protein_id="ABM71270.1"
FT                   /translation="MKVIASSPEGLEKYLASEINDLGGFNIKTYKRSVSFECDDATFYR
FT                   IHFFSRLAFRFYREVACFACYDRLSLYEGVRDSFDWLAWLPFEKTFNVQVTGRTSSLSH
FT                   SHFTALEVKNSIIDLQQSAWNKRSNIALDNPDLIIHLHLNNDRGVLSLQSSFESLHKRG
FT                   YRPAIGNAPLKENLASGLLKMTEWKGTKPLIDLMCGSGTFLIEAINQTLQVPLKSQHFY
FT                   LFENWLDFNKDIYLKEKTKAQQKVFSFDKLSKVIGCEINKDVFNQAKANISLAGLENYI
FT                   ELQNDNFTNIKFKSSEGLIVCNPPYGKKLGQENELITLYENIGDFLKGNYSGWEFWLLS
FT                   GNPKLTRYLKMKSSLKIPVSNGGIDCRWIKYLIR"
FT   gene            complement(67408..67794)
FT                   /locus_tag="P9515_00621"
FT   CDS_pept        complement(67408..67794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71271"
FT                   /db_xref="GOA:A2BU10"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU10"
FT                   /protein_id="ABM71271.1"
FT                   /translation="MDKPKSKNFANTASRISAIASSVMDLHVRIALQEVDREKRRLISG
FT                   GIFIAIGGILLLLVLICMHIIFYLTLSKFNNWATEYNLLLIIFVDLFLAGLSLKLGGKL
FT                   AKGPYLPQTLEGLGKTTKAVLGKK"
FT   gene            complement(67795..68256)
FT                   /locus_tag="P9515_00631"
FT   CDS_pept        complement(67795..68256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71272"
FT                   /db_xref="GOA:A2BU11"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU11"
FT                   /protein_id="ABM71272.1"
FT                   /translation="MEAFHPPKEVKETVNSSAPRGAEAMSEKWLREKIDSLIPIIQEKW
FT                   PTIAQQTLETAKGSLDDLVGVIASHTGSSASGIKNQLFDIIDSIQENNWEIAEKIEPIE
FT                   GQLEELLDELNNTLRPKIENPIRRKPILSIAIAAGIGLFIGTLINSGRK"
FT   gene            68447..68584
FT                   /locus_tag="P9515_00641"
FT   CDS_pept        68447..68584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00641"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71273"
FT                   /db_xref="GOA:A2BU12"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU12"
FT                   /protein_id="ABM71273.1"
FT                   /translation="MDITHTAIIFASRTIPTDFGLVAAAIAGAGSLLFIALRFVPDAGN
FT                   "
FT   gene            68672..69034
FT                   /locus_tag="P9515_00651"
FT   CDS_pept        68672..69034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71274"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU13"
FT                   /protein_id="ABM71274.1"
FT                   /translation="MNRWVLLEHKILGSKLIDVHYDFLVEDQLDCLTWKFHEIPLLNKG
FT                   FIKIGKQPNHRLIWLSRVEYQLSNNRGLVKRIDHGTFSSVLNQQNSQELKYLLNGTLLK
FT                   GLLIIDGNFCQLINNN"
FT   gene            69117..72701
FT                   /gene="smc"
FT                   /locus_tag="P9515_00661"
FT   CDS_pept        69117..72701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="P9515_00661"
FT                   /product="putative chromosome segregation protein, SMC
FT                   ATPase superfamily"
FT                   /note="COG1196 Chromosome segregation ATPases [Cell
FT                   division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71275"
FT                   /db_xref="GOA:A2BU14"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU14"
FT                   /protein_id="ABM71275.1"
FT                   /translation="MVHINQVEFENFKSFGGCVKIPLEEGFTVVTGPNGSGKSNILDGI
FT                   LFCLGLANSRGMRADRLPDLINNSKVKEGKASETFVSVRFNIEDWSPREDIPPLELEED
FT                   DISLNKNQKEWVVTRKLRLMPGGSYSSTYTSDGRQCTLQQIQRVLRDISVDPEGSNVVM
FT                   QGDVTRIVSMNNKERRTLIDELAGVALFDSRIEQTHSKLNDVFERQERCEILENELQSS
FT                   KIKLEKECEKAKKYKELKAKLFHIKEIEKVLLFDKQVQNIQLIKQKNTNLLNSKILLNQ
FT                   QKESLSKEINVLLDAMKVMIAELKEKGEDTLIKVNSDIGSINSNLRELERVAIVNKEEG
FT                   IKLQEQRDNIAISKKNTELEKNQQEKFNDNFLEKLNLKIQDLTLKHKLSRKKLSDAAGE
FT                   SGEFSKQSIKLNNELDYLKSLIQPLESSKRNIEEEIIQINIQRDEISSQIEGFKLETKK
FT                   LSEFNQINGKSTDAKNRILSSIRSEIDTLKLEIEVLNKTKVRLNNEQLRLEKDLSRCES
FT                   RKEALNETRGSYALRVLLEAGLEGIHGYVAQLAAVNEKHRYALEIAAGNRLGQIVVDND
FT                   TIASRSIEILKKKKAGRLTFLPLNRIKIHRKNFALTRFENSKENGFVDKAFNLIDCDDV
FT                   YTDVFRYVFGETVVFSDLESAKLSNQKIRIVTLSGELLEVSGAITGGSKVNKDLAYRFG
FT                   TNNDIDEAHPIKQRLSLIDEALRKSDNDVVNKTNKLNKLNFNQREILEDCVSSNKEIEV
FT                   NNNSLKVSMQRIDDNTLRLKKLTSQNNLLNEKLDHIQSEIKPLKSKLNELEIVLKKNYE
FT                   DNQRSSLMTHNNDFEKLDKELELLTQEKDELLNKKNQFVLNQERIKNQLNLISLQEKNL
FT                   QESIKELSNAHNEWIKKRDGYKKELASLDDQKSLLEKDLGILRRKRDELNSSISNKRQE
FT                   INEFTLKLEYLERDISSLNEEMRSETIKLENYKKELPDPLPSFGEYESITLDSLQSEIV
FT                   ILNTKLESLEPVNMLALDELEELTERLNNLIERLEVLSNERSELLLRIETVSTMRQEAF
FT                   MQAFKEVDKHFREIFANLSDGDGFLQLENSDAPLEGGLTLVAHPKGKNVRRLASMSGGE
FT                   KSLTALSFLFALQKYKPSPFYALDEVDSFLDGINVERLSKLITSQSSNAQFIVVSHRRP
FT                   MISASERTIGVAQARGANTQVVGLPNAA"
FT   gene            72747..73766
FT                   /locus_tag="P9515_00671"
FT   CDS_pept        72747..73766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00671"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71276"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU15"
FT                   /protein_id="ABM71276.1"
FT                   /translation="MSLSNTSTNNNGRNSVPSERLWLRSELMGTQVITTDTGRRLGVVG
FT                   EVVVDIDRREVVALGLRDNPLTRFLPGLPKWMPLESIKQVGDVILVDSLDSLSDGFSPE
FT                   RYGKVINCQVITESGQLLGRVLGFSFDIETGDLISLVTGAVGVPILGEGVLSTWEILVD
FT                   EIVSSGTDRIIVYEGAEEKLKQLSSGLLDKLGVGGSSWDERESNRYSANLVPVENQLLS
FT                   GSESEEQNNLIEEFKEEDIEEEEYEEELEYVEIETAKEKINNKKQLYLDNDSSEQLGNQ
FT                   IKKENMKEFVVQRQSISNRASKRPIQRSQEPLDIEPVEDKKIVIDNDQSESFEIDDPW"
FT   gene            complement(73778..75055)
FT                   /locus_tag="P9515_00681"
FT   CDS_pept        complement(73778..75055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00681"
FT                   /product="cyanobacteria-specific lipid A disaccharide
FT                   synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71277"
FT                   /db_xref="GOA:A2BU16"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU16"
FT                   /protein_id="ABM71277.1"
FT                   /translation="MTAMKKKSIAVVIISNGPGELSTWVKPVVDYLNQINNCSKDIEKL
FT                   NFSLRLVLVPCPNATGKEYSVAKSWKIFELITKSKSFWKLLIRPSKFAKWPQKGIVIFL
FT                   GGDQFWSVLLAKRLGYMNITYAEWISRWPRWNNIIAAMNKNVKKNIPSNHRYKCKVVGD
FT                   LMADIKKNKSDSLNTEKKDWIALLPGSKKPKLSVGIPYFLEIADHIHKNNKNINLIIPI
FT                   APTTSTSEYLYFQSYKNPITKHYSSRIKRIRNIKNSIFDSVIETSNNTKIYLINKHPCY
FT                   EVLKKCDLAITTVGANTAELASLALPMIVILPTQHLNVMNAWDGILGIIGKISFINKFF
FT                   TFIIKNWYLKKKKFFAWPNIKANKLIIPERIGNISPRQIANEALFLIKNKKYLKEQKNN
FT                   LTKHRGKTGAVKKLAYIIFNSIKKLS"
FT   gene            complement(75072..75153)
FT                   /locus_tag="P9515_tRNALeuVIMSS1309118"
FT                   /note="tRNA-Leu"
FT   tRNA            complement(75072..75153)
FT                   /locus_tag="P9515_tRNALeuVIMSS1309118"
FT                   /product="tRNA-Leu"
FT   gene            75462..76811
FT                   /gene="accC"
FT                   /locus_tag="P9515_00691"
FT   CDS_pept        75462..76811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="P9515_00691"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /EC_number="6.3.4.14"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG4770 Acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71278"
FT                   /db_xref="GOA:A2BU17"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU17"
FT                   /protein_id="ABM71278.1"
FT                   /translation="MVEKVLIANRGEIALRIIRSCRELDIATVAVYSTIDKKALHVQLA
FT                   DEAVCVGDSLSNKSYLNIPNILAAATSRGVDAIHPGYGFLAENDKFAEMCNDHGITFIG
FT                   PSPNAIRSMGDKSTAKETMERVGVPTVPGSKGLLSSVEEAYQMAKEIGYPVIIKATAGG
FT                   GGRGMRLVENKANLEKMFKAAQGEAEAAFGNDGLYMEKFIKKPRHVEIQILADRSGNVV
FT                   HLGERDCSVQRRHQKLLEESPSPAINRSLREKMGNAAIAAAKSISYEGAGTVEFLVDDE
FT                   NNFYFMEMNTRIQVEHPVTEMVTGVDLIAEQIKIAGGDNLGFTQDDIQLNGHAIECRIN
FT                   AEDPSHNFRPSPGKITGWLPPGGPGVRVDSHVYTGYEIPPFYDSLIGKLIVWGKDRNTA
FT                   IKRMNRALNECAVTGIPTTINFHLNLLNKTKFMEGKIHTKYVEEELLPNY"
FT   gene            complement(76830..77003)
FT                   /locus_tag="P9515_00701"
FT   CDS_pept        complement(76830..77003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00701"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71279"
FT                   /db_xref="GOA:A2BU18"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU18"
FT                   /protein_id="ABM71279.1"
FT                   /translation="MVAIPTSSILNFTRKLIPPIGGVDVGPVIWIGIISFLREILVGQQ
FT                   GLIKLAIQKSIS"
FT   gene            77225..77413
FT                   /locus_tag="P9515_00711"
FT   CDS_pept        77225..77413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00711"
FT                   /product="Photosystem II protein X PsbX"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71280"
FT                   /db_xref="GOA:A2BU19"
FT                   /db_xref="InterPro:IPR009518"
FT                   /db_xref="InterPro:IPR023428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BU19"
FT                   /protein_id="ABM71280.1"
FT                   /translation="MIQISDLLLIANVSPEVAGSSGFNMIASFFAAALLIVIPAATFLI
FT                   FVSQNDSLDRTSATRRR"
FT   gene            77492..78418
FT                   /locus_tag="P9515_00721"
FT   CDS_pept        77492..78418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71281"
FT                   /db_xref="GOA:A2BU20"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU20"
FT                   /protein_id="ABM71281.1"
FT                   /translation="MVNASLNWASIVGIVLAVCGGGLYFLRSFKPALARDYDVFFAAIG
FT                   LLCGGILFFQGWRLDPILQFGQFLLAGTTVFFAYESVRLRGVATDQARRSSYFEDDQIP
FT                   DMPRNSSRNRFNDDYDRFDDSDRIARRFKPQEDDIEEDYIEGRSQRRNISRAIPESAVS
FT                   RRRPPLRESNKFENEEPKRRRNRSEDRMPNEERRASFGERRASRSDVKRGSRPLPNKEV
FT                   SRKLNNSSLKDSFSSTKTTRQSIRSQIPREKVEDASFSQNINEEKKTRQARRSSSNDRS
FT                   TSKNQAGRYTVGTKKNKSRDNSSRFDD"
FT   gene            complement(78419..78652)
FT                   /locus_tag="P9515_00731"
FT   CDS_pept        complement(78419..78652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00731"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71282"
FT                   /db_xref="GOA:A2BU21"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU21"
FT                   /protein_id="ABM71282.1"
FT                   /translation="MTSNQEQYNKESMDVEKINSEEIKVDEQSTEIEDTYKFGWSNYSE
FT                   ITNGRFAMLGFLAIILIELISQKSFFNWVGIF"
FT   gene            complement(78662..80644)
FT                   /locus_tag="P9515_00741"
FT   CDS_pept        complement(78662..80644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00741"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /note="COG4178 ABC-type uncharacterized transport system,
FT                   permease and ATPase components [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71283"
FT                   /db_xref="GOA:A2BU22"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU22"
FT                   /protein_id="ABM71283.1"
FT                   /translation="MNNVVQNKSKIINQLQKLRRLAQPFFLPIDQCNGFQFIWLLISLL
FT                   FCVGGIVLVGLTGIISFFESIQPVFLEKYFGGVVNTVNTIWSGLWGLLFSGLFLIGSGS
FT                   FFSLRRQLKNRRWLHWLFLAVIVLMLLAVNGINAGIGFIARDLTNALVEKQQDGFYRIL
FT                   GIYACCFAVALPIRVSQIFFTYKLGIIWRDWLSKSLVKDYMTNKAYYQLNPNDEEQTDV
FT                   DNPDQRITDDTRAFTGQSLSFTLGVFDALLTFSLNILILWSISTTLTFSLFGYALFATT
FT                   ILLIAGKNLVKIDFDQLRYEADFRYGLVHIRDNAESIAFYAGEKPEKSETERRLGAVVK
FT                   NFNLLIIWRVIIDVMRRSINYAGNFFPYLIMAIPYFRGDIDYGRFIQASFAFGMVEGSL
FT                   FFIVNQIEELAKFTAGIGRLEGFQSKVESISQTKPIDNQNIISNYSSILINNADLFPPG
FT                   SNKAVIKNLNLSIETNQSLLVVGPSGCGKTSLLRMISGLWEPNQGSIKKPSTGDLLFIP
FT                   QKPYMLLGSLREQLCYPTEVDKFSDDHLISVLNEVNLESMVDRYPNLDVKQDWPRILSL
FT                   GEQQRLAFARLLLNSPRFAVLDEATSALDIKTERRLYNLLRNRELSLISVGHRPSLKEF
FT                   HENILELNGKGDWKLFTTDKYNFKN"
FT   gene            complement(80684..80971)
FT                   /locus_tag="P9515_00751"
FT   CDS_pept        complement(80684..80971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71284"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU23"
FT                   /protein_id="ABM71284.1"
FT                   /translation="MKTPESLNSKPNNFLNLIIENWEGLEDSQKSVLIKIWKVLTYKWQ
FT                   LQILFNLPFLIWWLMDISILKVHEFDLRLLSYLNLPDWALSLIGFGQSSS"
FT   gene            complement(81019..81360)
FT                   /gene="hit"
FT                   /locus_tag="P9515_00761"
FT   CDS_pept        complement(81019..81360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hit"
FT                   /locus_tag="P9515_00761"
FT                   /product="HIT (Histidine triad) family protein"
FT                   /EC_number="2.7.11.1"
FT                   /EC_number="3.6.1.17"
FT                   /note="COG537 Diadenosine tetraphosphate (Ap4A) hydrolase
FT                   and other HIT family hydrolases [Nucleotide transport and
FT                   metabolism / Carbohydrate transport and metabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71285"
FT                   /db_xref="GOA:A2BU24"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU24"
FT                   /protein_id="ABM71285.1"
FT                   /translation="MTQTTIFSKIINGEIPCEKLYEDELCIAFDDIAAQAPVHFLVIPK
FT                   KPLVSLYECLEEDKDLLGHLLLVGKNIARSKKLKNWRTVINTGEESGQTVFHLHIHFLA
FT                   GRKMSWPPG"
FT   gene            complement(81376..81987)
FT                   /gene="def"
FT                   /locus_tag="P9515_00771"
FT   CDS_pept        complement(81376..81987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="P9515_00771"
FT                   /product="putative formylmethionine deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COG242 N-formylmethionyl-tRNA deformylase
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71286"
FT                   /db_xref="GOA:A2BU25"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BU25"
FT                   /protein_id="ABM71286.1"
FT                   /translation="MANNFSQLAKKSRNELSSSKVKKEVIENPPLEIFKLGNDVLRTNA
FT                   KRIGKVDLDTRNLAKDMLKSMYSAKGIGLAAPQVGISKELLVIDINFEDSAAEPLILIN
FT                   PEITAFGNTLNSYEEGCLSIPGVYLNVVRPSTIKLRFSDEMGRPRKMNADGLLARCIQH
FT                   EVDHLRGVLFVDRVTSKEDLKTELKKEGFQMKDVFPISQS"
FT   gene            82068..83996
FT                   /gene="dap2"
FT                   /locus_tag="P9515_00781"
FT   CDS_pept        82068..83996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dap2"
FT                   /locus_tag="P9515_00781"
FT                   /product="Esterase/lipase/thioesterase family active site"
FT                   /note="COG1506 Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71287"
FT                   /db_xref="GOA:A2BU26"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU26"
FT                   /protein_id="ABM71287.1"
FT                   /translation="MINHKTLPINNVFKKKPVFNQISFCKNIIFWIDIVKKGKTYSNSI
FT                   FARPFNQEEAGIQKLTGDEFNIKSHFHGYGGKSYQCIEVDEKLYLVWIDEISESLWIQV
FT                   FTVNKSETINNNQYLLCKNKPRQLVESLKGNFDSSFAITNQNILLGLYELNNKDYLFSV
FT                   DIRKSKQEIRILREFDDFAGNLSLSKNGKNLSWLEWKTPFMPWEKNELFFAVINQNGVL
FT                   DKIKKFKNDSINLNKNVSFFQPYWIHEDIIVCSEDSSGWWNLLFIDVSDINNIVIKKRI
FT                   LKEFFEYGIPQWISGLSLFSGSFNNLFCLAKNKCSWVLEQYIDFSLVRTIDLPYDLLRD
FT                   LHAVDDNLILIGSSNTCNERLLELECNNKRLIKLSKKSFFLSQNNCSKPESFWFKGFNN
FT                   QSTHAFIYKPLYERFVNSPLIVKAHSGPTSCFDGSLNSEVQYWTSKGFMVAELNYGGSS
FT                   GFGREYRERLNYKWGILDSFDCKALVLDLIRLHLVDSSKVAILGNSAGGLTAINALCEG
FT                   DLFKVAICKYPVIDLNDMHHKTHRFEKGYLNSLIGEYSTCLEKYQIRSPINKINQLKKP
FT                   VLLFHGKKDSVISYKKTSQIKDLLIGNNKNSEVIFFDNEGHGFKNLDNKQQVLIKTQKF
FT                   LERTLNI"
FT   gene            complement(83993..85270)
FT                   /locus_tag="P9515_00791"
FT   CDS_pept        complement(83993..85270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00791"
FT                   /product="putative cysteine desulfurase or selenocysteine
FT                   lyase"
FT                   /EC_number="2.8.1.7"
FT                   /EC_number="4.4.1.16"
FT                   /note="COG520 Selenocysteine lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71288"
FT                   /db_xref="GOA:A2BU27"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU27"
FT                   /protein_id="ABM71288.1"
FT                   /translation="METIKNFPQIVKKNFNLVDKKDFPLLENNFKSKNKIIYLDHAATT
FT                   QKPSQVLEKIEEYYKKFNANVHRGAHQLSAKATEEFENSRSLVAKYINANSTQEIIFTR
FT                   NATEAINLVARSWGEFTLKENDEIILSVMEHHSNIVPWQMVAAKNQCKLKFVGIDQDGK
FT                   LDINDFKSKLTNKTKLVSLLHISNTLGCCNPIKEITKLAKVKGSLVLLDACQSLAHQKL
FT                   DIDELGIDFLAGSGHKLCGPTGIGFLWAKKEILEEIPPFFGGGEMIQDVFEDTSTWAEL
FT                   PHKFEAGTPAIAEAIGLAEAIKYINNIGLDRISEYEKQITKYLFEQLSQIKDLVIIGPP
FT                   PKIDPNRASLATFYIKGIHSNDIAEILDSKGICIRSGHHCCQPLHRHIGVNSTARVSMN
FT                   FTTTKDDINAFIEKLKETISFLRLNS"
FT   gene            complement(85270..86487)
FT                   /locus_tag="P9515_00801"
FT   CDS_pept        complement(85270..86487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00801"
FT                   /product="ABC transporter, membrane component"
FT                   /note="COG719 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71289"
FT                   /db_xref="GOA:A2BU28"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU28"
FT                   /protein_id="ABM71289.1"
FT                   /translation="MQIIEEIKKNELFSNPSEIQKFCLNKLKLNPLPNVKSEYWRLSNK
FT                   SKFSSLLDHIHKNKESKINLPYTNTSQNIIRLIIGEDSSINYEEENFSIKQLRETEIAD
FT                   YIKKNISNFDQNNHWSDLLNHCLSSKKNILGLSISGNKIPPIEIFSASSPESFNAKTLI
FT                   LFFDKNSKIDLLQINLGNENSSLSQSTYFCLEENTSVNHGVVSYGESKSNLLNSLNVIQ
FT                   KAKSEYSLGSLHFKFNYARFEININQLDGNAKTNIKGIQITKNNDQIATYTNMNFNGPN
FT                   GFLDQINKSLADDKSHAVFEGSIIVPKIAQKTDASQLSRNLLLSRFAKIDTKPQLEIIA
FT                   DDVKCKHGATISQLNEEEIFYMRSRGLTLAEASKLQLSSYIQEIISSIPISKDRWDLLD
FT                   KLLKEN"
FT   gene            complement(86495..87277)
FT                   /gene="sufC"
FT                   /locus_tag="P9515_00811"
FT   CDS_pept        complement(86495..87277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="P9515_00811"
FT                   /product="ABC transporter, ATP binding component"
FT                   /note="COG396 ABC-type transport system involved in Fe-S
FT                   cluster assembly, ATPase component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71290"
FT                   /db_xref="GOA:A2BU29"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU29"
FT                   /protein_id="ABM71290.1"
FT                   /translation="MQIKSKALDPILEVNSLFASIENLPILKGVTISVKPGEIHAIMGR
FT                   NGCGKSTLSKIIAGHPSYQVTKGEIKFNGNDIQSLEPEERAQSGIFLGFQYPIEIPGVS
FT                   NLEFLRVATNARRKFLNKEELDTFDFEDLVKEKLDLVKMDSAFLSRSINQGFSGGEKKR
FT                   NEILQMALLEPKIAILDETDSGLDIDALRIVASGIKKISNEKTGIILITHYQRLLDEIQ
FT                   PDYVHVMSDGQIIKTGGSDLALELEKYGYEWTDKFIKE"
FT   gene            complement(87297..88739)
FT                   /locus_tag="P9515_00821"
FT   CDS_pept        complement(87297..88739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00821"
FT                   /product="ABC transporter, membrane component"
FT                   /note="COG719 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71291"
FT                   /db_xref="GOA:A2BU30"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU30"
FT                   /protein_id="ABM71291.1"
FT                   /translation="MVSENLVKDVVSEPYKYGFVTDIETEKISKGLNEDIIRLISVKKE
FT                   EPEYLLNFRLNAFKKWQKMVEPNWAELGYKKIDYQDIIYYSAPKQKEKISSLDEVDPKL
FT                   LETFDKLGIPLTEQKKLTNVAVDAVFDSVSIATTFRKELAEHGVIFCSISEAVKDHSDL
FT                   IEKYLGSVVPANDNYFAALNSAVFSDGSFVYIPKGIKCPMDLSSYFRINSGDSGQFERT
FT                   LIIAEEASSVSYLEGCTAPMFDTNTLHAAVVELVALDDASIKYSTVQNWYAGNEDGVGG
FT                   IFNFVTKRGKCLGKRSKISWSQVETGSAITWKYPSCLLLGEESVGEFYSVALTNNLQKA
FT                   DTGTKMIHIGPKTKSTIVSKGISAGKSANSYRGLVKMGSKAVGSRNYSQCDSMLIGDQA
FT                   AANTFPYIQSQQPNSEIEHEASTCRISEDQLFYLQSRGIEFEEAVSMMVSGFCRDVFNQ
FT                   LPMEFAAEADKLLALKLEGSVG"
FT   gene            88839..89201
FT                   /locus_tag="P9515_00831"
FT   CDS_pept        88839..89201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00831"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71292"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU31"
FT                   /protein_id="ABM71292.1"
FT                   /translation="MPNQTNSFSSPLSYEIVEDIEQLNLSIIQKHHIRLLAHCLAILKE
FT                   IVKEDISPLEEDERLREWCEKQSKKFNDENFNQLFYEQMSSASQKLNAYSQSIEKNLKE
FT                   LDLEDLILLVAQNQEY"
FT   gene            89467..90573
FT                   /locus_tag="P9515_00841"
FT   CDS_pept        89467..90573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00841"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3330 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71293"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU32"
FT                   /protein_id="ABM71293.1"
FT                   /translation="MVDGIKNKENLLSLTLRQLRKEASKLSVPLYSRKTKAVLVDLIIK
FT                   YQKKVDDKSNQTKDNKIFKKISNPIDQPSKESVDTKVVFLPRDPEWAYVFWQISESDRE
FT                   KAQSLGASKICLRLYDATGLGEGEFNQGTLREINVDSHSTEWYLPIPLADRDYKVELGY
FT                   KYGFKWMSLAFSSVSHVPGSLPSEQILDKFVPFNLDSPAVSDSSPGIQSPMGQEANALH
FT                   ERLYQAATSFSTRRKVGSEEFMEDLNSTNLNSNLSDSGAGQWSSGLNESGSGIVKNRSF
FT                   WLVADAELIVYGATDPTAKLTIGEEEVPLAADGTFRLQVPFRDGSQKYEIKAVDFSGEQ
FT                   EKNITMKFDRATPHDDTNEKDNAETEWF"
FT   gene            90586..90756
FT                   /locus_tag="P9515_00851"
FT   CDS_pept        90586..90756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00851"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71294"
FT                   /db_xref="GOA:A2BU33"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU33"
FT                   /protein_id="ABM71294.1"
FT                   /translation="MLKKIVAFTPLFGALTFPLIVPITISKFGVNYGILSALVISSLWF
FT                   IAMLRTSEMPH"
FT   gene            90790..92427
FT                   /gene="pgm"
FT                   /locus_tag="P9515_00861"
FT   CDS_pept        90790..92427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="P9515_00861"
FT                   /product="Phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="COG33 Phosphoglucomutase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71295"
FT                   /db_xref="GOA:A2BU34"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU34"
FT                   /protein_id="ABM71295.1"
FT                   /translation="MTEVKVIHINNPFQDQKPGTSGLRKSTIRFQEEHYLEIFIEAIFK
FT                   SLKSLQGSTLVVGGDGRYGNIAAIKKIIQICVAHKVRKVIIPKNGLLSTPATSHLIRKE
FT                   GAIGGIILSASHNPGGLQGDFGVKLNISNGGPAPESLTNQIYQCSQSLKSYKISKIQIP
FT                   DLDKFGVFSFGETSLAIIDGLKDYSDLMESIFDFDQISDFLKRDFSLIFDAMNAVTGPY
FT                   AKNIFVEKMGLGDDCLMNGVPLEDFGGLHPDPNLTYASKLADLLLVQKSYSFGAACDGD
FT                   GDRNMILGQGCFVNPSDSLAVITANSNCIPGYKDGISGVARSMPTSSAVDFVASALNIP
FT                   CFETPTGWKFFGNLLDSNLITICGEESFGTGSNHVREKDGLWAVLYWLQILAVKNCSVS
FT                   ELMQNHWKQYGRNYYSRHDYEAIPSNVANQIFNNLSSMLPNLKENRFAGNLVKRADNFS
FT                   YLDPVDNSISKNQGLRIILEDNSRVILRLSGTGTKGSTLRLYFEKFASSEQNLDLNPQI
FT                   ALKTLINDLDHLLNISKLTKMEKPTVIT"
FT   gene            92461..93747
FT                   /gene="mgs1"
FT                   /locus_tag="P9515_00871"
FT   CDS_pept        92461..93747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgs1"
FT                   /locus_tag="P9515_00871"
FT                   /product="putative ATPase, AAA family"
FT                   /note="COG2256 ATPase related to the helicase subunit of
FT                   the Holliday junction resolvase [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71296"
FT                   /db_xref="GOA:A2BU35"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU35"
FT                   /protein_id="ABM71296.1"
FT                   /translation="MSDNLFSNAFQIQSNAPLADRLRPKTLDDFFGQESILGNNSLLRN
FT                   AILNDKVGNIIFSGPPGVGKTTLIEIISSNTRSALIKLNAVLSSIKELRTEIANAKERL
FT                   LSSNRKTILFIDEVHRFTSIQQDALLPSIENGTITFIGATTENPFFAVNKALISRARVF
FT                   SLIPLNTNDLRKIIEKVVNYYACLEDPKAIEITEEAISHLIKYSGGDARNLINALESGI
FT                   SITKENKDKLVFIDLSIAEDSIQKKNIVYDKNGQNHFDVISAFIKSIRGSDPDATLYWL
FT                   ANMVEAGEDPNFIFRRLLISASEDIGLADPNAIVVVQSCCDAFDRVGLPEGLFFLSQAS
FT                   LYLAISPKSNSTKSIFKAVEAIKTTNVSLVPNHLKNNASNYLNPHNYHENLLSQEYLPT
FT                   ELKGIKFWQHKNSGWEKNKYDDLVKKRKS"
FT   gene            complement(93744..94400)
FT                   /locus_tag="P9515_00881"
FT   CDS_pept        complement(93744..94400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00881"
FT                   /product="possible 4'-phosphopantetheinyl transferase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71297"
FT                   /db_xref="GOA:A2BU36"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU36"
FT                   /protein_id="ABM71297.1"
FT                   /translation="MTLLNNYDSKIPKIWFHKIKGVQDVATLKELEIANKLSKQRANIF
FT                   LESRAYIRQSLGTLFNINPLEIPIIADPGEPPKLPKGMGYLSFSHCCDAIILVWHEKKI
FT                   GIDIERVDRDFSYMKLAKKYFLTSKKSNQTSESYKKSILNQWCAIEAAIKWNHGKLSED
FT                   LKEWQYYENEKTLFHNAKKLKLKFTQITFYKWTISLAYKDISQLISNIICSSKII"
FT   gene            94400..94867
FT                   /locus_tag="P9515_00891"
FT   CDS_pept        94400..94867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00891"
FT                   /product="putative bacterioferritin comigratory (BCP)
FT                   protein"
FT                   /note="COG1225 Peroxiredoxin [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71298"
FT                   /db_xref="GOA:A2BU37"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU37"
FT                   /protein_id="ABM71298.1"
FT                   /translation="MALRVGDVAPEFKLKDSFEKDVSLKDFKGKRIILYFYPKDNTPGC
FT                   TKEACNFKENWDLLKQNNFVVIGISKDSSASHLKFIEKFDLPFVLLTDPEPFKVSSDYD
FT                   SYGLKKFMGKEYMGMMRNTFLIDADGKVEKIYLKVKAAIMADHIISDLGLR"
FT   gene            complement(94873..95553)
FT                   /locus_tag="P9515_00901"
FT   CDS_pept        complement(94873..95553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00901"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="COG1521 Putative transcriptional regulator, homolog
FT                   of Bvg accessory factor [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71299"
FT                   /db_xref="GOA:A2BU38"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU38"
FT                   /protein_id="ABM71299.1"
FT                   /translation="MFERNHFLLVGNSRLHWAENLKNQYRFFHTQKNSKIPQNINLKSL
FT                   VWASVGELTDLSLKQENEITTKDIKLQNLPHYFGVDRALGCLEASKIIENPSKKNLLVA
FT                   DCGTTLSLTKLTAEGSIIGGQIAPGFLTQLRSMEKFTKNLKAPKKYDIPIQDFLINTED
FT                   AMLKGVSNSLMGVINSSFEPAKDILIICGGDSELIGSRLKQKNKDIVIAPNLVMQGMIT
FT                   HFNH"
FT   gene            complement(95571..96296)
FT                   /gene="cysH"
FT                   /locus_tag="P9515_00911"
FT   CDS_pept        complement(95571..96296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="P9515_00911"
FT                   /product="Phosphoadenosine phosphosulfate reductase"
FT                   /EC_number="1.8.4.8"
FT                   /note="COG175 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase and
FT                   related enzymes [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71300"
FT                   /db_xref="GOA:A2BU39"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU39"
FT                   /protein_id="ABM71300.1"
FT                   /translation="MMIEKTLESIKLNLEEQNKKLKDMTSKEIMLWGYRNFDNHFAITT
FT                   SFGIQSSVILHMVNECSLQKKIKIFWIDTGYLPSETYKYAERLINDLSLEIEVLQSEIS
FT                   PARMESLYGKLWETNKSSDLDKYHDIRKVKPLEKALDSHNINCWASGVRSEQTNNRNKM
FT                   KFVDVIRNRLSLRPLLNWKNKDIYYYMKENQLPSHPLFSKGYSTVGDWHSSSPDSIENE
FT                   GRSTRFRGMKQECGIHTEN"
FT   gene            96388..97575
FT                   /locus_tag="P9515_00921"
FT   CDS_pept        96388..97575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00921"
FT                   /product="putative NADH dehydrogenase, transport
FT                   associated"
FT                   /EC_number="1.6.99.3"
FT                   /note="COG1252 NADH dehydrogenase, FAD-containing subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71301"
FT                   /db_xref="GOA:A2BU40"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU40"
FT                   /protein_id="ABM71301.1"
FT                   /translation="MKSIKKPIVIVGAGFGGMTVASNLKRLNPSLPILVVDSEARFLFK
FT                   PLMYEVISEELSMWETTPEFSKIFSDLGITFLRNCLTKIRFDEKILEFNDDLHIGYEFL
FT                   ILCTGSVSSNFSVKGVDENCYFFNNLKDLTKLKSFLKQFQNNKIKKNLFVIGAGPSGVE
FT                   IACKIHDTYKDKFDISIVERSNEILGQNKIFNREEAEKALERRKINILLNSTVQEISEK
FT                   KISILNDSEIKKLEQDVVIWTAGIKPNLPYIDEQVKQIKGRILVNNKFQIENYLNSFAI
FT                   GDISIIQGMEELPLTAQVAMQQGDHLAKNIERIFLEQDLLPFDFQDNGEMISLGMGEAS
FT                   ISALGVTLSGKLAFEARRLIYASKMPDISRSLKSTASWLFQKKSIINKFVNKRPK"
FT   gene            97632..99440
FT                   /gene="citT"
FT                   /locus_tag="P9515_00931"
FT   CDS_pept        97632..99440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="P9515_00931"
FT                   /product="putative sodium/sulfate transporter, DASS family"
FT                   /note="COG471 Di- and tricarboxylate transporters
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71302"
FT                   /db_xref="GOA:A2BU41"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU41"
FT                   /protein_id="ABM71302.1"
FT                   /translation="MNLFSLFSNNFDALITVLVLLLSLILFIRNTIAPELTGLLCVGIF
FT                   IVTGVLTPEKALAGFGSPSLITLMGLFAVSSALFKSGALDRVRELISSENIKTPRRLIT
FT                   LITFLIAPISGIVPNTPVVASLLPLIEGWCERRNISPSKVLLPLSFATLLGGTLTLLGS
FT                   SVNLLVSDISQQLGYGSLELFSLTSIGIPVWLIGTTYMIMVSDVLLPDRGRNKDFIKKG
FT                   NMNIYFTEVTIPSSSELVGQSVRNSRLQRRFDVDVLELQRNGEVILPPLADRKFEPEDR
FT                   LIVRVTRADLLRLQQEHTILLAENRRSLSGTNLLSTEEGTKTFEALLPAGSTLAGASLR
FT                   ELRFRQRHNATVLALRRGQQTVQERLGQAVLRAGDVLLLQAPLDSIRGLQSSNDLLILD
FT                   QFEDDLPVLIRKPIAIAIAIGMVILPSLTNIPLVGAVLLAVIAMVAFGCLRPAEIQRSI
FT                   RLDIILLLGSLSSFSVAMQVTGLADLIAINLDFILNGMPLYFALMVIFVATVILTQFIS
FT                   NAASVALILPVAIQFSIVLGISPNALIMLVLFGASQSFLTPMGYQTNLMVYGPGRYRFF
FT                   DIAKYGAGLTLIMSLTVPALIILNFK"
FT   gene            99450..100853
FT                   /gene="trkG"
FT                   /locus_tag="P9515_00941"
FT   CDS_pept        99450..100853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkG"
FT                   /locus_tag="P9515_00941"
FT                   /product="possible sodium transporter, Trk family"
FT                   /note="COG168 Trk-type K+ transport systems, membrane
FT                   components [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71303"
FT                   /db_xref="GOA:A2BU42"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU42"
FT                   /protein_id="ABM71303.1"
FT                   /translation="MNINKTVYKFKEVYRKLSVPQFTIVTGLIIVFFGTLILSSPLCSS
FT                   SDVGLWEAFFTSTSAITVTGLTIIDIGVDLNIFGQIFLAFMLLSGGLGLMAITTFLQGF
FT                   VVKGTQLRTRLDKGKTLDEFGVGGIGRTFQSIAITATTIISFGAIILYFFGFLEIQNNW
FT                   ERLWSAIFHSISAYNNAGFSLRSNSLQEYRSNFVVNIVFIFLIVMGGLGWRVIDDLWRN
FT                   RKNLSYKKLNLHSKLVIRTSFSLIFFGSLGFFITETLLNSQFFSDLNFFEKILSSIFET
FT                   VSARTAGFTNFPISLNSISDTGLLLLMTLMFIGASPGGTGGGIKTTTFIALMAATRSTL
FT                   RGQKDVIISNRLISDKVILKAVGITVASLLFVLLMAMLLSTTNTFIKKESFTFLEILFT
FT                   CISAFATVGFDIGLTAKLNHFGQFILIIGMFVGRLGILLLLSALWQALYKSRIEKQKRI
FT                   GFPKADLYV"
FT   gene            100872..101576
FT                   /locus_tag="P9515_00951"
FT   CDS_pept        100872..101576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00951"
FT                   /product="putative potassium channel, VIC family"
FT                   /note="COG569 K+ transport systems, NAD-binding component
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71304"
FT                   /db_xref="GOA:A2BU43"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU43"
FT                   /protein_id="ABM71304.1"
FT                   /translation="MADWWQWSPHKEEEALTFAVVGVGRFGTAVCRELISNGADVLAAD
FT                   SSEKAIDDLRQLEPSIEARVIDCTDEESMKESGILEMNTVVVGISEPIEASITTTLIAK
FT                   DSDGTKVKRVIARATSDLHEKMLKRVGADKVVFPSRMQGERLGLELVRPNLIERLELDN
FT                   QTGIDEITVPEEFIGRSLRDLNLRKNYLVNVLAAGPQEQLTVNPPAKYILERGNILVVM
FT                   GKTVDLQKLPQN"
FT   gene            complement(101573..101884)
FT                   /locus_tag="P9515_00961"
FT   CDS_pept        complement(101573..101884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00961"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71305"
FT                   /db_xref="InterPro:IPR012869"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU44"
FT                   /protein_id="ABM71305.1"
FT                   /translation="MATRQNSTNGRPKSPRIQVVLPESICEKLTTLAESESRTVSNMAK
FT                   VLIQEGIKNYFEKEAQSLISDTKINTDNFRDTLERHSIKRLKGAPQRIRYSKNQTQND"
FT   gene            102002..102340
FT                   /locus_tag="P9515_00971"
FT   CDS_pept        102002..102340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00971"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71306"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU45"
FT                   /protein_id="ABM71306.1"
FT                   /translation="MKNSRKLDSSQRPIIDKKKKKFIQSESLNNENSDVLVSAVISPYL
FT                   LTHLHQILQRSEYYAQKDGRISHAANFAKLRKVLCLDARSMADASAKEIKDTDHDLSIN
FT                   KYNEQNVA"
FT   gene            102376..102606
FT                   /locus_tag="P9515_00981"
FT   CDS_pept        102376..102606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00981"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71307"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU46"
FT                   /protein_id="ABM71307.1"
FT                   /translation="MTRNVEKLYNLIANDSKKKQSLFLMALNNPKSALEKICEIGRELD
FT                   IHVTKEEVIEYLETVDDEATKLWLIKARGGL"
FT   gene            complement(102574..102756)
FT                   /locus_tag="P9515_00991"
FT   CDS_pept        complement(102574..102756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_00991"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_00991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71308"
FT                   /db_xref="GOA:A2BU47"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU47"
FT                   /protein_id="ABM71308.1"
FT                   /translation="MKRIEQIVVIFIAAALAIPSYWFFWTLAGGGGYNKRSKPITTEEA
FT                   VIKPLLKSSSSLNQP"
FT   gene            102826..104448
FT                   /locus_tag="P9515_01001"
FT   CDS_pept        102826..104448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01001"
FT                   /product="ABC transporter, ATP binding component"
FT                   /note="COG488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71309"
FT                   /db_xref="GOA:A2BU48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU48"
FT                   /protein_id="ABM71309.1"
FT                   /translation="MIRFDNVSKIYSTDTVLKNINWEIKRGEKIGLVGSNGAGKSTQFK
FT                   ILIGEVDQTSGVVLKEGSPKISHLKQELDCNLSRTVREELESSFKDIQLVSNKLLEIEN
FT                   EMKLLESRKDTAKLNHLVHQLSKYQEKFEVLGGYQMQAEVEKILPKLGFSQEDADKLVG
FT                   NFSGGWQMKVALGKIILQKPDLLLLDEPTNHLDLDTIFWLEEYLISLKIAIILISHDRY
FT                   FLDKLCKKIIFIERGISETYNGNYSFFVEQKSLNEESQNKAFALQQKEIATQRKYIERF
FT                   RASATRSTQAKSREKQLKKITKIDAPISRLKTPSFSFPECPRSGKSVLQIKNLSHSFED
FT                   KILLFDVNLKVSAGEKIAILGPNGCGKSTLLKLIMKKIEPEIGEVNLGKHNIITSYYEQ
FT                   NQAEALAIEKQVIDLIYSKAPDWTQQKVRTFLGSFGFHNNAVFKYVQQLSGGEKARLAL
FT                   ALMIMNPSNFLLLDEPTNHLDLQSKENLELAINNYKGTVFVISHDRYFISRVANRIIEI
FT                   KESKLLSFNGNYEYFLEKKRIKK"
FT   gene            104590..104751
FT                   /locus_tag="P9515_01011"
FT   CDS_pept        104590..104751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01011"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71310"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU49"
FT                   /protein_id="ABM71310.1"
FT                   /translation="MLFKILMKKYDYKENNYVTSDPVESYFECISSCDITDGICISKCV
FT                   EILRDDES"
FT   gene            complement(104759..105910)
FT                   /locus_tag="P9515_01021"
FT   CDS_pept        complement(104759..105910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01021"
FT                   /product="possible serine protease"
FT                   /note="COG265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71311"
FT                   /db_xref="GOA:A2BU50"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU50"
FT                   /protein_id="ABM71311.1"
FT                   /translation="MFFKALRKIKTRKYSFNRLMFISYLTFGLLNKPQVISQPIRNQTL
FT                   DEKSKIANISFITKAIKKTGASVVTIDTQRLVKNKQFSRDSGIFIDPYFERFFGLQLPR
FT                   EYQPRIEQSQGSGFIFEDGLVMTNAHVVNGSKKVIVGLSNGTKYEGKLIGQDSLTDLAV
FT                   IKLQGRGPWPKAKLGDSSKIEVGDWAIAVGNPFGLENTVTLGIISNLNRNVSELGIYDK
FT                   KFELIQTDAAINPGNSGGPLLNSAGEVIGINTLIRSGPGAGLSFAIPINKAKDIASQLI
FT                   NNGRVIHPMIGINLIDQNSFEIKKNIVKVGYVVPNSPADKSGFYINDVIIKVGKKDVQN
FT                   SSDVINEITNNGINNYLNIIIKRKNKLIKLKVKPTDISNLSGK"
FT   gene            106049..106312
FT                   /locus_tag="P9515_01031"
FT   CDS_pept        106049..106312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71312"
FT                   /db_xref="InterPro:IPR021355"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU51"
FT                   /protein_id="ABM71312.1"
FT                   /translation="MSLLFPIIYSAALTYLVWKAFRVMSNGWGLFDKEQNRSYNTKIRQ
FT                   NKYTIHPELLDKSGNITQEELLTVRFSNDTDSTLEEKGTTTD"
FT   gene            106344..106727
FT                   /locus_tag="P9515_01041"
FT   CDS_pept        106344..106727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71313"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU52"
FT                   /protein_id="ABM71313.1"
FT                   /translation="MESRTKIVSGVIRSLKLPPRFLLKMVKDDPVRLELSLTPSYGKNP
FT                   VIVGLVESLDLVARRDREGRMPRDLQGTWDWTVRHGKVSTGGWNPMLKEALQTMFETGL
FT                   PAIIYEELTGDEYKPVDGIRHVR"
FT   gene            106799..106945
FT                   /locus_tag="P9515_01051"
FT   CDS_pept        106799..106945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01051"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71314"
FT                   /db_xref="GOA:A2BU53"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU53"
FT                   /protein_id="ABM71314.1"
FT                   /translation="MNEDNQPRFGFVNFAETWNGRMAMMGILIGLGTELITGQSILRQI
FT                   GIG"
FT   gene            complement(106974..107312)
FT                   /locus_tag="P9515_01061"
FT   CDS_pept        complement(106974..107312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01061"
FT                   /product="possible Zinc finger, C3HC4 type (RING finger)"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71315"
FT                   /db_xref="GOA:A2BU54"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU54"
FT                   /protein_id="ABM71315.1"
FT                   /translation="MLNKMNKQLVIYFLMFLIVIPVFGFNFLFNLLGNILLLIFLVPLL
FT                   ILLTTLISFNSLKSKINICDQCGNISLGINNDCSRCGADLSDINSKNFEKFKKPSEATI
FT                   EVKAEEIN"
FT   gene            complement(107333..108277)
FT                   /gene="rbn"
FT                   /locus_tag="P9515_01071"
FT   CDS_pept        complement(107333..108277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="P9515_01071"
FT                   /product="serum resistance locus BrkB-like protein"
FT                   /note="COG1295 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71316"
FT                   /db_xref="GOA:A2BU55"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU55"
FT                   /protein_id="ABM71316.1"
FT                   /translation="MILEEYLKRIDMQRSSTWIIKSLWGACERWSKSDCIDLSAAFAYY
FT                   TLQSFFPILLISLSIASWFLGKQEGLDQEIISIAAQILPPSVVELVETTLFKLIDQGFG
FT                   AGILGAMFLLFTAGNAYLSLQRGSDRLWEDELPSRRVNSAWQEQASRFLRNRIEAFLIV
FT                   FFVGFLMVLDQISANLRMIPTTVLENLSKSSNIFSDLFMKLPLLQVGKFAFPLIGFSLM
FT                   ALLLQALLPSRKVPLKPLIPGSILIGIGLTTLNLAVSKSILSLGVRFQAYGFIGGFLVL
FT                   TLWVWLLGVILYFGQCWSVVIASMSLINRRRNK"
FT   gene            complement(108333..109133)
FT                   /locus_tag="P9515_01081"
FT   CDS_pept        complement(108333..109133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01081"
FT                   /product="inositol monophosphate family protein"
FT                   /note="COG483 Archaeal fructose-1,6-bisphosphatase and
FT                   related enzymes of inositol monophosphatase family
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71317"
FT                   /db_xref="GOA:A2BU56"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU56"
FT                   /protein_id="ABM71317.1"
FT                   /translation="MNKNNLTDQQLKDLDSLFELVSDRQLKDFGNISASNKSDGSLVTS
FT                   CDLWSDKTIVKALSIIAPDEGVLSEEGGKLVPKTNAYWIVDPLDGTTNFAAGIPYWSIS
FT                   IARFVNGNPQSSFLIIPTLKKKFVAIKGRGVWLNNKKIEVNSHKQNSECVSLCSRSIKI
FT                   LQKKPDSIFPGKIRLLGVSSLNLTSVAMGQTFGAIESTPKIWDIAAAWLILEELNCSIE
FT                   WLETNPMHLSAEQDLKDTNFPLIASWNQEKIKVLRPWGDLLIEK"
FT   gene            complement(109136..110566)
FT                   /locus_tag="P9515_01091"
FT   CDS_pept        complement(109136..110566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01091"
FT                   /product="possible RND family outer membrane efflux
FT                   protein"
FT                   /note="COG1538 Outer membrane protein [Cell envelope
FT                   biogenesis, outer membrane / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71318"
FT                   /db_xref="GOA:A2BU57"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU57"
FT                   /protein_id="ABM71318.1"
FT                   /translation="MLRKLIHPVLFFPLFLFINSQKAVLSGSNNNIEAILEENETQIFL
FT                   NYSEIKNITLKNNQELKALENLVDSSTFTLSSKIAKRYPSLDLQASGFPKYVSGKNYNS
FT                   TSSTTKTSQFSANPSLNIRLDLIDPLRGSEIQIAKNNYAIARNNYEIKKKDLIQEAKSR
FT                   YHKLQKSYQDIKNKKSSLDLSVTSLKDAKSKFDAGIGTKFEVLEANAQLSRDRQTLNEK
FT                   KIQNQINKIALKEILNINGDFDINKKQKLIGFWNHKLNKNINEGLLKSLSLKNITLQKA
FT                   IKENQAKNYLNTYKPNVYISNVLTTSFSKGDSLAVQIDSGKSGSAYTNTVSLNFGWNIF
FT                   DGGQNKNLYKSSIADAQSEDYSYRNLENVIKSKISKAYLNLKLNEEKIISSLEEISSTE
FT                   ESLRLARLRYEVGISTLKDVLVRQKELSNANSKNIDAIYNYNLNLDELERLTYLEISNI
FT                   CDESNGFINNDIKSICNI"
FT   gene            complement(110559..111971)
FT                   /locus_tag="P9515_01101"
FT   CDS_pept        complement(110559..111971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01101"
FT                   /product="possible Fe-S oxidoreductase"
FT                   /note="COG1625 Fe-S oxidoreductase, related to NifB/MoaA
FT                   family [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71319"
FT                   /db_xref="GOA:A2BU58"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017673"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU58"
FT                   /protein_id="ABM71319.1"
FT                   /translation="MWKEINSKENSNDFLIPEIKSQINPAEIESVENNSIAEEIGFESG
FT                   DSIISINGKKPRDLIDYQILISEEILDISVLDKYKKIHNISIEKDQDDNLGINFKEALF
FT                   DSIKQCNNKCPFCFIDQQPNGKRKSLYVKDDDYRLSFLYGSYLTLTNLNKDDWNRISTQ
FT                   KLSPLFISIHATDPKTREQLLKNKKASQILNQIEWLEENSIQIHAQIVVCPKINDGKIL
FT                   EKSIYDLAKFHKKSFKTVLSTAIVPVGLTKFRPENDGLLPIGKEYAKEIIKQVEKIQTS
FT                   LQQRIGTRFCWLADEWYLIAGRKLPSYTTYENMPQESNGVGSIRSFLKILETKTKSLPE
FT                   KIDKQRKVSWIVGKLVYEALLPTVRKLNKINGLTINLYGLPSIYWGQDQVVTGLLTGED
FT                   LIAGLQNKDLGESIFIPSIMLKLNSDLFLDDKNITEVSNKLKTNIHVLDDTNDIINNLI
FT                   GISNTYKILDYA"
FT   gene            112200..112925
FT                   /locus_tag="P9515_01111"
FT   CDS_pept        112200..112925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71320"
FT                   /db_xref="GOA:A2BU59"
FT                   /db_xref="InterPro:IPR021468"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU59"
FT                   /protein_id="ABM71320.1"
FT                   /translation="MKPSFHDEFDTPKSTFLSRPIALRLWASFFVILPIFVQAPWVRFE
FT                   PISALCATFIILFVSFLLSRKEADKWFIVGSLLLGVSGSWLGGCLFWGWLSAYPILHIP
FT                   VEAVALPLAMVGLGTKWKIGSSFYISSLFGTAITDLSIFLTGIMDQWKEVITADSDNAP
FT                   LILQKTSENLIQLKSLSIIILAAFILWFISKEIFNAAIPNSKNEKALLVSSYVIQTTLI
FT                   VDGIFIILAIIQPTFSGLV"
FT   gene            112925..114592
FT                   /gene="nadB"
FT                   /locus_tag="P9515_01121"
FT   CDS_pept        112925..114592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="P9515_01121"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="COG29 Aspartate oxidase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71321"
FT                   /db_xref="GOA:A2BU60"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU60"
FT                   /protein_id="ABM71321.1"
FT                   /translation="MLRQPFSQEAISIDKWDVIVIGAGAAGLMTCLELPENLNVLLLNR
FT                   NTSKRSSSRWAQGGIASVVRPEDSFALHVEDTLKAGDDLCDKSAVEMLVSEAPGCVDRL
FT                   QNLGMIFDQSSDQLATTLEAAHSCRRVLHVKDRTGRALVEVLEDHIENKENILHCRGVR
FT                   VTELLIENQVCTGVQVLDGSNLYWITSKAVVLATGGGGHLFTNTTNPAQSSGEGIALSW
FT                   KAGAAIEDLEFIQFHPTALKFYGSPCFLISEALRGEGAVLVDKNGESPVRHLQNGDLAT
FT                   RDQVSRAIMNSMQENDIDHVGLDLRFIDPKKIVERFPTIISRCQDYGVNPLTEVIPVAP
FT                   AAHYWMGGVHTDLDASSTVKGLYAVGEVASTGVHGANRLASNSLMECLVFARKLSSIEL
FT                   NSPFNLRRLDRHNKEIYMDSPKEDFISSISEKINSLRKSCWSHLGVSRNKKSMIELLKI
FT                   LQEEKDEIQKNPLLECLKKIEIDQKLKLSEPNRRALNLLLDLNNRQITTLLLLKACLFR
FT                   EESRGGHYRDDYPSKEKIWECHTRQQLNHKIIKRFIKN"
FT   gene            complement(114582..115517)
FT                   /locus_tag="P9515_01131"
FT   CDS_pept        complement(114582..115517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01131"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4243 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71322"
FT                   /db_xref="GOA:A2BU61"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU61"
FT                   /protein_id="ABM71322.1"
FT                   /translation="MAIKTLKSRNKKDLKWPKIIIAVISTIGLVDTGSITLKNWGVLKS
FT                   LSCPGINNGCEKVLNSPWGTLFENSQFNIPLSLAGVITYSLILGFSIFLSLNIISHKEK
FT                   LNKLLWWLIFLISCASSVFSILLINIMFFKIKAYCFFCILSAIISISIFIFSMIGAKFE
FT                   SREPMFFRGFIVFLTVLIGGLIWSNNVDPSNAIDISNSSEKVSPAITTLSSPQKVKFAK
FT                   FLSDNNIKMFSAYWCPHCLDQKKLFGKKAVKELTVIECAKDGKDNQYKLCREKQIEGFP
FT                   SWEINGEIYSGVKDLNELATITGYEGDSNF"
FT   gene            115625..116989
FT                   /locus_tag="P9515_01141"
FT   CDS_pept        115625..116989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01141"
FT                   /product="possible Fe-S oxidoreductase"
FT                   /note="COG621 2-methylthioadenine synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71323"
FT                   /db_xref="GOA:A2BU62"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BU62"
FT                   /protein_id="ABM71323.1"
FT                   /translation="MKQSNKNVKDKNITKVAFSHVGCEKNLVDTEHMQGLLDKEGYEVG
FT                   NNLEDAKVVVVNTCSFIETAREESIRKILEFTDQGKQVIVAGCMAQHFKEELLKEIPEI
FT                   KALVGTGDYQKIAKVMNRVEKGEIVNEVSKVPEFIADEKIPRLIDQKKFVAYLRIAEGC
FT                   DYNCAFCIIPKLRGPQRSRTIESIILEATNLANQGIQEIILISQITTNYGQDIYGKPSL
FT                   ARLLKELSKVSVPWIRIHYAYPTGLTDEVIKAFKDSNNIVPYFDLPLQHSHSDVLKSMN
FT                   RPWQASLNESILSKIRDQIPSAVLRTSLIVGFPGEEQKHFLHLLDFLHKHKFDHVGVFI
FT                   FSPEEGTSAFDLPNRVPSEIADARKDNIMSIQQNISKKKNQLYVGTKVKVLVEKISKNN
FT                   ELIGRSYHFAPEIDGNVILSIKKNVIENNYVGKFVEANICFADEYDLYGEVINIL"
FT   gene            complement(116998..117090)
FT                   /locus_tag="P9515_01151"
FT   CDS_pept        complement(116998..117090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01151"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71324"
FT                   /db_xref="GOA:A2BU63"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU63"
FT                   /protein_id="ABM71324.1"
FT                   /translation="MNIIFYFAFLGFGFGAAFLLDKLLRAVKLI"
FT   gene            complement(117157..117543)
FT                   /locus_tag="P9515_01161"
FT   CDS_pept        complement(117157..117543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71325"
FT                   /db_xref="InterPro:IPR017260"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU64"
FT                   /protein_id="ABM71325.1"
FT                   /translation="MDFIKILEKKIEIDNNLSNRYIELDPNGYFIIKIDIEKKHIILEH
FT                   YLNTINEEGYALDPKTNEPIKCDSREIKTCNETFTGISAKEIGIAITEKRNDLISRFDH
FT                   ALYLGRELQKAEECLYKQLTYVQD"
FT   gene            complement(117596..118762)
FT                   /locus_tag="P9515_01171"
FT   CDS_pept        complement(117596..118762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01171"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3146 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71326"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU65"
FT                   /protein_id="ABM71326.1"
FT                   /translation="MNHIEHKVEIKLSIQEINKKTWNELRKEINNPFYEWEWLYNLELS
FT                   KSVSRETGWQPLYFVAYQNEQICGIAPLFLKNHSYGEFIFDQSFARLAQDLNLNYYPKL
FT                   IGMSPYSPINGYEFLYKETKNKAPITNSLIKHIDNFALKNNILSCNFLYVNENWGKHLK
FT                   SLGYKEWINTSSEWKTNGEKSFDDFLLRFNSNQRKNIKKERKSISKQNLEIKIHTEESI
FT                   NLEIVQKMHNFYEQHCLRWGVWGSKYLTSEFFEKILENKQNLLFFSASRNDSERTIAMS
FT                   MCVKNKKNIWGRYWGSQEEILNLHFELCYYQPIEWAITNKIESFDPGAGGKHKRRRGFY
FT                   AKGTKSFHKWFNKNMEDIITPWLDKVNFQTMQEIKLENNSIPFKENKN"
FT   gene            complement(118775..119437)
FT                   /locus_tag="P9515_01181"
FT   CDS_pept        complement(118775..119437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01181"
FT                   /product="RibD/ribG C-terminal domain"
FT                   /EC_number="1.1.1.193"
FT                   /note="COG1985 Pyrimidine reductase, riboflavin
FT                   biosynthesis [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71327"
FT                   /db_xref="GOA:A2BU66"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU66"
FT                   /protein_id="ABM71327.1"
FT                   /translation="MNTPSVAIIIASSLDGRIAFPTGGESHLGSKEDKKMLDEHLSKVD
FT                   ATIFGLGTLKAHQSTYLVKNYCKNGEIKISKTQPISIVASNSKTFEKDWSYFQQPIKRW
FT                   LISSNKKDVLKNIDFEKEIFYNNSWSETLLSIKKAGINRLALLGGAKLINSFIKEDLID
FT                   EIKITIAPRIIGGKFTWIPAEQTSKIFNLKQFWKIKSIQELDKNEIYIHYTRNIKDD"
FT   gene            complement(119434..120360)
FT                   /locus_tag="P9515_01191"
FT   CDS_pept        complement(119434..120360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01191"
FT                   /product="6-pyruvoyl tetrahydropterin synthase"
FT                   /EC_number="4.2.3.12"
FT                   /note="COG720 6-pyruvoyl-tetrahydropterin synthase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71328"
FT                   /db_xref="GOA:A2BU67"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU67"
FT                   /protein_id="ABM71328.1"
FT                   /translation="MTFTHTKPLHGQGRECVITRRACFSSSHRYWLPEKSLEDNFSLFG
FT                   KCSIAPGHGHNYELIVSMGGELDSYGMVLNLSDVKHSIKNKVTEQLDFRFLNDVWPEFN
FT                   IHSHDGILPTTEALVKVIWNRLKDDLPLTNIRLYESPTLWADYSGKNMEALLTIQSHFN
FT                   AAHRLAKDEISLDENKKIYGKCARVNGHGHNYFLDVTVRGQIDPRTGMICDLPSLQTII
FT                   DDLVVEQFDHTFLNKDIEYFKTCVPTCENIALHISDILSSPIKNIGANLHKIKLQESPN
FT                   NAAEIYVEQSLPNSLQKNIANALVAQA"
FT   gene            120411..120968
FT                   /gene="aroK"
FT                   /locus_tag="P9515_01201"
FT   CDS_pept        120411..120968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="P9515_01201"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="COG703 Shikimate kinase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71329"
FT                   /db_xref="GOA:A2BU68"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU68"
FT                   /protein_id="ABM71329.1"
FT                   /translation="MEKSIIDKTNKIIKGRSIFLIGMMASGKSQTGPVLAKFLRYKYID
FT                   LDKLIEKIVKKTIIEMFHEDGEEKFRELETNCLKETIKIPSLVISTGGGVIAKPENWGI
FT                   LRQGIIIWIDTKQEIALERLQNDIDNRPLLQGKDLKELYSRIFQSRKNLYSQADLRVEV
FT                   DNENVEEVAKKIIYQIHNKIIN"
FT   gene            complement(120965..121222)
FT                   /locus_tag="P9515_01211"
FT   CDS_pept        complement(120965..121222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71330"
FT                   /db_xref="InterPro:IPR021954"
FT                   /db_xref="InterPro:IPR038150"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU69"
FT                   /protein_id="ABM71330.1"
FT                   /translation="MSNPLIRSEDHFVLLEPDSKEKIVTKKEAILWLKNWLTQIDSSTI
FT                   YQKKDFSNEKFLEELLESTYELEIKFGFIIKWFAVRVEPD"
FT   gene            121221..121931
FT                   /locus_tag="P9515_01221"
FT   CDS_pept        121221..121931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01221"
FT                   /product="possible POLO box duplicated region"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71331"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU70"
FT                   /protein_id="ABM71331.1"
FT                   /translation="MIKNFLGLIIFLIIQVLCVNNAYALNDNNVRGFLEERENSWPELY
FT                   LPIFKYSNTSKDLIYPKWFEGNWLVTSQDLEDESQAPVIYKVNFFKNNLNEVVGNRSKN
FT                   SESIGKAIFGENLIKVVNDPKSINKQITYLKDDLYIDSRITGRNQIQDDDKFFADELVI
FT                   QTVHKPGASRVNQVETISKFQKCNSGNMNSQDPLKPYICGVQYIATYGSKVGDRSVHAI
FT                   KTGKYKLSFKFIES"
FT   gene            complement(121918..122643)
FT                   /locus_tag="P9515_01231"
FT   CDS_pept        complement(121918..122643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01231"
FT                   /product="putative glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="COG625 Glutathione S-transferase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71332"
FT                   /db_xref="GOA:A2BU71"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU71"
FT                   /protein_id="ABM71332.1"
FT                   /translation="MITLYQFRHSPFCLKTRMALHAKKLQYRVEEVTPGIGQFEIFKLS
FT                   GQKQVPVIIDDNDQIISDSSLICEYINKKNDHNPLFPEDPLLFAQCKLVENWADTTMAS
FT                   TCKKALIKSAIENPKLRTALLPDEIPSSLKGLVDKLPFKNLSKISNVVLSSKDNLELQK
FT                   ILEAISKSLINKKYLIGDNFSIADIAIAAQLSLLKFPKSSGPILSGEGCQEYINNPYLE
FT                   NIFIWRNNIEEYIFSANSQ"
FT   gene            complement(122670..122894)
FT                   /locus_tag="P9515_01241"
FT   CDS_pept        complement(122670..122894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01241"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71333"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU72"
FT                   /protein_id="ABM71333.1"
FT                   /translation="MIGLVIACKTKYTVMKALITEDIKPININGFDLFLNKGSSSATNP
FT                   PAIIEIKYLGYLATLEKNWPISSTIRLLF"
FT   gene            122698..122901
FT                   /locus_tag="P9515_01251"
FT   CDS_pept        122698..122901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71334"
FT                   /db_xref="GOA:A2BU73"
FT                   /db_xref="InterPro:IPR008470"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU73"
FT                   /protein_id="ABM71334.1"
FT                   /translation="MGQFFSNVARYPKYLISIIAGGLVALLEPLFKNRSNPFILIGLIS
FT                   SVISAFITVYFVLQAMTNPINL"
FT   gene            122907..123305
FT                   /gene="rbfA"
FT                   /locus_tag="P9515_01261"
FT   CDS_pept        122907..123305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="P9515_01261"
FT                   /product="Ribosome-binding factor A"
FT                   /note="COG858 Ribosome-binding factor A [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71335"
FT                   /db_xref="GOA:A2BU74"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BU74"
FT                   /protein_id="ABM71335.1"
FT                   /translation="MPNNYRIAKVSSLLKKEITLILQNDLENDLLRSNFISISKIEVTG
FT                   DLQFCKIYISSAAEGNIRKEIIENLNLAKNYIKHILGQRIEMRRVPELTFKDDTALAKG
FT                   LSVLKLLEELNNKTHNQNSQVEENNDNV"
FT   gene            123292..124089
FT                   /gene="hemD"
FT                   /locus_tag="P9515_01271"
FT   CDS_pept        123292..124089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="P9515_01271"
FT                   /product="putative uroporphyrinogen III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="COG1587 Uroporphyrinogen-III synthase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71336"
FT                   /db_xref="GOA:A2BU75"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU75"
FT                   /protein_id="ABM71336.1"
FT                   /translation="MITSEFSLKQKNMIITRSKDKISDIKKLFTNEGAQIFDFPAIEVG
FT                   YPDDFNPLDDALSEINDFHWIIFSSSNGIKFVDERLRNFNTSLKECSKKIKIAVVGEKT
FT                   SLTLIELGIEADFVPPEFVAESLIENFPISGYGLRVLLPRVQTGGRNLIADQFRNSGSR
FT                   VVEVAAYETRCPASIPKETINVITKRKVDAMLFSSGKTVSNSSFLLEKEFGKEWLTFLD
FT                   DAKLLTIGPQTSKICEKFFGRVDGEAVKYTFEGLLDAAIDIFS"
FT   gene            complement(124082..124552)
FT                   /locus_tag="P9515_01281"
FT   CDS_pept        complement(124082..124552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01281"
FT                   /product="Predicted integral membrane protein"
FT                   /note="COG5637 Predicted integral membrane protein
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71337"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU76"
FT                   /protein_id="ABM71337.1"
FT                   /translation="MGTWLKHDVITTVNAPLDNVWNTWSDLDSMSLWMSWIESVKTVDQ
FT                   ETSTLPDLTEWTLAANGFKFKWKAQITERIEKNKLKWKSIGGLPTQGSVIFESKGDKFT
FT                   SVNLAVTYELPKMLARFMEEKILGKMVTNELQANIDRFRDLVEKNYKNELTN"
FT   gene            complement(124555..126009)
FT                   /gene="crtQ"
FT                   /locus_tag="P9515_01291"
FT   CDS_pept        complement(124555..126009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtQ"
FT                   /locus_tag="P9515_01291"
FT                   /product="zeta-carotene desaturase"
FT                   /EC_number="1.3.5.6"
FT                   /note="COG3349 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71338"
FT                   /db_xref="GOA:A2BU77"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014103"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU77"
FT                   /protein_id="ABM71338.1"
FT                   /translation="MKIAIVGSGLAGLTAAVDLVDAGHEVEIYESRSFWGGKVGSWEDK
FT                   DGNHIEMGLHVFFYNYANLFKLMNKVGALNNLLPKEHTHLFINNGGNLKSLDFRFPLGA
FT                   PFNGLKAFFTTEQLTWVDKLRNALALGTSPIVRGLIDYEGAMKIIRDLDKISFKEWFLN
FT                   HGGSIRSLERMWDPIAYALGFINCQDISARCMLTIFMMFASKTEASKLNLLKGSPHKWL
FT                   TQPIVDYITKKGCLIHLNHKVDEIIFEKESSAYSVKQLKISSPEGDKVVFADTFLAACD
FT                   VPGIKKIVPKEWYQFKEFKGLKKLRAVAVATIQLRYDGWVTELNNDNKSQNPSGLDNLL
FT                   YSADASFSCFADLALASPIDYRKEGMGSLLQCVLTPGDRWMGRSKEKVTKEIDAEVRRL
FT                   FPSSKNLKLLWSNIVQIPQSLYRESPGMEPYRPDQRTSISNFFMAGSYTKQDYIDSMEG
FT                   ATMSGHLAAAAILDKKVELAKNRAVS"
FT   gene            126108..126500
FT                   /locus_tag="P9515_01301"
FT   CDS_pept        126108..126500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01301"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG316 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71339"
FT                   /db_xref="GOA:A2BU78"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU78"
FT                   /protein_id="ABM71339.1"
FT                   /translation="MENLEVDEKIKTSDDGKGILITNAAIEQVSFLLKNQTDKKALRVG
FT                   VRSGGCSGMSYTMDFIGGDQINADDKVYDYSLSSEQSFKVVCDPKSLLYIYGMQLDFSK
FT                   DLIGGGFNFVNPNASQTCGCGSSFAV"
FT   gene            126510..126938
FT                   /locus_tag="P9515_01311"
FT   CDS_pept        126510..126938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71340"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU79"
FT                   /protein_id="ABM71340.1"
FT                   /translation="MLDEINPIESDFNAALSRYKDGKELIPILEDFQKIIQQIPNHFAA
FT                   WTCLSWLHLLLKNNEEALAAARQAVRLNQQDPQARMNLSLALLATNNKGVRENVELIKK
FT                   MSIMMPDVKTELKDSVADGFNRYPNWPELTKINKWLEF"
FT   gene            126939..128129
FT                   /locus_tag="P9515_01321"
FT   CDS_pept        126939..128129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01321"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG4370 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71341"
FT                   /db_xref="InterPro:IPR019994"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU80"
FT                   /protein_id="ABM71341.1"
FT                   /translation="MSRILLLSNGHGEDLSGSLLAKYFAKQGDLVNALPIVGDGENYKK
FT                   ANIRIIGKTKKFRTGGLGYNSFKGRIAEIFGGQIIYFLKKLYLSYKVRNNYDFYIVVGD
FT                   IVPVFFSWFAKKDFFTYLVAYSSHYEGKLKLPWPCKFFLLSKYSKKIYARDLLTANDLT
FT                   QQFGKKVLFLGNPFMDKFSVFSNKSNISPSIIGLFPGSRCPELVENLKTILEVLETMSD
FT                   LKYFENISFKFAIVKALSIEEITYILNQRKWIFIEKKENTNSLVYKFGFITLYFNWNLF
FT                   EEILFNSKFVISMAGTASEQAIGLAKPVIQIEGKGPQFTKSFAEAQRRLLGRYVFCSTN
FT                   YINKEDQINQTINLILQVIYRIKLDKNFLSSCLHNANQRIGEFNSCIDIINDIKRS"
FT   gene            128133..128402
FT                   /locus_tag="P9515_01331"
FT   CDS_pept        128133..128402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71342"
FT                   /db_xref="GOA:A2BU81"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU81"
FT                   /protein_id="ABM71342.1"
FT                   /translation="MTNEKSQSKLKDIIDNFLLINLFVVIFFAIFFIFAVIMEINGVFI
FT                   FLDFFQNLWNPLIVPLITILILSTLISGINSWWRRKWLSQEEDI"
FT   gene            complement(128353..129285)
FT                   /locus_tag="P9515_01341"
FT   CDS_pept        complement(128353..129285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01341"
FT                   /product="putative cell division inhibitor"
FT                   /note="COG1090 Predicted nucleoside-diphosphate sugar
FT                   epimerase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71343"
FT                   /db_xref="GOA:A2BU82"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU82"
FT                   /protein_id="ABM71343.1"
FT                   /translation="MRLLLLGCTGFVGKELVPALLKEGHELCIISRKNINNLKLNIPLD
FT                   KFKFLKIDLSKKQNWEDEHLLNNLKNCEGIINLIGEPIADKKWNELQKEEIEKSRINST
FT                   KFLMETLKKSRIIPKVIINASAIGFYGTSLTNEFNENSRCGNDFLANLCKKWEDVANEK
FT                   PFFSRLVIFRIGIVLEAEGGALGKMLPVFKIGLGGPIGDGKQWMSWIHRSDLCGLISKA
FT                   LVDQQFTGVFNAVAPEPVLMKDFSKSLGRCLNRPDLLPVPGTILKLLLGDGAKLVLEGQ
FT                   KVISIKLKEKMYKFKYPLLEKAIYASTKN"
FT   gene            129423..129665
FT                   /locus_tag="P9515_01351"
FT   CDS_pept        129423..129665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71344"
FT                   /db_xref="GOA:A2BU83"
FT                   /db_xref="InterPro:IPR020905"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BU83"
FT                   /protein_id="ABM71344.1"
FT                   /translation="MSETIPKKPLKKGSLVFVDKNIYDKSIEALASDSDLPAYIFEGPG
FT                   EILGIKEEYAQVRWRRPVPDVWFKLDQLKEYLASE"
FT   gene            complement(129670..130347)
FT                   /locus_tag="P9515_01361"
FT   CDS_pept        complement(129670..130347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01361"
FT                   /product="possible heat shock protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71345"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU84"
FT                   /protein_id="ABM71345.1"
FT                   /translation="MIKNFYEELGLKKNATKSEIKSSYRRLVKQHHPDTGGEKDRFLAI
FT                   QDAWETLNDPIKKEQYDKTLLSLNQSSNFNNENWAEKVNTTKYSSAVKDIEVKNWIKNI
FT                   YYPSNRFISQIIKPLNQEIKELSADPYDEELMDKFCSYINLSQKKIEKVDELYKSKSVP
FT                   HTISSFGLDLYHCFSQVKDALSELDKYTQGYVDDYLFDGKEMMQEAKRIQLKMGFDKKS
FT                   IIS"
FT   gene            complement(130364..131332)
FT                   /locus_tag="P9515_01371"
FT   CDS_pept        complement(130364..131332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01371"
FT                   /product="O-acetylserine (thiol)-lyase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="COG31 Cysteine synthase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71346"
FT                   /db_xref="GOA:A2BU85"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU85"
FT                   /protein_id="ABM71346.1"
FT                   /translation="MEIASDITSLVGNTPLVKLDRIKDYCKCHTEIIAKLESFNPSASV
FT                   KDRIAYSMLNSAEEDGLILPGKTTLIEATSGNTGIALAMVAAAKGYRLILTMPDTMSIE
FT                   RRAMLRAYGAELQLTPGTEGMRGALELANELSSSIPNSFQFNQFENLANPEIHERTTAK
FT                   EIWDQSNQNIDGLVSGVGTGGTITGCARFLKKVNPNCKIYAVEPAKSAVISGEKPSSHS
FT                   IQGIGAGFIPKVLNTQLIDEIIKIDDDDAFYYGRLLARLEGLLSGISSGAALAAAIKIG
FT                   KRKEFIKKRLIVILPSFGERYLSTAMFESNTVVQARQDGYL"
FT   gene            131491..131760
FT                   /locus_tag="P9515_01381"
FT   CDS_pept        131491..131760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01381"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein in cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71347"
FT                   /db_xref="InterPro:IPR020885"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BU86"
FT                   /protein_id="ABM71347.1"
FT                   /translation="MYSLEISLRYSPFPLSIQKKDYEDVKRIYDEIKDFMQGKNTNSDL
FT                   IEISCEKVQDKLITVLAKEVISVQIYEKSSVAGGSKRPGFSLDI"
FT   gene            131762..132445
FT                   /locus_tag="P9515_01391"
FT   CDS_pept        131762..132445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01391"
FT                   /product="possible ABC transporter, ATP-binding component"
FT                   /note="COG1122 ABC-type cobalt transport system, ATPase
FT                   component [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71348"
FT                   /db_xref="GOA:A2BU87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU87"
FT                   /protein_id="ABM71348.1"
FT                   /translation="MSELQDTFKNKVPKITFQNVSFSWPGKKEHIINNCSFSINKTGLW
FT                   MIVGKNGSGKSTLLKLINGLLKPSNGVINNLANVGMVFQNPDHQILMPNCRSELLLNIS
FT                   KKLSRTDITKKIDFALNTVGLPGFEKRPIHTLSGGQKQRLTIACSLISDKNFVLLDEPT
FT                   SLLDSSSQLKVLEIIKDLTNNKRNPFTALWITHRLEELSYSDAVAEMKNGNLSDWQKPL
FT                   NFQYN"
FT   gene            132494..132565
FT                   /locus_tag="P9515_tRNAAsnVIMSS1309137"
FT                   /note="tRNA-Asn"
FT   tRNA            132494..132565
FT                   /locus_tag="P9515_tRNAAsnVIMSS1309137"
FT                   /product="tRNA-Asn"
FT   gene            complement(132892..133299)
FT                   /locus_tag="P9515_01401"
FT   CDS_pept        complement(132892..133299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01401"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71349"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU88"
FT                   /protein_id="ABM71349.1"
FT                   /translation="MIRKSQYTDEYAKKYGKKPIPFPYFVLEQKKVVYFRILTGFPASL
FT                   AVKPIMREHFPDDYKGMIASDETWEKLMKDFPPHFLIKKDKKVVFLIKGVFPEDFILKN
FT                   YMPSFPEGYKGMIMRCEESFYKMRMKANSSK"
FT   gene            complement(133299..133601)
FT                   /locus_tag="P9515_01411"
FT   CDS_pept        complement(133299..133601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01411"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71350"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU89"
FT                   /protein_id="ABM71350.1"
FT                   /translation="MAFRCSACGIRKIEEKTRGAATAMKKEIDWKKELLESGRFNDKFQ
FT                   KNLLENGAKNFMQGIYLGYMYSRWRKIRGLDKDDPVENKGQLKSSFKEFEKKIKK"
FT   gene            complement(133529..133714)
FT                   /locus_tag="P9515_01421"
FT   CDS_pept        complement(133529..133714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01421"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71351"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU90"
FT                   /protein_id="ABM71351.1"
FT                   /translation="MSNKWDDTSWQKDFLNMKSHSPSDAKLLMGGVKGLKGAWRLGVLH
FT                   VEYEKLKKRQEEQQQQ"
FT   gene            complement(133711..133914)
FT                   /locus_tag="P9515_01431"
FT   CDS_pept        complement(133711..133914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01431"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71352"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU91"
FT                   /protein_id="ABM71352.1"
FT                   /translation="MKKENNYAGGLSNYIVLKGKKEVIFYLHNPYPDCLEIPDIMKQRF
FT                   PSDYKSIVVNSLDEFKKYGGKV"
FT   gene            complement(133954..134310)
FT                   /locus_tag="P9515_01441"
FT   CDS_pept        complement(133954..134310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01441"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71353"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU92"
FT                   /protein_id="ABM71353.1"
FT                   /translation="MDSAVDKLSILQESVNAFFIKFFDGMYPEKVDRDPDLVKLKRIGA
FT                   LNQFKGIDKDYSDVDIKMDITKAFTNIIEHGDGVAMLQEENVPFEESIERLVLEELTNT
FT                   ENGYGYDFNDDMEY"
FT   gene            complement(134401..134718)
FT                   /locus_tag="P9515_01451"
FT   CDS_pept        complement(134401..134718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01451"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71354"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU93"
FT                   /protein_id="ABM71354.1"
FT                   /translation="MLRLLPLPIFICIYLFSWWRCRKNIAASDEQLKPCIDWAYVKNLP
FT                   LPKKPSFVEFYIVYISSFIRLPFGIIIQQLPFSKKVRNYEREMKLIFDKWNLEKIKKII
FT                   N"
FT   gene            complement(134725..134913)
FT                   /locus_tag="P9515_01461"
FT   CDS_pept        complement(134725..134913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01461"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71355"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU94"
FT                   /protein_id="ABM71355.1"
FT                   /translation="MSTSWEHFKRESDKTLWVHICGNPKSQIAMAVNKWWHTRYPTYKM
FT                   RICNKETFDSIKKKNSP"
FT   gene            complement(134943..135158)
FT                   /locus_tag="P9515_01471"
FT   CDS_pept        complement(134943..135158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01471"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71356"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU95"
FT                   /protein_id="ABM71356.1"
FT                   /translation="MVVKTIFSHSIGVEIIQESKALTDFVDNECIRYDELFEDEDIAEA
FT                   HGIRYSDIQEEPLDSPHFSFDFKEFS"
FT   gene            135243..135401
FT                   /locus_tag="P9515_01481"
FT   CDS_pept        135243..135401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01481"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71357"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU96"
FT                   /protein_id="ABM71357.1"
FT                   /translation="MRLTTPFTAFRNATSDIWRMHDFNYQLPKDQRQGYWEKECIDHPT
FT                   SAHCKVY"
FT   gene            135425..135571
FT                   /locus_tag="P9515_01491"
FT   CDS_pept        135425..135571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01491"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71358"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU97"
FT                   /protein_id="ABM71358.1"
FT                   /translation="MKLITPFTILNQKFHEMDLIRDAMKNRRLATERLHDDLRKMYKKH
FT                   QFA"
FT   gene            complement(135768..136106)
FT                   /locus_tag="P9515_01501"
FT   CDS_pept        complement(135768..136106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01501"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71359"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU98"
FT                   /protein_id="ABM71359.1"
FT                   /translation="MIIYKAILQIKMSLFNKLSIEDITLSSKEAYQKELKKGMGSKIGK
FT                   SLFNKLSIEDIIISSKEAYQKELKKGMGSKIGKSLFNKLSIEDIIISSKEAYQKELKKG
FT                   MGSKIGKS"
FT   gene            136621..137250
FT                   /locus_tag="P9515_01511"
FT   CDS_pept        136621..137250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01511"
FT                   /product="Hypothetical protein"
FT                   /note="COG1230 Co/Zn/Cd efflux system component [Inorganic
FT                   ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71360"
FT                   /db_xref="GOA:A2BU99"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:A2BU99"
FT                   /protein_id="ABM71360.1"
FT                   /translation="MSNNCCQNKTKDIKKIQKQHSNVLWIVLFINLIMFVIELVGGLNA
FT                   KSLALNGDSLDMLGDSLVYGSSLFVIYKSKYAQARVALLKGFIMFGFGLIILIRGLYKL
FT                   YIWSIPFTQTMQSLGILALAANLSCLFLLTKYRKDNLNLSSVWLCSRNDITANVSILIS
FT                   AWITNIYSSPVPDIMVGFLLTFVFIKSSLKVIKASQKELSLGMNQL"
FT   gene            complement(137254..138327)
FT                   /gene="rfbB"
FT                   /locus_tag="P9515_01521"
FT   CDS_pept        complement(137254..138327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="P9515_01521"
FT                   /product="dTDP-D-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /EC_number="4.2.1.47"
FT                   /EC_number="5.1.3.2"
FT                   /EC_number="5.1.3.7"
FT                   /note="COG1088 dTDP-D-glucose 4,6-dehydratase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71361"
FT                   /db_xref="GOA:A2BUA0"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUA0"
FT                   /protein_id="ABM71361.1"
FT                   /translation="MIKNKYKIIVTGGAGFIGGTLIRKILQEKKDWVVYNLDQMGYASD
FT                   LSWIKNSEDYKFRHFFLKIDLRNKEILENLVKEINPNLIIHLAAESHVDRSIDNPLKFI
FT                   ESNIIGTFNLLEASRAYWKKLSDNKKQLFRFIHISTDEVFGSLGLDGKFDENTKYSPRS
FT                   PYSASKASSDHLAQSWYHTYGLPTIISNCSNNFGPYQFPEKLIPLSILKGIKGEKIPLY
FT                   GNGLNVRDWLYVEDHVEALLLIAEKGEVGKSYCIGGFGERTNKEVQLQICKILDAVAPK
FT                   EFPHESLIKNVTDRPGHDIRYAINSNLIKEKLGWTPKVTFEDGLKKTIYWYLNHSKWIH
FT                   SMMQKSGYAGNRIGNKK"
FT   gene            138435..139577
FT                   /locus_tag="P9515_01531"
FT   CDS_pept        138435..139577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01531"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71362"
FT                   /db_xref="GOA:A2BUA1"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUA1"
FT                   /protein_id="ABM71362.1"
FT                   /translation="MYSKIKNKLRFNRVTRIIRFKNRISANEACTYWLKNNKNKFTYED
FT                   NNINSFNLDITPIDQKPIPLYFLWANPVISRARFIYSFNNVVVSPYESHIYFYDIDKST
FT                   SDLGTKFDNDKLSLFDFYKKNELFAAKELKGNVLHLGISSNPSNFYHWIHEIYARILRI
FT                   KKKYDLNKFDFVIMPKLNNKFQKEALELLEFDTSKILSSEKFYKCTGNLVTANIDIIAS
FT                   GLDLRNFFANNHELKSNKLKKYFLDRDSNSGIQKRELINFDRFKSKYKDAGFEFVKPEQ
FT                   LSFKEQLKIFLSAKSLVGVSGSAFCLVSLMNEGSKVVEIFSKSFVDPAISNICAASNLK
FT                   YGFYIEDSYRPKIENNWVRDLNSKINADLIDHEKIIKFFI"
FT   gene            complement(139650..141308)
FT                   /locus_tag="P9515_01541"
FT   CDS_pept        complement(139650..141308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01541"
FT                   /product="Hypothetical protein"
FT                   /note="COG2274 ABC-type bacteriocin/lantibiotic exporters,
FT                   contain an N-terminal double-glycine peptidase domain
FT                   [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71363"
FT                   /db_xref="GOA:A2BUA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUA2"
FT                   /protein_id="ABM71363.1"
FT                   /translation="MTIGTMVPFISFVSNPNKILEIEFLRRISDFFNFQQTDQLFIFIS
FT                   FSFLIIILFSGLIKIFCIKKINDFGGTLNIELGKKLYKEILYQDYEYHLNTNSSQLIST
FT                   QIQQLESSLAVISESLLLGLSVLNILGITISLFIIDSKIIICIFTFSLLFYVIASKSTK
FT                   KYVDVYGKIIFETRKNIIRIVQESLGFIRQIILDDSHSFFIQEYDKNNIQNTLANTNSN
FT                   TISQIPRYLMESLILSGLVISIIFIYLSGIDFYNYLTKGGAFILGLQKLLPLFQKTFRS
FT                   VFFIRQEKLSVNSVVQLLKETKKHKHNSRDKLVNNFEIKNKIRFENISFSYKENTVLEN
FT                   INLVIKRGEVIGIVGKTGTGKSTFIDILLGLIKPNSGYIYIDEKKMDPNLFRRFRLSVS
FT                   SVPQDYFLLDRTIEENIVFGKSKSKIDYKLLNKVVKISMLQDLVNSLSYGLQTFVGENG
FT                   IRLSGGQKQRLAIARALYKKHSLLILDEATSSVDSETEKSILDNIITDNPEITVLMIAH
FT                   RLQTLKNCDYILEIKNKKLIKYQNIKEYKYKYDSN"
FT   gene            complement(141909..142268)
FT                   /locus_tag="P9515_01551"
FT   CDS_pept        complement(141909..142268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01551"
FT                   /product="possible Signal peptide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71364"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUA3"
FT                   /protein_id="ABM71364.1"
FT                   /translation="MKKKSITYADLSKKQLHHLKEHYIQKKVNSMSHKELTEFVLEIIS
FT                   HQINNTIGKEEEMEAWQEMSDFYGDQFEIIILEIQQKYINNESIQNIEEDTQERRLELL
FT                   EKNNLDKAKQDMWDD"
FT   gene            142690..143472
FT                   /gene="rpaA"
FT                   /locus_tag="P9515_01561"
FT   CDS_pept        142690..143472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpaA"
FT                   /locus_tag="P9515_01561"
FT                   /product="two-component response regulator"
FT                   /EC_number="3.1.1.61"
FT                   /note="COG745 Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71365"
FT                   /db_xref="GOA:A2BUA4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUA4"
FT                   /protein_id="ABM71365.1"
FT                   /translation="MKISILLIEDDRDMRELVAGHLEHSGFDVQKAEDGIKGQALALQY
FT                   SPDLILLDLMLPSVDGLTLCQRLRRDERTSNIPILMITALGGLKDKVTGFNSGADDYIT
FT                   KPFDLEELHVRIKALLRRTNRAQLNSTNQQEILNYGPLTLVPERFEAIWFESPVRLTHL
FT                   EFELLHCLLQRHGQTVSPALILKEVWGYEPDDDIETIRVHVRHLRTKLEPDPRKPTYIK
FT                   TVYGAGYCLELPDEAKVDVASQKFTESRNSSLINTVIE"
FT   gene            complement(143476..144435)
FT                   /gene="holB"
FT                   /locus_tag="P9515_01571"
FT   CDS_pept        complement(143476..144435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="P9515_01571"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71366"
FT                   /db_xref="GOA:A2BUA5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUA5"
FT                   /protein_id="ABM71366.1"
FT                   /translation="MINLENDNLLINKEVNQILENILQTKVFSNGYIFYGPEGIGKKQT
FT                   AIEFIKEIFIQDSSNSNIQEKIIDNNHPDFLLIEPTYVFKGNLINSSEADSSKNKKATI
FT                   RIEQIRNIKNFLAQKSIESGKKIVLIIDADLLNEAASNCLLKTLEEPTNGLFILLTSRL
FT                   SSLLGTIISRCQLIRFKSFSYKQLEIFIKNNTDDSILNNEEKVNLEDLIYSANGSPGKI
FT                   LKNIKMWNELPNEIKDNLSFPLMNNLEILKVSKIIAEELVLDQQIFLVNLMQKKCWETA
FT                   KNKKIIKTLEKLKIHLMNFTQPRLAWEVSLLKIANEDL"
FT   gene            complement(144439..145071)
FT                   /gene="tmk"
FT                   /locus_tag="P9515_01581"
FT   CDS_pept        complement(144439..145071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="P9515_01581"
FT                   /product="Thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="COG125 Thymidylate kinase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71367"
FT                   /db_xref="GOA:A2BUA6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUA6"
FT                   /protein_id="ABM71367.1"
FT                   /translation="MKGKFIVIEGIDGCGKTTQIDEISRWLPTSGLMGKNSKLIKTREP
FT                   GGSLLGKKLRNLILDNNKNNKPSSLAELLLYSADRAEHVSKIISPALKKEDWVISDRFS
FT                   DSTLAYQGYGRHINLEIIKNIESIVCQGEYPDLTIFLEISAEESILRRKNFVPDRMESE
FT                   GINFLQKVNEGFKLIAKEKKWKVISATQNITAISNEIKETLLKTFRN"
FT   gene            complement(145072..147369)
FT                   /gene="zntA"
FT                   /locus_tag="P9515_01591"
FT   CDS_pept        complement(145072..147369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zntA"
FT                   /locus_tag="P9515_01591"
FT                   /product="putative P-type ATPase transporter for copper"
FT                   /EC_number="3.6.3.4"
FT                   /note="COG2217 Cation transport ATPase [Inorganic ion
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71368"
FT                   /db_xref="GOA:A2BUA7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUA7"
FT                   /protein_id="ABM71368.1"
FT                   /translation="MKSIQLNINGMKCGGCVNTVENILKNSDGIENVSVNLLTESAYIE
FT                   VNKTFQNIDQVLENLNQSGFPSKIYINDFSKKVNKVQLEKKKKWVNQWKKLTFALLLLL
FT                   LSGLGHLAEGGYLNLPILGNLFFHALLATTALLFPGREILIKGFKSFLRNRPDMDSLVA
FT                   LGVTSAYITSLLSLIFPSTGFPCFFNEPVMLLGFILIGRFLEERAKYHTGSSIGELLDL
FT                   QPEMANIYLEENKVKSVRVHSLKPGDEIQLLAGDRVPADCTVIEGNSSLDVSHITGESK
FT                   PINVRPGEHLLNGSLNLNSTLRLKVIKVGDDTSLAKLVNLIESVQFNKPPIQRIADQIA
FT                   GKFTYFVLFIATSSFFFWWKGAKQIWPDLLIHDHHGLIDASNHTLHNSLGSNAENFLSL
FT                   AIQLSIAVLVIACPCALGLATPTVITVASGKAAKKGILFKGGDKIEMASKINHIIFDKT
FT                   GTLTKGEPFIINYINSDDNLYLLKVSASLESQSRHPIAKALVKEANKQNLSLLPIKSIH
FT                   TESGRGISGDLESIDGVINIGSIEWLISKGVIIDSESQKMLETQENKSHSVIGVSINNE
FT                   LLGFILLGDLLREDSISSVQKLRKDNYKINILSGDRKETVVELAKKIGSPEDEIKWDLL
FT                   PEMKLKIIENLKENYKVAMIGDGINDAPALAASNLGIAVGSGTQIAKANADVVLMGDHL
FT                   SGLPYALSLAKRTIRKIKQNIFWAFGYNLIAIPLAAGILFPKYGILLTPSIAALLMATS
FT                   SITVVINALSLE"
FT   gene            147489..148010
FT                   /locus_tag="P9515_01601"
FT   CDS_pept        147489..148010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01601"
FT                   /product="cyanobacterial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71369"
FT                   /db_xref="GOA:A2BUA8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022818"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUA8"
FT                   /protein_id="ABM71369.1"
FT                   /translation="MPNNQNRDNFIDKAFTVIAESIVKIMPIADKEKKAYIYYRDGLAA
FT                   QNNGDYSEALEYYKESLLLEENKIDRGETLKNMAIIYMSNGEEDLSIETYQKALVENPK
FT                   QPSCLKNIGLIYEKRGRYAEQNGDLDQRDMWFDKAAQVWSKAVRLYPGGYLDIENWLKT
FT                   SGRSSIDIYL"
FT   gene            complement(148021..149373)
FT                   /gene="sms"
FT                   /locus_tag="P9515_01611"
FT   CDS_pept        complement(148021..149373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sms"
FT                   /locus_tag="P9515_01611"
FT                   /product="putative DNA repair protein RadA"
FT                   /note="COG1066 Predicted ATP-dependent serine protease
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71370"
FT                   /db_xref="GOA:A2BUA9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUA9"
FT                   /protein_id="ABM71370.1"
FT                   /translation="MSSKFSTFICQNCGSETSQYFGRCVNCNEWNTIVEERKISRSKTT
FT                   NITKSKKSKLFHEIELNTISRFTSGFKEFDRVLGGGIVPGSLVLLGGEPGIGKSTIVLQ
FT                   SAGIISLNEKVLYITAEESLEQVKIRWERLNQSSLDLKIYAETNLSLIIEEIKKIKPSF
FT                   AIIDSIQAINNDEMESSPGSVSQVRACSSELQNLAKENNIALLIIGHVTKEGALAGPKT
FT                   LEHLVDVVLNFEGDNIASHRLLRSVKNRFGSTFEIGIFEMLENGLKEVGNPSSIFTNKE
FT                   NISGVTTTITNEGSRPFAVDIQALVNKTFYTNPRRTTTGISINRLHQILAVIEKHVGIK
FT                   LSDYDCYIATGGGFEINDPSSDLGVAISILSSLKNIPPLINCSFVGELGLSGQVRQANN
FT                   LRTKIDEAIRLGFKNILIPKTTCEIKDNFQTLIKIKEISNINEAMNYVLKE"
FT   gene            149479..150225
FT                   /locus_tag="P9515_01621"
FT   CDS_pept        149479..150225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01621"
FT                   /product="two-component response regulator"
FT                   /EC_number="3.1.1.61"
FT                   /note="COG745 Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71371"
FT                   /db_xref="GOA:A2BUB0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUB0"
FT                   /protein_id="ABM71371.1"
FT                   /translation="MAVSSQTKETILVADDEASIRRILETRLSMIGYKVVTACDGKEAL
FT                   KLFKDYDPDLVVLDVMMPKLDGYGVCQELRKDSDVPIVMLTALGDVADRITGLELGADD
FT                   YVVKPFSPKELEARIRCVLRRIDKEQLPGMPNSGLILVTDIKIDTNRRQVFKSDERIRL
FT                   TGMEFSLLELLVSRSGEPFSRGEILKEVWGYTPERHVDTRVVDVHISRLRSKLEADPAN
FT                   PELILTARGTGYLFQRIVDISPFDGK"
FT   gene            150226..151680
FT                   /gene="plsX"
FT                   /locus_tag="P9515_01631"
FT   CDS_pept        150226..151680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="P9515_01631"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="COG416 Fatty acid/phospholipid biosynthesis enzyme
FT                   [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71372"
FT                   /db_xref="GOA:A2BUB1"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUB1"
FT                   /protein_id="ABM71372.1"
FT                   /translation="MEKDSSNKKSRAIRRLVIWYKRNSAVTSIVDTAANSAVTAGNVAG
FT                   NVVSGAGSVVNTASNVAGNVVSGAGSVVNTASNVAGNVAGNVVSSAESVVNTASSVVSN
FT                   ASSIAKNTLQPLVFDPLKRLQNNDNYINKEEISNPKRIWIAVDGMGGDYAPVPILEGCL
FT                   DAISRFPINIKFVGKIEKVRCEAEKAGLIDLLEKEIDNNRLELIDSGDPIGMNEEATAV
FT                   RKRKDASINVAMDLVKNNKAEAVYSAGNSGALMASAIFRIGRLKGIERPAIGALFPTRD
FT                   QTRPVLVLDVGANTDCKPSYLHQFALLGNVYAKDVLQIEKPRIGLLNIGEEECKGNDLS
FT                   LKTFKLLSQEKSFNFGGNCEGRDVLSGNFDVVVCDGFTGNVLLKFLESVGGVLLDILRS
FT                   ELPRGRRGKVGSAFLKSNLIRIKKRLDHAEHGGALLLGVNGICVIGHGSSKSLSVVSAL
FT                   RLAHSAVNHNVMENLNQLQKLQVLNS"
FT   gene            151734..152741
FT                   /gene="fabH"
FT                   /locus_tag="P9515_01641"
FT   CDS_pept        151734..152741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="P9515_01641"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="COG332 3-oxoacyl-[acyl-carrier-protein]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71373"
FT                   /db_xref="GOA:A2BUB2"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUB2"
FT                   /protein_id="ABM71373.1"
FT                   /translation="MEVINSNQIGVSFKGSGSYVPHQILTNHEISKKVDTSDEWIKSRT
FT                   GISQRRISGLSENVSEMGYKAGLAAIEMAKWDIETIDLIILATSTPHDLFGSAPEIQSK
FT                   LGANNAVAFDLTAACSGFLFAVITATQFLKAGSYRRAIVIGSDQLSSYVDWNDRRSCIL
FT                   FGDGAGALAIEATNEFDNLIGFSMRTDGQRGSFLNLPSQKNNDQIIDNINFSSGGFSTI
FT                   AMNGQEVYKFAVREVPLIIDNLFKKTNFNSEKINWLLLHQANQRILDSVGDRLNISSEK
FT                   ILSNLSNYGNTSAATIPLMLDEAIRNKKIKENDIIATSGFGAGLSWGAALIRWG"
FT   gene            152760..153638
FT                   /gene="fabD"
FT                   /locus_tag="P9515_01651"
FT   CDS_pept        152760..153638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="P9515_01651"
FT                   /product="Malonyl coenzyme A-acyl carrier protein
FT                   transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="COG331 (acyl-carrier-protein) S-malonyltransferase
FT                   [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71374"
FT                   /db_xref="GOA:A2BUB3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUB3"
FT                   /protein_id="ABM71374.1"
FT                   /translation="MTVAWVFPGQGSQKIGMANEIIDLPNAKNRFNYASELFGKNLLQI
FT                   CELDSAGLSNTKNTQICLFLVESVLLDALKENGFKPNYIAGHSLGEITALYCADVLSFE
FT                   DCVSLIKVRSGLMGDAAKGSMAALISFDRDQLDLLVKEIDDLVIANDNSSTQVVLSGSE
FT                   QALDNISKRITAKRFLKLNVSGAFHSPFMKEPSFQFSKYLDTLEFNQPSFSVISNSNPS
FT                   LCNDPNELKVRLKNQMCNGVRWRETMDLMRENGILQMVEIGPSNVLGGLAKRHLKDIKI
FT                   SQISSSDQIKY"
FT   gene            153643..154263
FT                   /locus_tag="P9515_01661"
FT   CDS_pept        153643..154263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01661"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="COG204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71375"
FT                   /db_xref="GOA:A2BUB4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUB4"
FT                   /protein_id="ABM71375.1"
FT                   /translation="MKSNFYQKLIYQLVSNVIIYPIYKLIFRGKLLGREHIPQKGSFIL
FT                   VSNHGSLLDPPILGHAVGRNISFMAKSELFRIPLLGFIIRSCGAYPVKRGIVDKTTIKI
FT                   ACEKLSNNNSIGIFIDGTRQKDGRVNKPKQGAALLSFKNQKMLLPVAIINSHRLMRLKF
FT                   FIPFFTKIVIKVGRPIPPPKSSSKKDLMEVTNCLQESINNMLE"
FT   gene            complement(154268..154918)
FT                   /locus_tag="P9515_01671"
FT   CDS_pept        complement(154268..154918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01671"
FT                   /product="putative molecular chaperone"
FT                   /note="Inactive homolog of metal-dependent proteases"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71376"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUB5"
FT                   /protein_id="ABM71376.1"
FT                   /translation="MPYDKKNFNKLTLAIHSTDNSFAFAYRENNQSISDNFFTKKFEKD
FT                   LCNNLIVDFSNFITKENLKRIDKISVSTGPSNFNASRQIIVLARTLAQQINCSIDSFSS
FT                   FELMAKRIALKNNINSNKNSFWIFKKLKRRGYIAGKYQICISEKTNNKISIKEKIIPKI
FT                   FEELINIDSSYQAEYSDIEDLKELLNLSDNNVQNSKSSTWKKVLPLYPLSPIN"
FT   gene            complement(154925..155176)
FT                   /gene="ycf34"
FT                   /locus_tag="P9515_01681"
FT   CDS_pept        complement(154925..155176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf34"
FT                   /locus_tag="P9515_01681"
FT                   /product="putative Ycf34"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71377"
FT                   /db_xref="InterPro:IPR019656"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUB6"
FT                   /protein_id="ABM71377.1"
FT                   /translation="MCICINCKLVDRCMTYHDVEKNHGVEHISDFPNFKPKKPYIHVSI
FT                   IKDLDGDFKTDWDVKSCSSFLEEAGKWSKCKPGQELPV"
FT   gene            155163..156410
FT                   /locus_tag="P9515_01691"
FT   CDS_pept        155163..156410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01691"
FT                   /product="Poly A polymerase family"
FT                   /EC_number="2.7.7.19"
FT                   /EC_number="2.7.7.72"
FT                   /note="COG617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71378"
FT                   /db_xref="GOA:A2BUB7"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUB7"
FT                   /protein_id="ABM71378.1"
FT                   /translation="MQMHIIKEENLKNHIFIDHTLIINEIERSIKFYNWEFILSFLPSG
FT                   SYLVGGYIRDLILGRLNSLIDVDIVVPKNAIKIGKKIADKFEGKFIILDEARDVVRLIF
FT                   KHVSVDIASQISPSIEIDLFSRDFSINAIAFSFDKKLLIDPSNGIKDLQLSLLRTHSKQ
FT                   NLLEDPLRILRCFRFVSELNFNVDVNLINVIKTCKNKLSLIASERINYEIQRIIIGSEA
FT                   AYAIKLINKFKIFDYLQSEKNLIFIDLQKINFEAFSKIEKDKFFPLFFLSQILDEFSLK
FT                   ILKFRKSEIAKIRLLRKWNLLLKRKTIYELDERERFNLHQELENILPSFILFLQESFYI
FT                   DWLERWRNKDDKLFHPSNLIKGTVLKKYLKIQEGPVLGKVMNYLSMELAFNRLNNFDEA
FT                   IYKGKQWIQQNAPKCD"
FT   gene            156471..156890
FT                   /locus_tag="P9515_01701"
FT   CDS_pept        156471..156890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01701"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71379"
FT                   /db_xref="GOA:A2BUB8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUB8"
FT                   /protein_id="ABM71379.1"
FT                   /translation="MSIRIYIGNLPQGFNPKDFDSILKSVSDSIRFKAVLDKETKECRG
FT                   FGFATTNNEQNANLIIEKLNGFEFNGSKLRVELSEKKDSSSHKRNSLGSNKNKKRKDFK
FT                   KIVHSDAPNLEAPDPRWAGELSKLKDLLANQKTPA"
FT   gene            complement(156891..157799)
FT                   /gene="crtB"
FT                   /gene_synonym="pys"
FT                   /locus_tag="P9515_01711"
FT   CDS_pept        complement(156891..157799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtB"
FT                   /gene_synonym="pys"
FT                   /locus_tag="P9515_01711"
FT                   /product="Squalene and phytoene synthase"
FT                   /EC_number="2.5.1.32"
FT                   /note="COG1562 Phytoene/squalene synthetase [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71380"
FT                   /db_xref="GOA:A2BUB9"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUB9"
FT                   /protein_id="ABM71380.1"
FT                   /translation="MKNSLSQLNKAYEICRKETQQWAKTFYLGTLLLPYEKRKAIWAIY
FT                   VWCRRTDEIMDSVEASSKTTEELSDNLDEWEANTINVFKGNIKSDLDAVLFDTIEKFPQ
FT                   NIEPYLDMIEGQRMDLKKYRYENFSELKLYCYRVAGTVGLMTQNVMGIDSAYTSAPWSN
FT                   MPDPSEAAIALGIANQLTNILRDVGEDRQRGRIYLPQEDMNNFNYSEEELLKGVINTQW
FT                   KMLMNFQLTRARDWFKKSEDGIKWLSADARWPVWTSLRLYRGILDSIEKLDYDVFNNRA
FT                   FVKNSVKAFEIPISFLISRIK"
FT   gene            complement(157822..159243)
FT                   /gene="pds"
FT                   /locus_tag="P9515_01721"
FT   CDS_pept        complement(157822..159243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pds"
FT                   /locus_tag="P9515_01721"
FT                   /product="phytoene desaturase"
FT                   /EC_number="1.3.5.6"
FT                   /note="COG3349 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71381"
FT                   /db_xref="GOA:A2BUC0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014102"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUC0"
FT                   /protein_id="ABM71381.1"
FT                   /translation="MRVVIAGAGLAGLSCAKYLVDNGHIPIVLEARDVLGGKVAAWKDE
FT                   DGDWYETGLHIFFGAYPNMLQLFKELDIEDRLQWKSHSMIFNQPSEPGTYSRFDFPDLP
FT                   APANGVTAILSNNDMLSWNEKILFGLGLVPAMLRGQKYLDKCDSKSWSEWLKEHNIPER
FT                   VNDEVFIAMSKALNFIGPDEISSTVLLTALNRFLQEKNGSKMAFLDGAPPERLCQPIVD
FT                   YIKARGGEVHMNSPLRKIDLNQDSTVKSFTIASPDKDEKKKVITADAYVSAMPVDLFKL
FT                   MIPDQWKGINAFSKLDGLIGVPVINIHLWFDKKLTDIDHLLFSRSPLLSVYADMSITCK
FT                   EYEDPNRSMLELVFAPAKDWINRSDQDIVDATMEELKKLFPTHFIGDEKTQLRKYKVVK
FT                   TPRSVYKAVPGCQEFRPSQRSPIKNFFLAGDYTMQKYLASMEGAVLSGKLCAESINKEY
FT                   SKTTNNVSQESSKIN"
FT   gene            159332..159679
FT                   /locus_tag="P9515_01731"
FT   CDS_pept        159332..159679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01731"
FT                   /product="NADH dehydrogenase I subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71382"
FT                   /db_xref="GOA:A2BUC1"
FT                   /db_xref="InterPro:IPR018922"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUC1"
FT                   /protein_id="ABM71382.1"
FT                   /translation="MEKMLLKSTTRHVRIFTAEVVNNDLKYHPNKLTLDLDPDNEFIWN
FT                   EESLKKVNQKFTELVEERAGKSLDDYELRKIGSEVEGLIKYLLQNSLLSYNPECRVMNY
FT                   SMGLPKTKEVL"
FT   gene            159676..160296
FT                   /locus_tag="P9515_01741"
FT   CDS_pept        159676..160296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01741"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71383"
FT                   /db_xref="GOA:A2BUC2"
FT                   /db_xref="InterPro:IPR021511"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUC2"
FT                   /protein_id="ABM71383.1"
FT                   /translation="MSRYSNRGSRRGPSNNSYSSTSIDGDNYTPRRRISPPNSEQKNNF
FT                   NTATIAVLAGVLILGVGIGSAITSTTDGGQGNIASQQQLDMAVPDPEFCRQWGASAFVI
FT                   DVEMYTTLNPSTSFVTQPALQPGCVIRRENWTVLQKQGAISNEDVRECKQRMNTFAYIG
FT                   SIRDKPIVKCVYQTDVNENKFIIKGEGQAEDGGVGINKEAIQF"
FT   gene            complement(160293..161246)
FT                   /gene="rbcR"
FT                   /locus_tag="P9515_01751"
FT   CDS_pept        complement(160293..161246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcR"
FT                   /locus_tag="P9515_01751"
FT                   /product="putative Rubisco transcriptional regulator"
FT                   /note="COG583 Transcriptional regulator [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71384"
FT                   /db_xref="GOA:A2BUC3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUC3"
FT                   /protein_id="ABM71384.1"
FT                   /translation="MPELPFTLDQLRILKAIAAQGSFKKAADLLYVTQPAVSLQIQNLE
FT                   KQLEITIFDRGGRKALLTEGGKLLLEYCERILNQCDEACKAIEDLNSLKGGTLIIGASQ
FT                   TTGTYLMPRMIGLFRQKYPDVSVQLQVHSTRRTGWSVANGQIDLAIIGGQLPSDLENLL
FT                   QVIPYATDELALVLPTKHPLANKRELMKEDLYKLNFVTLDSQSTTRKVVDKLLKDSGLD
FT                   IQRLKIEMELNSLEAIKNAVQSGLGVSFLPVVSIERELAGGSIHKSYLADLEVKRELKL
FT                   ITNPSRYTSRASEAFKKNILPQFASSESPLRQINSI"
FT   gene            161330..162058
FT                   /locus_tag="P9515_01761"
FT   CDS_pept        161330..162058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01761"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4094 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71385"
FT                   /db_xref="GOA:A2BUC4"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUC4"
FT                   /protein_id="ABM71385.1"
FT                   /translation="METHKTSFLILVLIFIFAVIHSGGAALRSRAEAVMGPRLWRLCFV
FT                   SLSLPSAVILISYFLAHRYDGIRLWNFQGNNYVFLLVWILTAISFLFLYPATYNLLEIP
FT                   SVLKPQVRIYGTGIMRITRHPQAFGQIIWCLAHTLWIGTSFTFITSLGLIFHHLFAIWH
FT                   GDRRLEIKFGKEFYKFKESTSIIPFVAIFDGRQQIKIKEFFKLSQLGILIAIAVIWWSH
FT                   KYINIAVITFNSSFMSKIFS"
FT   gene            162092..164128
FT                   /gene="ndhF"
FT                   /locus_tag="P9515_01771"
FT   CDS_pept        162092..164128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /locus_tag="P9515_01771"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 5)"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1009 NADH:ubiquinone oxidoreductase subunit 5
FT                   (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit
FT                   [Energy production and conversion / Inorganic ion transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71386"
FT                   /db_xref="GOA:A2BUC5"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR002128"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUC5"
FT                   /protein_id="ABM71386.1"
FT                   /translation="MPQASEIAWLIPVFPLIGAVLSGLGLICANKKINNSREIVAISLL
FT                   SFVGVSAVISYKTLIEQIKGYHSVEKLFVWASAGDFTIPMGFVLDPLGSVMLTLVTTIT
FT                   LLVMIYSHGYMAHDKGYVRFFTYLALFSSSMMGLIISPNLLEIYVFWELVGMCSYLLVG
FT                   FWYDRDGAANAAQKAFVVNRVGDFGLLLGILGLFWATKSFDFTEIALGVSQSVSENSLP
FT                   VWAALLLCFLVFLGPMAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLQ
FT                   PLYSLFPSIQFIIALVGTITCFLGASIALTQMDLKKGLAYSTVSQLGYMMLAMGCGAPV
FT                   AGIFHLITHACFKAMLFLGSGSVIHAMEEVVGHQPVLAQDMRLMGGLRKKMPFTSTTFL
FT                   IGCVAISGIPPLAGFWSKDEILGNAFISFPAFWFVGFLTAGMTAFYMFRLYFLTFEGEF
FT                   RGENKELQKELLLAAEINIEEEQQHEEEQQHEEEHGSLHESPWSMTFPLVFLAVPSVII
FT                   GFMGFPWDSKFANLLDPEEALMAIESFELKEFLPLALASVFIASIGITIAYQAYFAKKI
FT                   NLSILFAQRFPSVNKFLAKKWYLDDINEKLFVKGSRKLAKEVLEVDSKVVDGVVNLTGL
FT                   VTLGSGEGLKYFETGRAQFYALIVFGGVILLVAIFGFQSPQIT"
FT   gene            164213..165853
FT                   /locus_tag="P9515_01781"
FT   CDS_pept        164213..165853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01781"
FT                   /product="putative NADH dehydrogenase subunit (chain 4)"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1008 NADH:ubiquinone oxidoreductase subunit 4
FT                   (chain M) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71387"
FT                   /db_xref="GOA:A2BUC6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUC6"
FT                   /protein_id="ABM71387.1"
FT                   /translation="MSSLFFTHFALKTIGTLGGGLSDFPWLSISILFPIASAFLIPFFP
FT                   DKGEGKEVRWFALSVALITFLVTVGAYINGFDINNENVQLKESISWLPKLGLTWSVGAD
FT                   GISMPLILLTSFITALAVLAAWPVKFKPKLFFFLILIMDGGQIAVFAVQDMLLFFLTWE
FT                   LELLPVYLLLAIWGGKNRQYAATKFIIYTAGSSIFILLAALAMGFYGTEVPNFEFAHLA
FT                   NQNFSQNFQILCYIGLLIAFGVKLPIVPLHTWLPDAHGEATAPVHMLLAGILLKMGGYA
FT                   LLRFNAQLLPVAHAQFAPLLIVLGVVNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIG
FT                   IGSFSSLGTSGAMLQMVSHGLIGASLFFLVGATYDRTKTLKLDEMGGVGQKMRIMFALW
FT                   TACSLASLALPGMSGFVSELMVFTGFVTDEVYTLPFRVVMASLAAVGVILTPIYLLSML
FT                   REIFFGKENPKLTEDRNLIDAEPREVYIIACLLLPIIGIGLYPRLVTESYLATISNLVD
FT                   RDLNAVKSVPKTNIFAGNKKSQILKAPTI"
FT   gene            165964..166797
FT                   /locus_tag="P9515_01791"
FT   CDS_pept        165964..166797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01791"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG1354 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71388"
FT                   /db_xref="GOA:A2BUC7"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUC7"
FT                   /protein_id="ABM71388.1"
FT                   /translation="MGPRLLIKFLQDAAGRGDLDPWDIDVISVIDSFLEQFKQNLKYSS
FT                   NDQMSYEKDLSETSEAFFAASVLVNLKAQVLESDVFPEEILGFEDEIDMDNQEWINQGF
FT                   DIPKYPEKYLRRRSVAQPVIKRTSTLGELVSQLESIAEIIETQDLLLMKRKRNKKYSDK
FT                   ILISKVQSLAHREKLPETTKALGKFIDGWEKALQWTDFEYLVNKWQNVVKSDLDKDRLG
FT                   VFWALLFLSSENKIEIKQKNSLYGPIQIKRILPDGELAQLPIDNLEVAETSSTAA"
FT   gene            166846..168024
FT                   /locus_tag="P9515_01801"
FT   CDS_pept        166846..168024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01801"
FT                   /product="Putative sugar-phosphate nucleotidyl transferase"
FT                   /EC_number="2.7.7.13"
FT                   /note="COG1208 Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B,
FT                   gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell
FT                   envelope biogenesis, outer membrane / Translation,
FT                   ribosomal structure an"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71389"
FT                   /db_xref="GOA:A2BUC8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037538"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUC8"
FT                   /protein_id="ABM71389.1"
FT                   /translation="MKAMILAAGKGTRIQPITHIIPKPMIPILQKPVMEFLLELLKEHG
FT                   FKEIMVNVSHLAEEIENYFRDGQRFGVEIAYSFEGRIEDGEMIGDALGSAGGLKKIQDF
FT                   QNFFDETFVVLCGDALVDLDLTEAVRNHKQKGALASLITKKVTREQVSSYGVVVSDENG
FT                   RVKAFQEKPTVDTALSDSINTGIYLFEPEIFDYIPSGEKFDIGADLFPKLVEMDLPFFA
FT                   LPMDFEWVDIGKVPDYWSAIRNVLLGKVRQVEIPGKEIKPGVFTGLNVAANWDQVDIKG
FT                   PVYIGGMTRIEDGATIIGPSMIGPSCCICEGATIDNSIIFDYSKIGKGVQLVDKLVFGR
FT                   YCVGKNGDHFDLKDASLDWLITDSRRLDLTEPSPQQKAMAELLGSDLINIPD"
FT   gene            complement(168008..168898)
FT                   /gene="metF"
FT                   /locus_tag="P9515_01811"
FT   CDS_pept        complement(168008..168898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="P9515_01811"
FT                   /product="Methylenetetrahydrofolate reductase"
FT                   /note="COG685 5,10-methylenetetrahydrofolate reductase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71390"
FT                   /db_xref="GOA:A2BUC9"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUC9"
FT                   /protein_id="ABM71390.1"
FT                   /translation="MKSKLQQTLEKNSKVITAELMPPRGGDPIRSLKIAQLLKNKVHAV
FT                   NITDGSRAIMRMCSLAMSKLLLENGIEPIMQISCRDRNKIALQSDILGANALGIKNILC
FT                   ITGDSVKAGDQQETKAVHEFEAVRLLKQIQYFNQGIDPTFEKLADNRTNIFAGAAVDPS
FT                   CRNQRSLKNRTRKKKEAGANFLQTQIVMDRNYLIDFCQEISNPLEIPVIAGVFLLKSYK
FT                   NALFINKFVPGANIPENILNRLKEAKDPLKEGILIAAEQAKDFINIAEGIHIMAVKAEN
FT                   LIPEILEKAGLNLEC"
FT   gene            168975..169253
FT                   /gene="csgD"
FT                   /locus_tag="P9515_01821"
FT   CDS_pept        168975..169253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgD"
FT                   /locus_tag="P9515_01821"
FT                   /product="Bacterial regulatory protein, LuxR family"
FT                   /note="COG2771 DNA-binding HTH domain-containing proteins
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71391"
FT                   /db_xref="GOA:A2BUD0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUD0"
FT                   /protein_id="ABM71391.1"
FT                   /translation="MQMVEEGINDIDMMGLSSREMEIIDLVADGLTNQEIAVKLTISKR
FT                   TVDNHVSNMFTKTGSKNRVALLNWAMDHGKICRDGFNCCSLPDSDQD"
FT   gene            complement(169216..169401)
FT                   /locus_tag="P9515_01831"
FT   CDS_pept        complement(169216..169401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01831"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71392"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUD1"
FT                   /protein_id="ABM71392.1"
FT                   /translation="MYGLYDRDGVLRFVNSDRKACLDYAELFELNSSHYCLMNLIETID
FT                   TENNINLDLNQVESNN"
FT   gene            complement(169476..169952)
FT                   /locus_tag="P9515_01841"
FT   CDS_pept        complement(169476..169952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01841"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG2954 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71393"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUD2"
FT                   /protein_id="ABM71393.1"
FT                   /translation="MTLEIERRFLIKNDQWKAFITHKTFIEQGYLSYDLEDWIIRIRFN
FT                   GKNFKIALKKHIKNFTNYEYEYSIPNSEGEQIMATLTNTIKKERFFLKIDQKDWIIDCF
FT                   KDRNFPLEIAEIELAEEKEQIILPPFLAKEITGLKIYTNLNLTKNPFSKWGNKD"
FT   gene            complement(169953..170852)
FT                   /locus_tag="P9515_01851"
FT   CDS_pept        complement(169953..170852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01851"
FT                   /product="predicted inorganic polyphosphate / ATP-NAD+
FT                   kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="COG61 Predicted sugar kinase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71394"
FT                   /db_xref="GOA:A2BUD3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUD3"
FT                   /protein_id="ABM71394.1"
FT                   /translation="MLIIYRSNSSVAKEASIFCEKALKDRNIKSKSIGSDFDTKKIEQY
FT                   LFNLPSLPDLLIVLGGDGTVLKSANALVHYDIPLLSFNIGGNLGFLTQEKDFLFDKSFI
FT                   KILEKEEFTIDLRNRLHCEVYSKENLGVRKIIKSYDALNDFYFKSVEEDISPTNQIQIE
FT                   IDNEKVNEYKGDGLIISSSTGSTAYSMAAGGPIVHPSINAFVINPICPMSLASRPIIIP
FT                   DTSKVIIRAVQKNKREIKLWKDGSKCMTVKENDYCEINKGTKPCKMIKFNKSISYYITL
FT                   IKKLDWKGNLSLKNNQLN"
FT   gene            complement(170878..171198)
FT                   /gene="ndhE"
FT                   /locus_tag="P9515_01861"
FT   CDS_pept        complement(170878..171198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhE"
FT                   /locus_tag="P9515_01861"
FT                   /product="putative NADH Dehydrogenase subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG713 NADH:ubiquinone oxidoreductase subunit 11 or
FT                   4L (chain K) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71395"
FT                   /db_xref="GOA:A2BUD4"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUD4"
FT                   /protein_id="ABM71395.1"
FT                   /translation="MNLESIPLQAFLIVSSILFCIGIWGLLNSRNAVRVLMSIELMLNA
FT                   VNINLMAFSSYIDNNLIQGQVFTIFVITVAAAEAAVGLAILLSLYRNRVTVDMESFNLL
FT                   KW"
FT   gene            complement(171200..171799)
FT                   /gene="ndhG"
FT                   /locus_tag="P9515_01871"
FT   CDS_pept        complement(171200..171799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhG"
FT                   /locus_tag="P9515_01871"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 6)"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG839 NADH:ubiquinone oxidoreductase subunit 6
FT                   (chain J) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71396"
FT                   /db_xref="GOA:A2BUD5"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUD5"
FT                   /protein_id="ABM71396.1"
FT                   /translation="MSIAVTTQIICFSVLSLVVIVGALGVILLDSIVYSAFLLGGVFMS
FT                   VAGLYLLLNASFVAAAQVLVYVGAVNVLIIFAIMLVNKKEDLKPINNINSRRIISTSIC
FT                   LTLLSLLIRVDLSNVWSLADPNSSIGEESTIRIGEHLFSDYLLPFEVASVLLLMAMIGA
FT                   IVLARRDVFNKDISTGLPVDQELIEKPSEPLLIKKN"
FT   gene            complement(171812..172438)
FT                   /gene="ndhI"
FT                   /locus_tag="P9515_01881"
FT   CDS_pept        complement(171812..172438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhI"
FT                   /locus_tag="P9515_01881"
FT                   /product="putative NADH Dehydrogenase subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71397"
FT                   /db_xref="GOA:A2BUD6"
FT                   /db_xref="InterPro:IPR004497"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUD6"
FT                   /protein_id="ABM71397.1"
FT                   /translation="MKDFLQKVNSYIKEAFGAGKYLYDGLSVTFDHLRRRPVTVQYPYE
FT                   KLIPSERYRGRIHYEFDKCIACEVCVRVCPINLPVVDWVMNKETKKKELRNYSIDFGVC
FT                   IFCGNCVEYCPTNCLSMTEEYELATFDRHNLNFDNVALGRLPTNVTTDPSVKPLRELAY
FT                   LPKGVMDPHEVSSSDARVGKLPEEVYDWMKPKTNEMSDPAVKLNK"
FT   gene            complement(172508..173626)
FT                   /gene="ndhA"
FT                   /locus_tag="P9515_01891"
FT   CDS_pept        complement(172508..173626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhA"
FT                   /locus_tag="P9515_01891"
FT                   /product="putative respiratory-chain NADH dehydrogenase
FT                   subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1005 NADH:ubiquinone oxidoreductase subunit 1
FT                   (chain H) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71398"
FT                   /db_xref="GOA:A2BUD7"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUD7"
FT                   /protein_id="ABM71398.1"
FT                   /translation="MNTGLDLEYSFNEILKGFGLSSEIAHIIWLPLPMLIVLVSAVVGV
FT                   LVTVWLERKISAAAQQRIGPEYAGALGVLQPIADGLKLLVKEDIIPAKADSILFTTGPI
FT                   LVLVPVILSWLIVPFGQNLLISNVGIGIFLWIALSSIQPIGLLMSGYASNNKYSLLGGL
FT                   RAAAQSISYEIPLALSVLAVVLMTNSLSTIDIVNQQSGAGILSWNIWRQPVGFIIFWIC
FT                   ALAECERLPFDLPEAEEELVAGYQTEYAGMKFALFYLGSYINLILSALLVSILYLGGWG
FT                   FPIPVEIIAKVLNLPINAPVIQVFTASIGIIMTVLKAYLLVFIAILLRWTTPRVRIDQL
FT                   LDLGWKFLLPISLANLLLTAGLKLALPQFFGG"
FT   gene            complement(173702..174847)
FT                   /gene="gltA"
FT                   /locus_tag="P9515_01901"
FT   CDS_pept        complement(173702..174847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="P9515_01901"
FT                   /product="Citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="COG372 Citrate synthase [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71399"
FT                   /db_xref="GOA:A2BUD8"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUD8"
FT                   /protein_id="ABM71399.1"
FT                   /translation="MDPNKLILKPGLEGVPVTNSSICDIDGQNGKLLYRGYAIEELAQK
FT                   STFLETAFLLIWGELPSAIELRDFEQEVQMHRRLSFRVRDMMKCFPATGHPMDALQSSA
FT                   ASLGLFYSRRAIDDPKYIYNAVIRLIAKIPTMIAAFQLIRKGQDPIQPRDDLSYSSNFL
FT                   YMLTEKEQDPIAAKVFDRCLILHAEHSLNASTFSARVTASTLTDPYAVIASAVGTLAGP
FT                   LHGGANEDVIAMLEDIKTPEKAGCFLDDAIKNKKKIMGFGHREYKVKDPRAIILQKLAE
FT                   ELFIRFGKDEMYEVAKNLELEAIPRLGPKGIFPNVDFYSGLVYRKLGIPRDLFTPIFAI
FT                   SRVAGWLAHWREQLGANRIFRPSQIYTGSAPRDWISLENRK"
FT   gene            complement(174933..176390)
FT                   /locus_tag="P9515_01911"
FT   CDS_pept        complement(174933..176390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01911"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71400"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUD9"
FT                   /protein_id="ABM71400.1"
FT                   /translation="MNIKLLAVLTILSLFLIFGFEKISHSLSKENHENISELKILTYLP
FT                   TDNKALFISNSKISKITNNISNHYEAREQDQFVLIKDSIFAYLGIDLGINNLKDIYSNE
FT                   FALTTYDNKEKDFDDILIIFKIKEKKDIDDILNLSNKIDEPDKLIKIYRDNKLNYLKYI
FT                   YRTNDNYIITSSNENLILKALESSKIDKNIIRKYSFKEVLNNYKNEQNILLTNNFKQTE
FT                   LLNNENYNITKDDYLVTLFKFKDKEIILKSYLVNNNKNLDFQSYKKINKENIVKRNYQI
FT                   STYNSLFDSNKYLNQIKISDFEKDIFRELNKELKQNILLLITDNNWLIILDKNNFSFEK
FT                   LKLLEDLNKNSLTNNNNVYTIYSKDILKKEKDIIKESNYKKIFLIQSENLTFIGNNLVN
FT                   EAEIDLISKEFFNFRGDSQAKYFLNKKIDLNHPYSIQAKNISYLEKINFFFKNVTNVSS
FT                   QKFTEIIKQPIPETTPLYYEEINLKIF"
FT   gene            176473..176823
FT                   /gene="pspE"
FT                   /locus_tag="P9515_01921"
FT   CDS_pept        176473..176823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspE"
FT                   /locus_tag="P9515_01921"
FT                   /product="Rhodanese-like protein"
FT                   /note="COG607 Rhodanese-related sulfurtransferase
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71401"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUE0"
FT                   /protein_id="ABM71401.1"
FT                   /translation="MRNYPKIINALDLNKWFNSEDENPIIIDVRENSELEIACFPREFL
FT                   HLPISKISLDYVKTKISNVKDKKFVVLCHAGIRSYNFGQWSLDNNLVNEIWNLEEGIDG
FT                   WSRYIDQTIPRY"
FT   gene            complement(176827..178071)
FT                   /gene="trpB"
FT                   /locus_tag="P9515_01931"
FT   CDS_pept        complement(176827..178071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="P9515_01931"
FT                   /product="Tryptophan synthase subunit beta"
FT                   /EC_number="4.2.1.20"
FT                   /note="COG133 Tryptophan synthase beta chain [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71402"
FT                   /db_xref="GOA:A2BUE1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUE1"
FT                   /protein_id="ABM71402.1"
FT                   /translation="MVSTISRHDQNKNNDYLNQPSKEGRFGKYGGQYVPETLMPALFEL
FT                   EKAASDAWKDKQFVDELNHLLKTYVGRETPLYEAKRLTEHYQTKTCTSRIWLKREDLNH
FT                   TGAHKINNALGQALLAIRMGKERIIAETGAGQHGVATATVCARFGLKCIIYMGAEDIKR
FT                   QSLNVFRMKLLGAEVKVVTSGTATLKDATSEAIRDWVSNVETTHYILGSVAGPHPFPMI
FT                   VRDFHAVIGEEAKKQCVESFGSLPDILLACVGGGSNAMGLFHPFVKEKSVRLIGVEAAG
FT                   SGVNTDKHAATITKGSVGILHGSMSLLLQDKNGQVQEAHSISAGLDYPGVGPEHSYLKD
FT                   IGRAEYGSVTDTEALNALKLVSELEGIIPALETAHAFAWLEKLCPTLEKNTEIVINCSG
FT                   RGDKDVNTVASSLDI"
FT   gene            178119..178430
FT                   /gene="sui1"
FT                   /locus_tag="P9515_01941"
FT   CDS_pept        178119..178430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sui1"
FT                   /locus_tag="P9515_01941"
FT                   /product="Translation initiation factor SUI1"
FT                   /note="COG23 Translation initiation factor 1 (eIF-1/SUI1)
FT                   and related proteins [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71403"
FT                   /db_xref="GOA:A2BUE2"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUE2"
FT                   /protein_id="ABM71403.1"
FT                   /translation="MGKKNWIEFVNEENSYQEKPKEDSFRNISKINISKQKKGKKGKTV
FT                   TLIKGLGIRNEKEVKEFLKKIKVFCGTGGTVIGEDIQLQGDMVSKSIEFLRNEGFQNL"
FT   gene            178473..179099
FT                   /gene="cysC"
FT                   /locus_tag="P9515_01951"
FT   CDS_pept        178473..179099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="P9515_01951"
FT                   /product="Adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="COG529 Adenylylsulfate kinase and related kinases
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71404"
FT                   /db_xref="GOA:A2BUE3"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUE3"
FT                   /protein_id="ABM71404.1"
FT                   /translation="MKELNQRNSGKNIKWHNLTIDRNKLEKMRGHRGIVIWFTGLSGSG
FT                   KSTLANAVNEILHFDRLSTYVLDGDNIRHGLCKDLGFSDKDREENIRRIGEVANLFMDA
FT                   GIITITAFVSPFISDRNKVREIIGSKDFIEVYCSANIDICESRDTKGLYKKARSGEIKE
FT                   FTGISSPYEPPINPEISVDTGSLDLNDSVETVINYLREKNLLANV"
FT   gene            complement(179114..179605)
FT                   /gene="purE"
FT                   /locus_tag="P9515_01961"
FT   CDS_pept        complement(179114..179605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="P9515_01961"
FT                   /product="Phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /note="COG41 Phosphoribosylcarboxyaminoimidazole (NCAIR)
FT                   mutase [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71405"
FT                   /db_xref="GOA:A2BUE4"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUE4"
FT                   /protein_id="ABM71405.1"
FT                   /translation="MGSDSDLKTLKPSVDILHEFGIETEVCILSAHRTPIEMMEYAKKA
FT                   ESKNIKVIVAGAGGAAHLPGMLASLTCIPVIGVPVESKTLKGIDSLLSIVQMPAGIPVA
FT                   TVAINGAKNAGLLAIQILCLFDEGLRIKMKKFRDNLHAQVRTKNSKLFTLGTDNYLKTY
FT                   "
FT   gene            179742..180440
FT                   /gene="chlM"
FT                   /locus_tag="P9515_01971"
FT   CDS_pept        179742..180440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlM"
FT                   /locus_tag="P9515_01971"
FT                   /product="Mg-protoporphyrin IX methyltransferase"
FT                   /EC_number="2.1.1.1"
FT                   /EC_number="2.1.1.11"
FT                   /note="COG2227
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol
FT                   methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71406"
FT                   /db_xref="GOA:A2BUE5"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR010251"
FT                   /db_xref="InterPro:IPR010940"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUE5"
FT                   /protein_id="ABM71406.1"
FT                   /translation="MTSNKNLEKNEVKEYFNGTGFDRWRKIYSKSEEINTVQKNIRKGH
FT                   QKTVDDVISYVKNYPDLKSKTFCDAGCGVGSLAIPLLRLGIKDLQVSDISSEMIKETKS
FT                   RINELGLSQRKIKFLTSDLEKLKGLFDVVICLDVFIHYPQPVAEEMVRHLCDLSKEKLI
FT                   VSFAPYTPILALLKNIGKLFPGPSKTTRAYTLSEKGIINAANEKGFTVVQKKLNQAPFY
FT                   FSKLIEFKKL"
FT   gene            complement(180445..181173)
FT                   /locus_tag="P9515_01981"
FT   CDS_pept        complement(180445..181173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01981"
FT                   /product="two-component response regulator"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain [Signal
FT                   transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71407"
FT                   /db_xref="GOA:A2BUE6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUE6"
FT                   /protein_id="ABM71407.1"
FT                   /translation="MNDTNQINNDTIRKSKILLVDDEPGLRTAVKTFLEDEGFEISIAV
FT                   DGEDGWEKAQTIFPDLIISDIMMPRSNGYALLEKIREDEKLGGTPVIFLTAKGMTLDRT
FT                   QGYLAGIDDYIAKPFDPDELSARVKNVINRQERLLKEAARFADIDVSKMAKQITEIKSM
FT                   LTDQNPLNQENSIDIPNFTPREASVLQLVAEGLMNKEIARKLETSIRNVEKYVSRLFIK
FT                   TSTSSRTELVRYALENHLVK"
FT   gene            181232..182377
FT                   /locus_tag="P9515_01991"
FT   CDS_pept        181232..182377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_01991"
FT                   /product="NifS-like aminotransferase class-V"
FT                   /EC_number="2.8.1.7"
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_01991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71408"
FT                   /db_xref="GOA:A2BUE7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUE7"
FT                   /protein_id="ABM71408.1"
FT                   /translation="MFSSPILLDYQSSTPCLEDVVNSMSPYWREIFANTSSKSNLAGIN
FT                   ASAILEVSREKIQEYLCLKKKKVIFTSGATESNNLALLGFARNFYKETKSYGHIITLKT
FT                   EHKAVLEPLDQLRKEGFHITAITPEKDGLISKEKFMSFIRDDTFLVSIMMANNEIGVIQ
FT                   PLKEISEICKSREIILHSDYAQCLGSLELDNLDSVANMLTISSHKIYGPKGVGLLLIDR
FT                   DIELQPLFFGGGQEFGLRSGTLPLALIVGFTKAIEIAVFNQKKNAEKFLFYRDKLLHGL
FT                   LVNNSGVEINGSMKERLPHNLNLTVLDVNGSKLHKTLKSKIICSSGSACGNGEPSHVLL
FT                   ALGRSFKEAEASLRLSIGLMTTSEDIENSIQIITDTINLLR"
FT   gene            complement(182385..183287)
FT                   /locus_tag="P9515_02001"
FT   CDS_pept        complement(182385..183287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02001"
FT                   /product="Predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="COG275 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis
FT                   [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71409"
FT                   /db_xref="GOA:A2BUE8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUE8"
FT                   /protein_id="ABM71409.1"
FT                   /translation="MQTDLSNSSLFNHKSVMTDEILYSIDQYPFISDNKLTAIDATLGG
FT                   GGHSYQLLKKYPDLKIIGLDHDPIARESALNKLEEFKSRIEIIPSNFSNFEPKEKVSFV
FT                   IADLGVNSNQIDSPERGFSFQKDGPLDMRMNPLIKMNAENLIETLSEKDLADLIFKFGD
FT                   ERLSRKISRKIKKDLKEKGKYSGTKDLAYSIAGCFPPKQRYRKIHPATRTFQALRIAVN
FT                   NEIEALEKFLKIAPDWLLTGGIISIISFHSIEDRLVKNSFKGDYRLKNLTKKPITPNKK
FT                   EIENNKRSRSAKLRIAQLK"
FT   gene            183326..184513
FT                   /gene="ndhH"
FT                   /locus_tag="P9515_02011"
FT   CDS_pept        183326..184513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhH"
FT                   /locus_tag="P9515_02011"
FT                   /product="putative NADH dehydrogenase subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG649 NADH:ubiquinone oxidoreductase 49 kD subunit
FT                   7 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71410"
FT                   /db_xref="GOA:A2BUE9"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUE9"
FT                   /protein_id="ABM71410.1"
FT                   /translation="MAQLETRTEPMVVNFGPHHPSMHGVLRLVVTLDGENVIDCEPVIG
FT                   YLHRGMEKIAENRTNVMYVPYVSRMDYAAGMFYEAIVVNAPERLANISVPKRASYIRVL
FT                   MLELNRIANHLLWLGPFLADVGAQTPFFYIFREREMIYDLWEAATGQRLINNNFFRIGG
FT                   VACDLPYGWLEKCIDFCDWFAPKIDEYEKLITNNPIFKKRIEGLGTIERDQAINWSLSG
FT                   PMLRASGVSWDLRKVDNYECYDDFDWKIASEKEGDCYARYRVRVEEMRQSLKIIRQACE
FT                   MIPGGPTENLEAKRMATDDKKSDIFGIDYQYVAKKVAPTFKIPNGELYTRLESGKGEIG
FT                   VFIQGNNEVTPWRFKIRAADLNNLQILPHILKGAKIADIMAILGSIDVIMGSVDR"
FT   gene            184522..184974
FT                   /locus_tag="P9515_02021"
FT   CDS_pept        184522..184974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02021"
FT                   /product="Predicted thioesterase"
FT                   /note="COG824 Predicted thioesterase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71411"
FT                   /db_xref="GOA:A2BUF0"
FT                   /db_xref="InterPro:IPR022829"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUF0"
FT                   /protein_id="ABM71411.1"
FT                   /translation="MNPHSWLILKRKVRFGDCDSAGVIHFHNLLRWAHESWEESIDIYG
FT                   ISHQVIFPSCHSHENQNILPIVNCEANFLLPIKLGDLLTVKIFPKKISNHLFQVNTLFL
FT                   KDEIKVAEGKIIHCSLDMNSKLKVKLPDQLERWIEASNINTHLKEC"
FT   gene            complement(184982..186190)
FT                   /gene="menE"
FT                   /locus_tag="P9515_02031"
FT   CDS_pept        complement(184982..186190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="P9515_02031"
FT                   /product="probable O-succinylbenzoic acid--CoA ligase
FT                   (OSB-CoA synthetase)"
FT                   /EC_number="6.2.1.26"
FT                   /note="COG318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II [Lipid metabolism / Secondary metabolites
FT                   biosynthesis, transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71412"
FT                   /db_xref="GOA:A2BUF1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUF1"
FT                   /protein_id="ABM71412.1"
FT                   /translation="MKNKIHIIEVENNEKESTKKILKNIKEKKIIYIKNRSHEYEEIYK
FT                   AINIRGPAVILNSSGSSGKPRKCIHKLENLYSSAKASGIWLERQGFKLKHCLVFNTLPL
FT                   NHISGLMPLFRSQIWDCEHINISPALIKNPKELVVFTNKIKKDKHHLITSLVPIQLKRL
FT                   LSEKNGIDWLKIFDLIWIGGASLSIETSRKCRFEKINLAPCYGSTETAAMVTSLKPKEF
FT                   LEGLDNVGEILTDIKLRISKNGLIQIQSDRIGIELLESYQTKNFKDKNGWWESSDSGEI
FT                   QKLNNSLYLKFIRRTDNAFNSGGEIVFPEVIKLRLNEFILNKKIPIENFIISNIPNKEW
FT                   GNKMVIIINFKKQTDKTNIEYSLKLLKNFSKNWPKHERPKNWIIGKPKKDDIKNSNYMF
FT                   TKL"
FT   gene            complement(186187..187152)
FT                   /gene="menC"
FT                   /locus_tag="P9515_02041"
FT   CDS_pept        complement(186187..187152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="P9515_02041"
FT                   /product="putative O-succinylbenzoate synthase"
FT                   /EC_number="6.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71413"
FT                   /db_xref="GOA:A2BUF2"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUF2"
FT                   /protein_id="ABM71413.1"
FT                   /translation="MNLTFKKKSFLFKLSSKVENSKTTFKNKSGWIIKLKNVEKGVGFG
FT                   EVNPLSNKDLVKCQIELNKIPKYINSKNISELINTFHPCIQSAINSALAEIERKIIFKE
FT                   NYFFNAIDQTAILLNPNNALQELKKLKENKLLKGKLLTIKWKVAIYDNASEEKTLIQIL
FT                   NQLTSNIKLRIDANGSWERGIANRWVDILKDIKNIDWLEQPLSKDDIEGLREINKRMPI
FT                   ALDESLLKYPHLINEWDGWQIRRPSQEKNPMHLLEELKNKKGFRSLSTSFETGIGNRWL
FT                   FHLSSLQLLGPTPKVPGLALKKNPNSFLFLNKAQKIWDQL"
FT   gene            complement(187149..188066)
FT                   /gene="menA"
FT                   /locus_tag="P9515_02051"
FT   CDS_pept        complement(187149..188066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="P9515_02051"
FT                   /product="1,4-dihydroxy-2-naphthoate (DHNA)
FT                   octaprenyltransferase"
FT                   /note="UbiA prenyltranferase family; COG1575
FT                   1,4-dihydroxy-2-naphthoate octaprenyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71414"
FT                   /db_xref="GOA:A2BUF3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR011937"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUF3"
FT                   /protein_id="ABM71414.1"
FT                   /translation="MNERNKSLWKQAIKWPLYSVAILPVFISGAYTLNSFKNIKISNLI
FT                   AFTIAAILILIWENLTNDLFDSETGIDEFKFHSIVNLVRSKKIISTIAYTSLLIGLLVI
FT                   AIISISTSINVMILVVSCCFLGYLYQGPPFRLGYQGLGEPLCWLAFGPLTYSAALIALN
FT                   PSDIYTITIPWKDSFLLGSGSSLATTLILFCSHFHQIEEDKKHGKNSPLVRLGPKKGAK
FT                   LIPWIVFIVYFFQLFIIINGFIPILCILFLISLPQSIKLITLLKSSYNKPEVIKNCKFI
FT                   AVKFQTLNGIGLIAGLIIDYLINK"
FT   gene            188168..189565
FT                   /gene="menF"
FT                   /locus_tag="P9515_02061"
FT   CDS_pept        188168..189565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="P9515_02061"
FT                   /product="Isochorismate synthase"
FT                   /EC_number="5.4.4.2"
FT                   /note="COG1169 Isochorismate synthase [Coenzyme metabolism
FT                   / Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71415"
FT                   /db_xref="GOA:A2BUF4"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUF4"
FT                   /protein_id="ABM71415.1"
FT                   /translation="MKNNLNFSDFLKGVFSNFDKKGINSGLVSVCIEIPCVDLFDVYEF
FT                   FIDKYSFSSFWEEDNKMSYIAIDKCKYLTLEGPKKFQVAKEFNFENFNNLINLTDESNT
FT                   SALSKIIYFFSFSENLNKKYSLFDVPSLEAILPKILIIKNKNNCWLRINSSVEGKSSLR
FT                   TLIEELWSIRDQILYSKDQKSKNIFDYHKINHFMNSLELTNSNLKQLVNKGIELVEEGI
FT                   LEKIVLASRVKIELKTKLNLLEILKKLKTNQPNTCRYVWRRNSKDIMFGASPEKLFSLN
FT                   KPNLILEAIAGTSSNDLNPDSLLESPKDIKEHNYVINYLIQCLEVLRINNYKKSSLKVA
FT                   SFGDISHLQTLIYSKIDNVCPFDLLRILHPSPAVCGSPKKKAMNWINTLESFSRGNYAS
FT                   PMGWVDSEGNSEFRVAIRGARYIDQSLEFTAGSGIVKGSIASKEIEEIKLKFTSLVKQI
FT                   FIAKTTK"
FT   gene            complement(189558..190481)
FT                   /gene="gshB"
FT                   /locus_tag="P9515_02071"
FT   CDS_pept        complement(189558..190481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="P9515_02071"
FT                   /product="putative Glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="COG189 Glutathione synthase/Ribosomal protein S6
FT                   modification enzyme (glutaminyl transferase) [Coenzyme
FT                   metabolism / Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71416"
FT                   /db_xref="GOA:A2BUF5"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUF5"
FT                   /protein_id="ABM71416.1"
FT                   /translation="MKFLFVVDPIKNINPLKDSSAALMQASSKKKIKVWTCTPQDLEAR
FT                   GDEVWASSFRAEVIPWVSFKENKCIPLAEFNCIWMRKDPPVNEGYLYATHLLEVAERKG
FT                   VKVINKPSSLRAWNEKLGALRYSHLMAPTIVASKVKDLINFAQINDDVVVKPLGGKGGQ
FT                   GVIRLNKDSPGIKAMIELITSQEELPVMMQKFIPEVNKGDKRIIIVNGEPIGSINRIPQ
FT                   GGDFRSNLAMGGKAEKTNLTAKEKKICTELSQHFKDEGLFFVGIDVINEMLSEINVTSP
FT                   TGLREIENLSNKKVSDQVIEKLLEII"
FT   gene            complement(190487..190741)
FT                   /gene="grxC"
FT                   /locus_tag="P9515_02081"
FT   CDS_pept        complement(190487..190741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="P9515_02081"
FT                   /product="Glutaredoxin"
FT                   /EC_number="1.20.4.1"
FT                   /note="COG695 Glutaredoxin and related proteins
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71417"
FT                   /db_xref="GOA:A2BUF6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUF6"
FT                   /protein_id="ABM71417.1"
FT                   /translation="MSTVEIYTWRFCPFCIRAKSLLEKKNITFTEHKIDGDDDARELMT
FT                   KRANGKRTVPQIFINNKSIGGCDELYELEKEEKLDLLLN"
FT   gene            190875..191939
FT                   /gene="prfB"
FT                   /locus_tag="P9515_02091"
FT   CDS_pept        190875..191939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="P9515_02091"
FT                   /product="peptide chain release factor RF-2"
FT                   /note="COG1186 Protein chain release factor B [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71418"
FT                   /db_xref="GOA:A2BUF7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUF7"
FT                   /protein_id="ABM71418.1"
FT                   /translation="MLRIVFDVPSLVAKRKELEQIAAEPDFWINQAAAKKHMLNLDDVR
FT                   DQLQLLDKWKILIADAEASLELYSLDPEEEMIVESHLGLVTLRENLDKWEFQRLLSGEY
FT                   DKESAIVSINAGAGGTDAQDWVEILLRMYSRWADNNGMSLEITDLSNGEEAGIKSVTFE
FT                   VNGKYAYGYLQNEKGTHRLVRISPFNANGKRQTSFAGVEVMPKLDQSISLEIPDKDLEI
FT                   TTSRSGGAGGQNVNKVETAVRILHLPSGIAVRCTQERSQLQNKEKAMLLLKAKLLVIAK
FT                   EQRAAEISDIKGDIVEAAWGNQIRNYVFHPYQMVKDLRTMKETNDLDGVLNGGLDQFIH
FT                   ELLRMNISSKESVQ"
FT   gene            191944..192126
FT                   /locus_tag="P9515_02101"
FT   CDS_pept        191944..192126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71419"
FT                   /db_xref="GOA:A2BUF8"
FT                   /db_xref="InterPro:IPR021702"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUF8"
FT                   /protein_id="ABM71419.1"
FT                   /translation="MPNKNDNLEKKVSPPSFIKLAMRNMVRKGSKSISHFSITFLILMG
FT                   LLILIATLGKPHMPV"
FT   gene            192268..192675
FT                   /locus_tag="P9515_02111"
FT   CDS_pept        192268..192675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02111"
FT                   /product="Predicted metal-dependent hydrolase"
FT                   /note="COG319 Predicted metal-dependent hydrolase [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71420"
FT                   /db_xref="GOA:A2BUF9"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUF9"
FT                   /protein_id="ABM71420.1"
FT                   /translation="MCWINIILSEKNTSFPNFIFDKKIFSLSLQIINNNEISSINQKWM
FT                   DKSGPTDVLSFPMISDEDTTKNLNFIELGDLFISLEMAFQQSLEFDHSIKKEMLWLASH
FT                   GFLHLLGWEHNDDNELDNMLNFQEYLISKLD"
FT   gene            192700..193110
FT                   /gene="dgkA"
FT                   /locus_tag="P9515_02121"
FT   CDS_pept        192700..193110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="P9515_02121"
FT                   /product="Prokaryotic diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /note="COG818 Diacylglycerol kinase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71421"
FT                   /db_xref="GOA:A2BUG0"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUG0"
FT                   /protein_id="ABM71421.1"
FT                   /translation="MKSKAKLSKNIRESYRISRNVFISFRYAFNGIKYTFRNSRNFQIQ
FT                   VIFALFSALLGSILQINKTDYLILLLTVFSVLALEILNTSIESLVDLVVKKKFSNLAKI
FT                   AKDCSAGAVLLASINSVIIGLSLFIPKIKLLF"
FT   gene            193123..193719
FT                   /gene="pabA"
FT                   /locus_tag="P9515_02131"
FT   CDS_pept        193123..193719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="P9515_02131"
FT                   /product="para-aminobenzoate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /EC_number="2.6.1.85"
FT                   /note="COG512 Anthranilate/para-aminobenzoate synthases
FT                   component II [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71422"
FT                   /db_xref="GOA:A2BUG1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUG1"
FT                   /protein_id="ABM71422.1"
FT                   /translation="MFLVIDNYDSFTYNLVQYLGELSVDHNITKELLVKRNDEITLEEI
FT                   SQINPDGILLSPGPGNPDQSGICLPILQNLSKEIPTLGVCLGHQALAQAYGGKVIVGKE
FT                   LMHGKTSKIIHNKKGLFKDIASPFVATRYHSLIVDSDSLPSCFEITATLEDSTIMAISH
FT                   KKYKNLHGVQFHPESVLTQFGHKLISNFLKMAEQK"
FT   gene            193742..194470
FT                   /locus_tag="P9515_02141"
FT   CDS_pept        193742..194470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02141"
FT                   /product="Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold"
FT                   /note="COG2220 Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71423"
FT                   /db_xref="GOA:A2BUG2"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUG2"
FT                   /protein_id="ABM71423.1"
FT                   /translation="MNIIKLKKFFLFILFLFLIPPSALAGDLLLKSFGHGSFLIKGREK
FT                   SILLNPFKAIGCARDLNEPKGVNADFILASSKLADEGYNPKDQLMFSKPGVYQFENILL
FT                   NGIEVPHDRVGGRRLGMATVWTWEQNNLKIVHMGGAAGEMSINSQIILSRPDILFISIG
FT                   GGFKSYNGREAADIVKTLKPSIVIPVHFIRDKKNIDDCDFSNSDLFLENMQDFKVKYLG
FT                   KNFEINSKRIDKNTIYIFKD"
FT   gene            complement(194467..195576)
FT                   /locus_tag="P9515_02151"
FT   CDS_pept        complement(194467..195576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02151"
FT                   /product="Aminotransferases class-I"
FT                   /EC_number="2.6.1.9"
FT                   /note="COG79 Histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71424"
FT                   /db_xref="GOA:A2BUG3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUG3"
FT                   /protein_id="ABM71424.1"
FT                   /translation="MSEFNKINNLPPTPRKEIINMQSYSAPLENRRNLLRLDFNENTLG
FT                   PSQKVYEAIKDIKLNQISIYPEYNLLKNFLSHNYYESRQFDSEEIGLFNGADAVINAIF
FT                   HSFGDRDEIFLTTNPTFGYYSPCSEIQGMKKITCSYEGEHFLFPIKRFEEKIIKHKPKL
FT                   IFICNPNNPTGTVLSAQEIIKLANLNKSSLIVVDELYEKFNGDSLLPKIDFQEIKNIVI
FT                   IQSLSKTAGLAGLRIGFAFGNKSIIQYINKVTGPYDVNSFAVTAALAALNDKSYIDNYV
FT                   TEVNKARLFIEKKFESLSIRTHFGAGNYFLIWPNQNPEILTRKMRERGILIREMKNKKD
FT                   IENSVRVSIGTQEQMLRFWSTYKELDLNN"
FT   gene            complement(195576..197384)
FT                   /gene="argS"
FT                   /locus_tag="P9515_02161"
FT   CDS_pept        complement(195576..197384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="P9515_02161"
FT                   /product="Arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COG18 Arginyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71425"
FT                   /db_xref="GOA:A2BUG4"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUG4"
FT                   /protein_id="ABM71425.1"
FT                   /translation="MQVIYQELTKRFEETLLESLIKNEKKEEFENIRKNLINQASKEEF
FT                   GDYQCNICLVLSKIYKRNPREIAIEFVQKLKENKEISNLCEALEIAGPGFINIKLKNNL
FT                   LIAKIKSNIKCPRAGVPLSNNNSHSQKKVIVDFSSPNIAKEMHVGHLRSTIIGDSIAKI
FT                   FELRGYTVLRLNHVGDWGTQFGMLITQLKDLYSSDLREIDKITISDLVEFYKASKKRFD
FT                   NETEFKKRSREEVVKLQSGDKKSIKAWKLLCNQSRKEFDEIYKILNIKIKERGESFYNP
FT                   FLKSIIEDLTFKKILVEDQGAKCVFLHGMTNKEGNPLPLIIKKKDGGFNYATTDLAALR
FT                   YRFRKEPHGDNATRIIYVTDHGQSNHFAGVFQVAKRANWIPEDCEVNHVPFGLVQGIDG
FT                   KKLKTREGDIIKLKDLLSESIKRAKEDLLKRLEKESRFETEEFILNTSKVIGIGAVKYA
FT                   DLSQNRITNYQFSFEKMLSLNGNTAPYLLYTLVRISGINRKNNMNEDAVNSESIAYSHD
FT                   LEWKLIRKLLKFDEVIVSIEKDLMPNRLCNYLFELCQSFNRFYDQVSILKVEMNTKISR
FT                   LTLCALTEKTLKLSLELLGIDSLERM"
FT   gene            complement(197412..198278)
FT                   /gene="nadC"
FT                   /locus_tag="P9515_02171"
FT   CDS_pept        complement(197412..198278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="P9515_02171"
FT                   /product="Nicotinate-nucleotide
FT                   pyrophosphorylase:Quinolinate phosphoriobsyl transferase"
FT                   /EC_number="2.4.2.19"
FT                   /note="COG157 Nicotinate-nucleotide pyrophosphorylase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71426"
FT                   /db_xref="GOA:A2BUG5"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUG5"
FT                   /protein_id="ABM71426.1"
FT                   /translation="MDFYSPNISRIIDYWIEEDIGKGDLTSSAITENIGKAHWLAKEKG
FT                   IFCGVEIIKTILNKIDENIDCRFFIKDGETFLKDQKLLELCGPSRSLLASERISLNISM
FT                   HLSGISTYTKNIVDVLKGTNIKLADTRKTTPGLRIFEKYAFKCGGGINHRMGLYDAAMI
FT                   KENHIAWTDNLNNAVKKIRLNTPFTTHIIIEAENMKQAKDAVLAGADSILLDEFNPELL
FT                   EKCIKELRELSINSSKRTKRNNLIIEVSGINPRDISNYLIDGVDFISTSSSITKSNWID
FT                   FSMRYIN"
FT   gene            complement(198356..199741)
FT                   /gene="thdF"
FT                   /locus_tag="P9515_02181"
FT   CDS_pept        complement(198356..199741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thdF"
FT                   /locus_tag="P9515_02181"
FT                   /product="putative thiophen / furan oxidation protein"
FT                   /note="COG486 Predicted GTPase [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71427"
FT                   /db_xref="GOA:A2BUG6"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUG6"
FT                   /protein_id="ABM71427.1"
FT                   /translation="MESIVDTEDTIAAIASAISLGKGGIAVIRVTGEEAINSCKNIVET
FT                   KSKYAWESHRVFHGYVKDNLENKYIDEILISVMHSPNSFTGEDVVELHCHGGVIVVNKV
FT                   MDTLLSNNNKVRIANPGEFSQRAFLNGKIDLTQAESINQLINAKNLKSAEIAFNGVKGE
FT                   IKKKIDVIKNDLIEQLSEIEARVDFEEDFSDFNYHDFSRSIKNIKEKIEILIENTKRGA
FT                   SIHNGISIALIGKTNVGKSSLLNLLSKKEKAIVTNIPGTTRDMIEVNLTIKDIPIKLVD
FT                   TAGIRDTDEYIENIGIEKTFEMIQKSDYIIYLYSLEDGFNKDDEEIISKIPREKLITIL
FT                   GNKKDLIDSKKNDQKTFSSDIVLMSIKNNEGEKDLVDKIVKKCGSKEFENIDIFLNERQ
FT                   ISNLRDCLKNLNDTDPIIANQLPFDLLSIEVRDGIKNLSRITGQELTEDLLNNIFSKFC
FT                   IGK"
FT   gene            199808..200260
FT                   /locus_tag="P9515_02191"
FT   CDS_pept        199808..200260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02191"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3216 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71428"
FT                   /db_xref="GOA:A2BUG7"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUG7"
FT                   /protein_id="ABM71428.1"
FT                   /translation="MKLIKNLNFKKILSLFLKQEGTPFFNAKGVAVGVFCGCFPFFGFQ
FT                   TLLGLFLARVAKGNLFLAAIGTWISNPFTYVPLYFFNYKVGSFLLRNPTDIVLDKNLLI
FT                   EELWEQGRVFSLKLILGSALVGLLLASISGMIIFLLYKLKIKKRVL"
FT   gene            complement(200279..202588)
FT                   /gene="spoT"
FT                   /locus_tag="P9515_02201"
FT   CDS_pept        complement(200279..202588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="P9515_02201"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-diphosphatase, (ppGpp)ase"
FT                   /EC_number="2.7.6.5"
FT                   /EC_number="3.1.7.2"
FT                   /note="COG317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases [Signal transduction
FT                   mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71429"
FT                   /db_xref="GOA:A2BUG8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUG8"
FT                   /protein_id="ABM71429.1"
FT                   /translation="MSEATADSKERKEIEVSTIIVPENKNYESESLKYEIKIPNWLLEN
FT                   IQNYELSNNKNDSNQDLIVKAFKLAYQAHNGQLRASGEPYIIHPIAVADLLKEIGASSS
FT                   VIAAGLLHDVVEDTGIALSEIEINFGLEVKVLVEGVTKLGGIHFNNRTEAQAENLRKMF
FT                   LAMASDIRVVLVKLADRLHNMRTIQWLNEERKERIARETREIYAPLANRLGINRFKWEL
FT                   EDLAFKFLEPDEYKNLKDQIVVKRSDREKRLDNTLNLMKENLVSSGLKNFEITGRPKHL
FT                   YGIWSKMERQQKQFSEIYDVAALRIIVSNLDSCYKALAVVHDTFRPIPGRFKDYIGLPK
FT                   PNGYQSLHTSVIGKHRPIEVQIRTTSMHQIAEFGIAAHWQYKEGGSPASSNAERFNWLR
FT                   QLVEWQQEGNEKDHNDYLASIKEDLFDEEVFVITPKGDVVGLRKGSTAIDFAYRIHSEI
FT                   GNHCNGIRINEKLSPLSTSLQNGDFIEILTNNNSTPSLDWLNFVVTPTAKNRIRQWYKK
FT                   SHRDETIKRGKDLLEKEIGRNGFESLLSSDAMQKVAHRCNLKTTEDLLASLGFGGLTLH
FT                   QVLNRLREEIKIQTEEIKNESNAEIAKTLVNKNNSITTKSHATNKSPISGVEGLDYRIG
FT                   KCCSPLPGEEIIGTVSLGNHGITIHRRDCENVLPIPIERRLPVAWNQENKVLDNKFPIQ
FT                   LRIEVIDRVGVLKDILMRLSDKGINVSDANVKTAFGKPAIINLCVGLESYSQLHKTIDQ
FT                   IKSMADVLDIARVGIS"
FT   gene            202644..204239
FT                   /locus_tag="P9515_02211"
FT   CDS_pept        202644..204239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02211"
FT                   /product="ABC transporter, ATP binding component"
FT                   /note="possibly for oligopeptides; COG1123 ATPase
FT                   components of various ABC-type transport systems, contain
FT                   duplicated ATPase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71430"
FT                   /db_xref="GOA:A2BUG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUG9"
FT                   /protein_id="ABM71430.1"
FT                   /translation="MKINKNKILEVRNLNVKYTPNQKSTIKNFTLDLCEGDHLAIIGPS
FT                   GCGKSTIAKTIINMLPEEALIKGQITISGEDIKKIDKKEIELFRRKNFGFIYQDSLNKL
FT                   NPLMTVGDHVYELFQVHFPNKPFESIKDLVEETFRRVGIERDRLDSFPHEFSGGMRQRV
FT                   SIAMALALKPKILIADEPTTSLDTKTSFEVMNEILYLSKQSQTTLILISHDINLAAKWC
FT                   KKVAIMEQGCIHEQGDIQEVFKSPISKIGKKLIKATNISLQPIKKISYKNHIILEANNL
FT                   RHWYKLNSSIFRPKWNKALKEVSFKLYRNETLGIVGSSGSGKSTLCRALIGLLKVRGGE
FT                   IKVYDNGLKFGKKKSKNYKNIQIIFQDPFSSLNPKMKIKNILKDIFLIQKIYNNDQIKN
FT                   EIQLILENLNLPSDSLFLNSYPCQLSGGQLQRISIARSLLLKPKILICDESVNMLDAYI
FT                   KIEILELLRKIQEKMDFSIIFITHDLGIAKNFCNRLLVMDYGKIIEEGDSSTIFSNPKN
FT                   NITKALVESCLNLN"
FT   gene            complement(204232..205194)
FT                   /gene="rluD"
FT                   /locus_tag="P9515_02221"
FT   CDS_pept        complement(204232..205194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="P9515_02221"
FT                   /product="putative pseudouridylate synthase specific to
FT                   ribosomal large subunit"
FT                   /EC_number="4.2.1.70"
FT                   /note="COG564 Pseudouridylate synthases, 23S RNA-specific
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71431"
FT                   /db_xref="GOA:A2BUH0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUH0"
FT                   /protein_id="ABM71431.1"
FT                   /translation="MKSSNANSFGVGEGELTEIIYELPLPMRLDRWLVSKRPEQSRARI
FT                   QNLINAGLVLINYKTAKAKTPLKTGDNIQIWMPPPEPLVYLKPEKMHLNILYEDEHIIV
FT                   INKQSGLIVHPAPGHKSGTLVNGLLFHCKDLPGINGKLRPGIVHRLDKDTSGCMVVAKS
FT                   QESLVNLQIQIRDKIASRNYIAVIHGVPNTSEGKIVGHIGRDKINRLKYAVVDENSGRY
FT                   ACTYWKLLERFGNYSLMSFKLDTGRTHQIRVHCAYINHPILGDPLYGRCKKLPCKLDGQ
FT                   ALHAIELGLFHPINGEEMKFEADLPQEFVKLLRILKKFN"
FT   gene            complement(205191..206057)
FT                   /locus_tag="P9515_02231"
FT   CDS_pept        complement(205191..206057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02231"
FT                   /product="Predicted GTPase"
FT                   /note="COG1161 Predicted GTPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71432"
FT                   /db_xref="GOA:A2BUH1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUH1"
FT                   /protein_id="ABM71432.1"
FT                   /translation="MEIPTIQWYPGHIAKAEKKLSAVISRVDLIIEVRDARIPLSTGHP
FT                   HLNQWITNKKHILVINRADMIAPETIINWNTWFKKYDIYPLWCDAKNGKGIKEICKSAK
FT                   ESRLSIDKRRLSRGMKVRPIRALTLGFPNVGKSALINRIAKKKVVESARKAGVTRNLRW
FT                   IRLDGGIDLLDAPGVIPPNLENQKSALNLALCDDIGEAAYEIESVAIEFLKIIFKLKED
FT                   KNANISLKKISNRYGVDILKSFDSPHEWIDLVALKHTSGDRRRMAYKLLEDYRNQMLGK
FT                   IALEVPR"
FT   gene            206285..207493
FT                   /gene="pgk"
FT                   /locus_tag="P9515_02241"
FT   CDS_pept        206285..207493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="P9515_02241"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="COG126 3-phosphoglycerate kinase [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71433"
FT                   /db_xref="GOA:A2BUH2"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUH2"
FT                   /protein_id="ABM71433.1"
FT                   /translation="MSKLSLSSLDKSKLEGKKVLVRVDFNVPLNDDGQITDDTRIRAAI
FT                   PTIKYLINNSAKVILAAHFGRPKGKVNERMRLTPIAARLSEILGKKVNLTESCIGEEAL
FT                   EKSNNLNNGDVLLLENVRFYEEEEKNDLNFAKNLAAHADMYVNDAFGAAHRAHASTQGV
FT                   TKFLEPSVAGFLLEKELKYLQGAIDAPNRPLAAIVGGSKVSSKIGVLDSLLDKCDKIII
FT                   GGGMIFTFYKARGLDVGKSLVEEDKLELARNLEEKAKTKGVELLLPSDVVLANEFSPTA
FT                   ESKVSQIDSISGDWMGLDIGPQSIKVFQNALAECKTIIWNGPMGVFEFDKFAEGTNSIA
FT                   TTLADLSSFSEVCTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKNLPGVAAL
FT                   NEN"
FT   gene            complement(207495..208226)
FT                   /locus_tag="P9515_02251"
FT   CDS_pept        complement(207495..208226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71434"
FT                   /db_xref="GOA:A2BUH3"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUH3"
FT                   /protein_id="ABM71434.1"
FT                   /translation="MKMLNLNLFTKLGLFIYLFIYPIFPKIAITQNTNVNMPKNLEYGL
FT                   NTRNLKLIKDAFKEEENLKIQEKFTEIIQDFPNSKWQIKKISRETSKENLFDIKVNGKK
FT                   IVNDETFFLESNFKYSFSTYNNKINNGNIKNLLTTIRNDNNKIDIIFKIPEKVLTGTKY
FT                   DIDIILNEPLGDVIIAGGIISHQDGSYLKQDINIEPLASGGIFKTTRASSKPTTQVWSG
FT                   IIAHPKGIISFTKSVEIVEKI"
FT   gene            208262..209356
FT                   /gene="murG"
FT                   /locus_tag="P9515_02261"
FT   CDS_pept        208262..209356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="P9515_02261"
FT                   /product="Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc
FT                   GlcNAc transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="COG707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase [Cell envelope biogenesis,
FT                   outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71435"
FT                   /db_xref="GOA:A2BUH4"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUH4"
FT                   /protein_id="ABM71435.1"
FT                   /translation="MSKERNNLLIAASGTGGHIFPALAVSKEVEKYWNMHWLGVEKRLD
FT                   SKFVPRKYNLLTLNLETPQKSIFILFQYLKILYSTFNIIKILKEKKINLVFTTGGFISA
FT                   PTILAAKLLNIPVIIHESNLIPGTVTKYFGFLCEFVLIGFKDTNAYLKNCKTIFTGTPL
FT                   RPEFYKTNPLPEWVPRGKGPLLIVMGGSQGAKRINEIFYESLDLLIKQNFRIVHIVGEH
FT                   NINIPRKIKSNNYVQKKFTNQIASLMQNCDLVISRSGAGTINELIQTKKPSILVPYPNS
FT                   KNNHQEKNAIILSSIGGAILINQDKISKVFFQETLKRIFKVKKNKGKPTYEILDLMKEN
FT                   MKNLTSLKSTNKIKNLINYFLKEF"
FT   gene            complement(209335..210420)
FT                   /locus_tag="P9515_02271"
FT   CDS_pept        complement(209335..210420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02271"
FT                   /product="Aminotransferases class-I"
FT                   /EC_number="2.6.1.9"
FT                   /EC_number="4.1.1.81"
FT                   /note="COG79 Histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71436"
FT                   /db_xref="GOA:A2BUH5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUH5"
FT                   /protein_id="ABM71436.1"
FT                   /translation="MNDVNFKHGGNILTQAKNLNLLPSKIIDSSASLVAFKPPKILLDS
FT                   LRLEIKKLGFQYYPERNLNDLREIIGEFHQINPDNILPGNGASELITWAGHEASKFGVS
FT                   SIPSPGFVDYERSLNCWDAKYNYSELPRNWSNSFPQPFPLKPICDVLWITNPHNPTGQL
FT                   WDKKSLEIILKKYKLVICDEAFLAITPNGEKQSLIPLTKIYDNLLVIRSLTKLFNIAGL
FT                   RLGYVVGSSEKLNKWNIKRDPWPLNCFAIKAGIELLSNKIFYKEWTKKIHDWVRTEKDW
FT                   VSHELSKIKNLKVHNSSTNFFLVESKFSLNSNIKYLENKGILIRECTSFRCLNEKWARI
FT                   SLQNRKNNKILCREIQNSFKK"
FT   gene            complement(210471..211640)
FT                   /gene="pyrD"
FT                   /locus_tag="P9515_02281"
FT   CDS_pept        complement(210471..211640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="P9515_02281"
FT                   /product="Dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="COG167 Dihydroorotate dehydrogenase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71437"
FT                   /db_xref="GOA:A2BUH6"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUH6"
FT                   /protein_id="ABM71437.1"
FT                   /translation="MFEQKGMFINIYKNLVTPILKKDTGIDAEYLTNFSLSLLAFTSNN
FT                   RNWPLIKGIIKRLNDEFCVVDKRLHQNICGIDFCNPVGLAAGFDKNGNAANIWENFGFG
FT                   FAEIGTVTKFAQSGNPKPRLFRLAKEEAALNRMGFNNNGAENLFKNFLKQGIPLKKNRK
FT                   NNCLGINFGKSKITSLSKATEDYLTSLKLLIPYCDYAAINVSSPNTEGLRKLQDPILLQ
FT                   ELLREVKKLDNCPPLFVKIAPDLSYKDIEDICQLIIDENINGIIATNTSLDRLGLEQRK
FT                   IKQTGLLLSEENGGLSGRPLQLKANQIIRHINNIDQSIKLIGVGGIDSPESAWERICAG
FT                   ASLVQIYTGWIYKGPQLVPNILNGIIKQLNKHQLSNIKEAIGSNLKWIE"
FT   gene            complement(211655..212374)
FT                   /gene="rnhA"
FT                   /locus_tag="P9515_02291"
FT   CDS_pept        complement(211655..212374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="P9515_02291"
FT                   /product="possible ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="COG328 Ribonuclease HI [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71438"
FT                   /db_xref="GOA:A2BUH7"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUH7"
FT                   /protein_id="ABM71438.1"
FT                   /translation="MNSKTNIAIEAATDGACSGNPGPGGWGGLIIFIDNSEIEIGGSEQ
FT                   NTTNNRMELTAAIKTLEKLKNYQLKENFKLRTDSKYVIEGYTKWISNWKKNGWKTSAGK
FT                   SVQNLDLWQKIDELRIQGLEMEFVKGHSGDKQNERVDLIATSYSKGIPLDSEVKKLSSE
FT                   IDSKETGSSKIQNLFLKNELLEKFAEKKYFLNSSELNELLGEESYPLIKKYELFEWRNW
FT                   RLIPKNQKYWIIENKHA"
FT   gene            complement(212422..212817)
FT                   /gene="rplL"
FT                   /locus_tag="P9515_02301"
FT   CDS_pept        complement(212422..212817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="P9515_02301"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="COG222 Ribosomal protein L7/L12 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71439"
FT                   /db_xref="GOA:A2BUH8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUH8"
FT                   /protein_id="ABM71439.1"
FT                   /translation="MTAKTEEILESLKSLSLLEASELVKQIEEAFGVSAAASAGVVMAA
FT                   PGAAGGDGDGGAAEEKTEFDVILESFDAAAKIKVLKVVRNATGLGLGDAKALVESAPKT
FT                   VKEGIAKADAETLKKEIEEAGGKVTLK"
FT   gene            complement(212846..213373)
FT                   /gene="rplJ"
FT                   /locus_tag="P9515_02311"
FT   CDS_pept        complement(212846..213373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="P9515_02311"
FT                   /product="50S ribosomal protein L10"
FT                   /note="COG244 Ribosomal protein L10 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71440"
FT                   /db_xref="GOA:A2BUH9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUH9"
FT                   /protein_id="ABM71440.1"
FT                   /translation="MGRTIENKQKIVTELKSLLDDSEMAVVLDYKGLTIKEMSDLRSRL
FT                   QTNKGICKVTKNSLMRKAIDGNSNWTDLESLLTGTNAFVLIKEDVGGAVKAIQSFQKET
FT                   KKSETKGALFEGRLLSQSEIKEIASLPSREVLMAKIAGALNGVATKIAISINEVPSGLA
FT                   RSLKQHSEKSES"
FT   gene            complement(213565..214272)
FT                   /gene="rplA"
FT                   /locus_tag="P9515_02321"
FT   CDS_pept        complement(213565..214272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="P9515_02321"
FT                   /product="50S ribosomal protein L1"
FT                   /note="COG81 Ribosomal protein L1 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71441"
FT                   /db_xref="GOA:A2BUI0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUI0"
FT                   /protein_id="ABM71441.1"
FT                   /translation="MKKLSKRMTALSTKIEDRTYAPLEALAIIKENANAKFDETIEAHI
FT                   RLGIDPKYTDQQLRTTVALPHGTGQSIKIAVITSGENVAKAKSAGADLFGEEDLVESIN
FT                   KGNMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTSDIASAIKEFKAGKLEFR
FT                   ADKAGIVHVRFGKASFTENALFENLKTLQESIDKNKPSGAKGKYWKTFYVTSTMGPSVQ
FT                   VDINALQDYQPES"
FT   gene            complement(214339..214764)
FT                   /gene="rplK"
FT                   /locus_tag="P9515_02331"
FT   CDS_pept        complement(214339..214764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="P9515_02331"
FT                   /product="50S ribosomal protein L11"
FT                   /note="COG80 Ribosomal protein L11 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71442"
FT                   /db_xref="GOA:A2BUI1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUI1"
FT                   /protein_id="ABM71442.1"
FT                   /translation="MAKKIVAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNAR
FT                   TQDKAGFVIPVEISVFEDRSFTFITKTPPASVLITKAAGIEKGSGESSKGSVGNISKSQ
FT                   LEEIAKTKLPDLNCTSIESAMKVIEGTARNMGISITE"
FT   gene            complement(214828..215439)
FT                   /gene="nusG"
FT                   /locus_tag="P9515_02341"
FT   CDS_pept        complement(214828..215439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="P9515_02341"
FT                   /product="transcription antitermination protein, NusG"
FT                   /note="COG250 Transcription antiterminator [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71443"
FT                   /db_xref="GOA:A2BUI2"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUI2"
FT                   /protein_id="ABM71443.1"
FT                   /translation="MSNELTANLGSQKANTSIARWYAVQVASSCEKKVKATLEQRSVTL
FT                   GVNNRIIEIEIPQTPGIKLKKDGSRQTTEEKVFPGYVLVRMILDEDTMMAVKSTPNVIN
FT                   FVGAEDGRGSGRSRGHIKPRPLSRQEVNRIFKRASEKKAVIKLDLEEKDRIIVTSGPFK
FT                   DFQGEVIEVSGERNKLKALLSIFGRETPVELEFSQINKQN"
FT   gene            complement(215517..215774)
FT                   /gene="secE"
FT                   /locus_tag="P9515_02351"
FT   CDS_pept        complement(215517..215774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="P9515_02351"
FT                   /product="putative preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71444"
FT                   /db_xref="GOA:A2BUI3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUI3"
FT                   /protein_id="ABM71444.1"
FT                   /translation="MSSPTNQKPLKKEPSEIKEPSEIKEPKKKKNFLTSTVDELKLVVW
FT                   PNKQQLFSESVAVIIMVSFSAAAIASVSRFYGWAASQIFR"
FT   gene            complement(215837..218584)
FT                   /gene="clpB2"
FT                   /locus_tag="P9515_02361"
FT   CDS_pept        complement(215837..218584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB2"
FT                   /locus_tag="P9515_02361"
FT                   /product="putative ATP-dependent Clp protease, Hsp 100,
FT                   ATP-binding subunit ClpB"
FT                   /EC_number="3.4.21.92"
FT                   /note="COG542 ATPases with chaperone activity, ATP-binding
FT                   subunit [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71445"
FT                   /db_xref="GOA:A2BUI4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUI4"
FT                   /protein_id="ABM71445.1"
FT                   /translation="MRETLTSNPELFSDISWNLLLLGEETAKKWDHSEFNIEHIIHTLF
FT                   TSSDFFAFIEKLSIDQDTVLDITEDFLEETPTNDSDIFTIGEDLEILLDNANQIKTQWG
FT                   SNLIEIPHLLIALGRDARIGNYVFQEGDLSVEQLEEELKIFPNINPRQNYLENKKNITN
FT                   KENKSINKTDKKALIEKTKPIITTPKNNLKIETQHNSSQNALSLYGKDLTDSAKKGLLD
FT                   PVVGRENEINNLMRVLSRRSKNNPILIGYPGVGKTSIAKLLAQLIVERKVPDSLKNLKI
FT                   ISLDLGALVSGTKFRGQLEERLSLILNEIKDSNQGIILFIDEIHTIISSDRSTADISNI
FT                   LKPLLTEGELRCIGTTTPEKFRENIERDQALNNCFQKILVNEPSVELTAQILKGIKKKY
FT                   ELHHGIRITEEAINSSARLADRYISDKFLPDKAIDLIDEAAAQLKIEFNIKPQIILDEE
FT                   SKIYNIENKLKDLSPENIEDREKLLERKELATDKLNAIINNWNNDQEKMEQLTFLLHEE
FT                   DRLILEIEELNMNSEEINYFERLNNLEEELNEVEFEINNIESRFKNPQRDKKFNFKYQV
FT                   EPDDIADVISKITGIPMAKVVSNERKKLVNLELEISEKVIGQKKAIEAVSSAIRRARVG
FT                   MKNPKRPVGSFLFMGPTGVGKTELAKSLASSLFDEEEALLRLDMSEYMEKNAVARLLGA
FT                   PPGYVGYEEGGQLTEAVRRKPYSVILLDEIEKAHSEVFNVLLQVLDEGRLTDSQGRTVD
FT                   FKNTVIIMTSNLAGKIILEDAKKIPNNKENSELREHALQESINKSLSSIFRPEFLNRID
FT                   EVVKFDLLSIDQLQKIILLQINELKKLLLEQGININIDKKVILKIANDSYQPEYGARPL
FT                   SRELRRQIENPLASRLLEENFKNKKNISVKINPSKKDEILFKPS"
FT   gene            218871..220163
FT                   /gene="eno"
FT                   /locus_tag="P9515_02371"
FT   CDS_pept        218871..220163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="P9515_02371"
FT                   /product="Enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="COG148 Enolase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71446"
FT                   /db_xref="GOA:A2BUI5"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUI5"
FT                   /protein_id="ABM71446.1"
FT                   /translation="MKETIDFLIDTIEARQVLDSRGNPTVEAEVFLECGAIGRAIVPSG
FT                   ASTGAHEAHELRDGGTKYMGKGVLDAVNKIHETISPALCGLSALDQTIIDKLMIEIDGT
FT                   PNKSNLGANSILAVSLANARAASKALDMPLYRYLGDPLSNLLPVPLMNVINGGAHAPNG
FT                   LDCQEFMLVPHGVKTFSEALRMGTEIFHSLKSLLDKKGLSTAVGDEGGFAPELSSCEAA
FT                   GDLLLEAIQKAGFIPGKQVSLALDVASTEFYRDGFYKYEGTNLTSSQMISYLSNLVSNY
FT                   PIVSIEDGLGEDDWEGWAALNKEIGHKVQLVGDDLFVTNTERLRKGILEKSANSILIKV
FT                   NQIGTLTETLEAMDLAKSAGFTSVISHRSGETEDTTIADLSVATRAGQIKTGSLSRSER
FT                   IAKYNRLLRIEEELGNQARFAGDLGLGPKNI"
FT   gene            complement(220177..221844)
FT                   /locus_tag="P9515_02381"
FT   CDS_pept        complement(220177..221844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02381"
FT                   /product="possible kinase"
FT                   /note="COG661 Predicted unusual protein kinase [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71447"
FT                   /db_xref="GOA:A2BUI6"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUI6"
FT                   /protein_id="ABM71447.1"
FT                   /translation="MSNHKLKNRIQKIKRSFLIWKTLILLLVNLWIDNLKTKIFQTNKD
FT                   KNKKVQIKRARWFTNQLIDLGSAFIKIGQLLSARPDLIPNTWIQELSKLQDQVPQFSYT
FT                   KVEEIIKTELGQKFSEINKINDLPIGSASLAQVHRATLRNGKEVVFKVQRPNLKQLFII
FT                   DLNIMQQIAFVLQKNRNWSRGRNWVDIAKECRKVLMKELDFKCEAQYAARFRQQFLDDD
FT                   NVEVPEVIWDLSSDKVLCLSYLEGIKISDIEKLKSKNIDLPKIAEIGAISYLKQLVNYG
FT                   FFHADPHPGNLAVSNSGKLIFYDFGMMGNISNNLQVRLGSMVQSAALRDASSLVTQLQQ
FT                   AGLISKDIDVGPVRRLVRLMLKEALTPPFSPKIIEKLSGDLYELVYETPFQLPVDLIFV
FT                   MRALSTFEGVGRMLDPGFNLVSITKPYLIDLMTSNNQSPNDLINQFGRQVGELGSKAVG
FT                   IPKRIDESLERLEQGDLQLQIRMGESDRQFKKMFTAQKSLGHSILMGSLTIASALLVTK
FT                   NQNNLAILPLLFAAPISIDWIKCQLNMRKGSRIDKLKK"
FT   gene            complement(221844..222161)
FT                   /locus_tag="P9515_02391"
FT   CDS_pept        complement(221844..222161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02391"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71448"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUI7"
FT                   /protein_id="ABM71448.1"
FT                   /translation="MTNSDYLLKAAIKKVSEKLNEIVVEKFEEATSIAQEAPEIIKKEL
FT                   DTLKGAIIEEAARMENEMGQKRNTNNSESYKDPNLNEVLKEIQEIQEKIEKFNMKMNNT
FT                   I"
FT   gene            222415..223371
FT                   /locus_tag="P9515_02401"
FT   CDS_pept        222415..223371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02401"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="COG492 Thioredoxin reductase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71449"
FT                   /db_xref="GOA:A2BUI8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUI8"
FT                   /protein_id="ABM71449.1"
FT                   /translation="MEIIETDVAIVGGGPAGCTCALYTSRSNLKTVIIDKNPSVGALAI
FT                   THQIANYPGVPVDISGEKLLTLMREQAVQYGTDYRRAQVFGIDVGKDWKTVYTPEGTFK
FT                   AKALVLASGAMGRPASFKGEADFLGKGVSYCATCDGAFYKNREVAVVGANKEAIEEATV
FT                   LTKFASTVHWITSSDPKQDNEEAKELMDISNIKHWSRTRLLEILGNDMGVNRVIVKNKQ
FT                   EEGPINIDLDGVFVYMSGSKPITDFLGDQIALKEDGGVIVDDFMSTNSDGVWAIGDIRN
FT                   TPFKQAVVAASDGCIAAMSIDRYLNSRKNIRVDWIHS"
FT   gene            complement(223392..223673)
FT                   /locus_tag="P9515_02411"
FT   CDS_pept        complement(223392..223673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71450"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUI9"
FT                   /protein_id="ABM71450.1"
FT                   /translation="MKRLDLIFSERELDAIIDTLEKANVPGYTIMKHATGRGPERFVTE
FT                   DMEFTGLGSNAHVIVFCEQELIDQMRDNIKSDLSYYGGVAYISEATPL"
FT   gene            complement(223677..224675)
FT                   /locus_tag="P9515_02421"
FT   CDS_pept        complement(223677..224675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02421"
FT                   /product="putative sodium-dependent bicarbonate
FT                   transporter"
FT                   /note="COG3329 Predicted permease [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71451"
FT                   /db_xref="GOA:A2BUJ0"
FT                   /db_xref="InterPro:IPR010293"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUJ0"
FT                   /protein_id="ABM71451.1"
FT                   /translation="MEVNPIIQNVLAPPVLFFLIGAISIFFKSDLEIPAPLPKLFSLYL
FT                   LLAIGFKGGIEIQKSGFTDQVLPTLGAAILMSLIIPIIGFFILRYKFDVFNSAAIAAAY
FT                   GSISAVTFISAESFLESQSIDFDGFMVGALALMESPAIIVGLLIVKFAGPQDRPNARKM
FT                   HLSSILHESFLNGSVYLLLSSLVVGFLTAFSNPAAITKMEPFTGQLFYGAECFFLLDMG
FT                   IVAAQRLPRLKNAGSFLIGFAIFMPLFNSLIGVFVAKFLSLGPGNALLFVVLCASASYL
FT                   AVPAAMRMTVPEAKSSYYISTTLGLTFPFNIVLGIPIYMSLVNKIIPITPL"
FT   gene            224512..224685
FT                   /locus_tag="P9515_02431"
FT   CDS_pept        224512..224685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02431"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71452"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUJ1"
FT                   /protein_id="ABM71452.1"
FT                   /translation="MPPLKPIAKSKYKEKSFGNGAGISKSDLKNIEIAPIKKNSTGGAN
FT                   TFCIMGFTSINY"
FT   gene            complement(224682..226337)
FT                   /locus_tag="P9515_02441"
FT   CDS_pept        complement(224682..226337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02441"
FT                   /product="putative sulfate transporter"
FT                   /note="COG659 Sulfate permease and related transporters
FT                   (MFS superfamily) [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71453"
FT                   /db_xref="GOA:A2BUJ2"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUJ2"
FT                   /protein_id="ABM71453.1"
FT                   /translation="MNIINGFHLKNIRGDILGGITAAVVALPLALAFGNAALGPGGAIY
FT                   GLYGAVVVGFLAALFGGTPSQVSGPTGPMSVTVAGVVAGLAAVGVPRDLSAGQILPLVM
FT                   AAVVIGGLLQILFGILKLGKYITLVPYSVVSGFMSGIGVIIITLQIGPLLGISTRGGVI
FT                   ESLSTVFSNFQPNGAAVGVAIMTLGIVFLTPRKISQWVPSPLLALLIVTPISILIFGDG
FT                   ALDRIGEIPRGVPSLSFPSFNQYFPIIFKAGLVLAVLGAIDSLLTSLVADNISQTKHNS
FT                   DRELIGQGIGNAIAGLFSGLPGAGATMRTVINVKSGGSTPISGMVHSIVLLIVLVGAGP
FT                   LAEQIPTALLAGILIKVGLDIIDWGFLRRAHKLSLKTSVVMYGVLLMTVFWDLIWAVLV
FT                   GVFIANMLTIDSITETQLEGMDKDNPLSNEDQQSQNLLPADEKALLDRCSGEVMLFRLK
FT                   GPLSFGAAKGISERMMLVRNYKILILDITDVPRLGVTATLAIEDMMQEAKNNSRKAFVA
FT                   GANEKVKERLSKFGVSGIIETRKEALEAALNELA"
FT   gene            226565..227566
FT                   /gene="hemB"
FT                   /locus_tag="P9515_02451"
FT   CDS_pept        226565..227566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="P9515_02451"
FT                   /product="Delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="COG113 Delta-aminolevulinic acid dehydratase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71454"
FT                   /db_xref="GOA:A2BUJ3"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUJ3"
FT                   /protein_id="ABM71454.1"
FT                   /translation="MNLIIRPRRLRRTEAIREMVRENYLHPEDFIYPLFIHEKDFQEDI
FT                   SAMPGTYRWDMNGLIKEVVRAWELGVRCIVLFPKIDDSLKTEDGSECFNEAGLIPKAIR
FT                   TLKKEIPEMAIMTDVALDPYSCDGHDGLVDENGKILNDETIEILKKQAITQARAGADFI
FT                   GPSDMMDGRVGAIRSALDIEGFSDVGIISYTAKFSSAYYGPFRTALDSAPKENNKKLIP
FT                   NNKSTYQMDPANSKEALIESALDQYEGADILMVKPGVSYLDIVYRLSNFSNKPIAAYNV
FT                   SGEYSMVKAAAMKNWINEKDIVLETLLSFKRAGAKLILTYHACDASKWLQER"
FT   gene            227622..228014
FT                   /locus_tag="P9515_02461"
FT   CDS_pept        227622..228014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02461"
FT                   /product="Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /note="COG346 Lactoylglutathione lyase and related lyases
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71455"
FT                   /db_xref="GOA:A2BUJ4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUJ4"
FT                   /protein_id="ABM71455.1"
FT                   /translation="MLLKVSKGVHRIGHIALRVENLDRAKSFYLNLGMKLIWDDKDWCY
FT                   LEAGNFKDGLALLGPSYKAAGPHFAFHFEEKKEVENIYSDLQSSGVKVLPIHEHRDGTA
FT                   SFYMQDPEGNWLEMLYVPAGGIKSNI"
FT   gene            228029..230440
FT                   /locus_tag="P9515_02471"
FT   CDS_pept        228029..230440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02471"
FT                   /product="putative DNA mismatch repair protein MutS family"
FT                   /note="COG1193 Mismatch repair ATPase (MutS family) [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71456"
FT                   /db_xref="GOA:A2BUJ5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUJ5"
FT                   /protein_id="ABM71456.1"
FT                   /translation="MKEKSHYKNLLSHKSLSEESIGLLEWDTLKTQIASFASTKMGKNV
FT                   VLQFEIPTEYEISRRLLKETIEINELEKNLDKSISFSGVFDICKNIEICSKGGVINSSD
FT                   LLEIAETISASRNLKKILLDFEQRPFISAFLKGLIDHNQIEKILKNGIESNGRISDRAS
FT                   QKLANLRQELLSKKSERRVLVNKFIQNNLPYIQDTIVGDRYGRPVLAIKVQYAEKFKGI
FT                   IHDSSASGNTIYLEPESIVLKGNKIASMEARVAGEEFKLLKEWSHIIRDNNQSLLEMSN
FT                   ILLRAEFSLTRSRYSNWIGGNAPIVENSPIVSLMGFSHPLLIWENKKKQAAKPVSIDFH
FT                   IDRNTKVVAITGPNTGGKTVALKGLGIALLMARSGLFIPSIQKPIIPFCPNIFVDIGDD
FT                   QSLEGNLSTFSGHILRIKNILEALNNKKGFSVVLLDEIGSGTDPSEGTALAIALLKEFA
FT                   IVSDITLATTHYGDIKALKYSDNRFENVSVAFDEESFKPKYTLNWGIPGRSNALSISKR
FT                   IGINEKILNNASNYLKPKEVENINNIIKGLEEERLKQQKSAEEAAELIARTEILHDEIK
FT                   NKYEFQKLNALKIQEAEKQKLSKHIKEAQKEVINLIKKLKDQNATGEDARLIGIRLKEI
FT                   ETDHLTQSNVERTTSWSPKIGDFIKIKSLNSSGQIIDIDEKAKSYEVKCGSFRSTLSIN
FT                   DFEGLNGEKPKFKDSQIQISSVREDFSFSKIRTSKNTIDVRGMRVHEAEIIIEEKFKKF
FT                   HGPLWIVHGIGTGKLKKGLRLWLSSLNYVDKVEDAENNEGGAGCSIAWIK"
FT   gene            230481..231464
FT                   /gene="obg"
FT                   /locus_tag="P9515_02481"
FT   CDS_pept        230481..231464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obg"
FT                   /locus_tag="P9515_02481"
FT                   /product="GTP1/OBG family"
FT                   /note="COG536 Predicted GTPase [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71457"
FT                   /db_xref="GOA:A2BUJ6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUJ6"
FT                   /protein_id="ABM71457.1"
FT                   /translation="MQFIDQANIILKAGKGGNGIVSFRREKFVPAGGPSGGNGGKGGSI
FT                   ILVADNNLQTLLDFKFNREIFAKDGFKGGPNKRSGASGENTILKVPCGTEVRDVHTGII
FT                   LGDLTIDKQSLTIAHGGRGGHGNAYYLSNQNRAPESFTEGQEGEIWEVQLELKLLAEVG
FT                   IIGLPNAGKSTLISVLSSARPKIANYPFTTLIPNLGVVRKADGNGCLFADIPGLISGAA
FT                   EGVGLGHDFLRHIQRTKILIHVIDSIAENPIHDFEIIEKELKQYGNGLLEKERIIVLNK
FT                   KELIDENYLKIIIKKLENLSKKKVLVISSALREGLPSLLSEVWNRI"
FT   gene            231552..231734
FT                   /locus_tag="P9515_02491"
FT   CDS_pept        231552..231734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71458"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUJ7"
FT                   /protein_id="ABM71458.1"
FT                   /translation="MNFYSCFDQQGKIIARCQTIQDIEVLKKMGRPIVEVKEMKNEESV
FT                   VCSLTGSPSDFNMDY"
FT   gene            complement(231785..232003)
FT                   /locus_tag="P9515_02501"
FT   CDS_pept        complement(231785..232003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02501"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71459"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUJ8"
FT                   /protein_id="ABM71459.1"
FT                   /translation="MKSIDEHIQKDQSEIASAKEQGNLPKVRHLTEELKELEEYKDHHP
FT                   EDKHDPNALELFCDANPDEPECLVYDD"
FT   gene            complement(232136..233080)
FT                   /gene="ecm4"
FT                   /locus_tag="P9515_02511"
FT   CDS_pept        complement(232136..233080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecm4"
FT                   /locus_tag="P9515_02511"
FT                   /product="Glutathione S-transferase C terminus"
FT                   /note="COG435 Predicted glutathione S-transferase
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71460"
FT                   /db_xref="GOA:A2BUJ9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUJ9"
FT                   /protein_id="ABM71460.1"
FT                   /translation="MQNKYLINFAKRSWFWFWTKLMDGFAPADSHGNYKRPKGILVDKT
FT                   YDFEVNTKNSYLLVGNSCPWCHRTLLIYKLKNLSKKIKVIFLKADINSGQWIFKEKFEG
FT                   CETLNQFYKKAQKQNIFRSTLPLLFNLQNNHINIISSESSQIVRLLNSIKVESSNKTLQ
FT                   IKNCDQNFLKMIHSDINDGVYKCGFARNQRSYELASKTLFRSLSKVEKEFDKNLGNWIC
FT                   GEDLTYADIYLFPTIIRWELIYRQLFKCSEKEISDFKNIIKWRSRFFELSNISETCFDS
FT                   EWKKDYYKAIFPLNPNQIIPVLPSLQEIIESVT"
FT   gene            233105..234001
FT                   /gene="aspA"
FT                   /locus_tag="P9515_02521"
FT   CDS_pept        233105..234001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="P9515_02521"
FT                   /product="putative aspartoacylase"
FT                   /EC_number="3.5.1.15"
FT                   /note="COG2988 Succinylglutamate desuccinylase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71461"
FT                   /db_xref="GOA:A2BUK0"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUK0"
FT                   /protein_id="ABM71461.1"
FT                   /translation="MNSGKILIVSSTHGNEINPVWSVNQYSKQGNIIDKNIEYKFIIGN
FT                   PLAYEKGCRYIDKDLNRSFNLIKNNHDTSIYEIRRANFLVEKFGVNGSEPCDIAIDLHT
FT                   TTANMGTSIVMYGRREKDFCLAALLQHKFGLPIYLHEKDEKQTGFLVEAWPCGLVIEIG
FT                   PVAQNFYDPKIINRFLIIISSLREEINKLKNKQKQLPKLVIVHVHQGSIDYPRGEDGNI
FT                   NALIHPKRMNQDWKPIKKGDPLFMDMEGCTKSYNGKNTLWPVFIGEVAYKEKNIAMSYT
FT                   KKEVINLPTQICEDFFN"
FT   gene            234165..235247
FT                   /gene="psbA"
FT                   /locus_tag="P9515_02531"
FT   CDS_pept        234165..235247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbA"
FT                   /locus_tag="P9515_02531"
FT                   /product="Photosystem II PsbA protein (D1)"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71462"
FT                   /db_xref="GOA:A2BUK1"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUK1"
FT                   /protein_id="ABM71462.1"
FT                   /translation="MTTIQQQRTSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLAA
FT                   AACFIVAFIAAPPVDIDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVD
FT                   EWLYNGGPYQLVIFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYP
FT                   FGQGSFSDGMPLGISGTFNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTS
FT                   SLIRETTETESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAVFPV
FT                   VCVWLTSMGICTMAFNLNGFNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNF
FT                   PLDLAAAESTTVALTAPAIG"
FT   gene            complement(235801..235929)
FT                   /locus_tag="P9515_02541"
FT   CDS_pept        complement(235801..235929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02541"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71463"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUK2"
FT                   /protein_id="ABM71463.1"
FT                   /translation="MVIIKWLLNGKRSKEVVSLSRAKHRRLELEAFGAIIYWSERI"
FT   gene            236118..237200
FT                   /locus_tag="P9515_02551"
FT   CDS_pept        236118..237200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02551"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71464"
FT                   /db_xref="GOA:A2BUK1"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUK1"
FT                   /protein_id="ABM71464.1"
FT                   /translation="MTTIQQQRTSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLAA
FT                   AACFIVAFIAAPPVDIDGIREPVAGSFLYGNNIISGAVVPSSNAIGLHFYPIWEAATVD
FT                   EWLYNGGPYQLVIFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYP
FT                   FGQGSFSDGMPLGISGTFNFMFVFQAEHNILMHPFHMAGVAGMFGGSLFSAMHGSLVTS
FT                   SLIRETTETESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAVFPV
FT                   VCVWLTSMGICTMAFNLNGFNFNQSVVDANGKIVPTWGDVLNRANLGMEVMHERNAHNF
FT                   PLDLAAAESTTVALTAPAIG"
FT   gene            237312..238406
FT                   /gene="aroC"
FT                   /locus_tag="P9515_02561"
FT   CDS_pept        237312..238406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="P9515_02561"
FT                   /product="Chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="COG82 Chorismate synthase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71465"
FT                   /db_xref="GOA:A2BUK4"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUK4"
FT                   /protein_id="ABM71465.1"
FT                   /translation="MSSIFGKIFRVSTFGESHGGAVGVILDGCPPKLKINIDLIQNELD
FT                   RRRPGQSKITTPRKEDDKLEILSGLKEGITLGTPIAMLVRNKDQRPEDYNNLEQVFRPS
FT                   HADGTYHLKYGIQAGSGGGRASARETIGRVAAGAIAKQLLKTLFNTEILSWVKRIHDID
FT                   SQVNKNKLTLSKIDSNIVRCPDEKVATKMIQRIKELQQEGDSCGGVIECLVKNVPSGLG
FT                   MPVFDKLEADLAKALMSLPATKGFEIGSGFLGTYLRGSEHNDSFVESDDINKLKTKSNN
FT                   SGGIQGGISNGENIEMKIAFKPTATIGKEQKTVNSDGKEIVMKAKGRHDPCVLPRAVPM
FT                   VDSMVALVLADHLLLHQAQCSIIK"
FT   gene            complement(238417..239088)
FT                   /gene="eda"
FT                   /locus_tag="P9515_02571"
FT   CDS_pept        complement(238417..239088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="P9515_02571"
FT                   /product="possible 2-keto-3-deoxy-6-phosphogluconate
FT                   aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="COG800 2-keto-3-deoxy-6-phosphogluconate aldolase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71466"
FT                   /db_xref="GOA:A2BUK5"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUK5"
FT                   /protein_id="ABM71466.1"
FT                   /translation="MQTISDFKKSDNLIKHKKDFFSKNLESKSFFLLIKPTKNIYKNAE
FT                   EKELVEKQLEKLIKIGFLNIEISWSDNEKWFDYVSNLKLKFPKLNLGSASIINKKSIDD
FT                   SIRLGLNYSMMKVWDKDLLNYSRSKNHLLIPGIKNLKDLKEAIDLHCKIIKIYPVKDKN
FT                   KLIKISQYKNIDFIAAGGLSIVDVPLYKSLGYKAIVIGDKGFKNKVIDPNIYEWIQKTS
FT                   N"
FT   gene            complement(239072..240931)
FT                   /locus_tag="P9515_02581"
FT   CDS_pept        complement(239072..240931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02581"
FT                   /product="cell division protein FtsH2"
FT                   /note="COG465 ATP-dependent Zn proteases [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71467"
FT                   /db_xref="GOA:A2BUK6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUK6"
FT                   /protein_id="ABM71467.1"
FT                   /translation="MNKRWRNVGLYVLAVITVIFIGTSVFDKPNTENATKTLRYSDFIE
FT                   AVQDKEVSRVLLSPDNGTAQVVENDGSRSEVNLAPDKDLLKILTENDVDIAVTPTKLAN
FT                   PWQQAVSSLIFPVLLIGGLFFLFRRSQSGSGGGGGGNPAMSFGKSKARLQMEPSTQVTF
FT                   SDVAGVEGAKLELTEVVDFLKSPDRFTAVGAKIPKGVLLVGPPGTGKTLLAKAVAGEAG
FT                   VPFFSISGSEFVEMFVGVGASRVRDLFEQAKKNAPCIVFIDEIDAVGRQRGAGMGGGND
FT                   EREQTLNQLLTEMDGFEGNSGIIIVAATNRPDVLDSALMRPGRFDRQVTVDRPDYAGRL
FT                   QILNVHAKDKTLSKDVDLDKVARRTPGFTGADLANLLNEAAILAARKDLDTVSNDEVGD
FT                   AIERVMAGPEKKDRVISDKKKELVAYHEAGHALVGACMPDYDAVAKVSIIPRGQAGGLT
FT                   FFTPSEERMESGLYSRSYLQNQMAVALGGRVAEEIVYGEEEVTTGASNDLQQVANVARQ
FT                   MITKFGMSDKIGPVALGQSQGGMFLGRDMSSTRDFSEDTAATIDVEVSELVDVAYKRAT
FT                   KVLTDNRSVLDEMAMMLIERETIDTEDIQDLLNRSEVKVANYI"
FT   gene            complement(240978..242153)
FT                   /gene="met3"
FT                   /locus_tag="P9515_02591"
FT   CDS_pept        complement(240978..242153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="met3"
FT                   /locus_tag="P9515_02591"
FT                   /product="ATP-sulfurylase"
FT                   /EC_number="2.7.7.4"
FT                   /note="COG2046 ATP sulfurylase (sulfate
FT                   adenylyltransferase) [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71468"
FT                   /db_xref="GOA:A2BUK7"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUK7"
FT                   /protein_id="ABM71468.1"
FT                   /translation="MNSQKESIRDSKGIILPYGGELKDLIIKDKKLITKLFSQVSYEHE
FT                   CSDRNACDVELLMVGGFSPLEGFMDKEDYKSVIKSHRNTKGLLFGLPIVFDTNKEEIRE
FT                   GETILLTYKKQKLAFLEVSSKWEPDKSVEAEFCYGTNSLDHPAVKMIFNERGRYYIGGK
FT                   IYGLELPNRDFPCKTPEEVRDLLPANFDVVAFQCRNPIHRAHYELFTNALQSDNVSSNS
FT                   VVLVHPTCGPTQQDDIPGKVRYLTYKKLEEEISNENIKWAFLPYSMHMAGPREALQHMI
FT                   IRRNYGCTHFIIGRDMAGCKSSSTGEDFYGPYDAQNFANKCSKELMMQTVPSRNLVYTL
FT                   EKGYITAEEAKEKNYQIMKLSGTEFRKKLRNGDSIPEWFAFKSVVDVLRKS"
FT   gene            complement(242228..243022)
FT                   /gene="psbO"
FT                   /locus_tag="P9515_02601"
FT   CDS_pept        complement(242228..243022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbO"
FT                   /locus_tag="P9515_02601"
FT                   /product="Photosystem II manganese-stabilizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71469"
FT                   /db_xref="GOA:A2BUK8"
FT                   /db_xref="InterPro:IPR002628"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUK8"
FT                   /protein_id="ABM71469.1"
FT                   /translation="MRIRSLLAFVISLCLTFAFVPDKTYAFSERGNAQFTDVVNTGKAN
FT                   DCPSLDSSLIGSISLGNGDSLKGICMHPTEVYVKVPGSKRKEAEFVATKIISPRNNTTV
FT                   TEVYGDIDSGTFTEKGGIDFQLITVLTPGGLEVPFAFSAKDLTADIPSSIEPGTEVSGA
FT                   TFTPNYRTGDFLDPKARAKNTGVEYAQGLVALGGDDEELAKENIKVDVNGTGVVTLSIE
FT                   NVDSDTDEFAGTFVAIQPSDTDMGSKEPLDVKIIGELYGRKA"
FT   gene            complement(243240..244496)
FT                   /gene="dfp"
FT                   /locus_tag="P9515_02611"
FT   CDS_pept        complement(243240..244496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="P9515_02611"
FT                   /product="putative p-pantothenate cysteine ligase and
FT                   p-pantothenenoylcysteine decarboxylase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="COG452 Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71470"
FT                   /db_xref="GOA:A2BUK9"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUK9"
FT                   /protein_id="ABM71470.1"
FT                   /translation="MKNNSKESKIKLLILITGSIAAVRIPLLVSQLVKDNYDVKCVMSK
FT                   NAEKLIQPASLSILSRNVCVLDKDQWSYIQPKPLHIDLCNWADFLIIAPLTATTLSKWV
FT                   TGNADGLISSILIANNKPIIVAPAMNSNMWINQAVQKNYQCLLNYSNVLTLEPSKGILA
FT                   CDEIGIGKIPPNDLIQLALTFILSHNKKTYYRDLSNKKILITGGCTSEKIDAARKITNN
FT                   SSGTMGLMLAQVARFRGANVKYIHGPLKNRLDITEGIESVEIENSTDLIQEIEKEISKC
FT                   DYFIMNAAVADFKISSDTLKKIPKSKFSNFFKNSIEFIPDILRDFSKVKKENQIFVGFC
FT                   AFTGSIQNARKTIKEKIVLKGCDLIFANPIDIEEQGFGPLAKNEGWLFDTKNMEHHIEK
FT                   TSKLELANKLINRIISANK"
FT   gene            complement(244507..244707)
FT                   /locus_tag="P9515_02621"
FT   CDS_pept        complement(244507..244707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02621"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71471"
FT                   /db_xref="InterPro:IPR019678"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUL0"
FT                   /protein_id="ABM71471.1"
FT                   /translation="MKSTNHNTISADILVVFNEEITFDLAKGLEDENYALSFDESKTLD
FT                   LLWPLAINKTELPSDYSYLLC"
FT   gene            244840..245031
FT                   /locus_tag="P9515_02631"
FT   CDS_pept        244840..245031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71472"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUL1"
FT                   /protein_id="ABM71472.1"
FT                   /translation="MSQTKKEQVVSHLRYLRQELREMHLGIQDDGLFPEPGELRGVLAQ
FT                   MEALLELIEGNPKIKSDS"
FT   gene            245060..245401
FT                   /locus_tag="P9515_02641"
FT   CDS_pept        245060..245401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71473"
FT                   /db_xref="GOA:A2BUL2"
FT                   /db_xref="InterPro:IPR007572"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUL2"
FT                   /protein_id="ABM71473.1"
FT                   /translation="MVFKPQKTKFQLLVIDNFDSLSQWAANPWRRYSLALTVVLTGYFF
FT                   GSSLGMISAVAELIDPVGAFLSVFFIEVLIQFRRRLRFDRRKKLLVLLIDSLRLGLFYG
FT                   FFTESLKLL"
FT   gene            complement(245404..246420)
FT                   /gene="pyrB"
FT                   /locus_tag="P9515_02651"
FT   CDS_pept        complement(245404..246420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="P9515_02651"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="COG540 Aspartate carbamoyltransferase, catalytic
FT                   chain [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71474"
FT                   /db_xref="GOA:A2BUL3"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUL3"
FT                   /protein_id="ABM71474.1"
FT                   /translation="MGNWPHKHILTLSNFSIYDYKSVFELTERFKSLINAGTKKIPALQ
FT                   GNLITSIFFEASTRTRNSFELAAKRLSADVQSFSPSSSSLSKGETLIDTALTYAAMGSD
FT                   ILIIRHSSSHVPLEISKKLDATNTKTSVLNAGDGLHSHPSQGLLDLYTLIKFFSPELMK
FT                   PEILYSKKILIVGDVLHSRVARSNLWALTAFGANVILCGPPTLIPEEFTSFVSSSPPNQ
FT                   LRDPISSRGSITISRSLEDSIKDADAVIVLRLQKERMMENLLSSIKSYSENYCLTPEKL
FT                   SMNDKNIPILHPGPINRGIEISSRIVDEYPNCLINDQVSNGIPTRMALLYLLSKFNK"
FT   gene            complement(246420..246917)
FT                   /locus_tag="P9515_02661"
FT   CDS_pept        complement(246420..246917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02661"
FT                   /product="possible Methylpurine-DNA glycosylase (MPG)"
FT                   /note="COG2094 3-methyladenine DNA glycosylase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71475"
FT                   /db_xref="GOA:A2BUL4"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUL4"
FT                   /protein_id="ABM71475.1"
FT                   /translation="MIVETEAYSQEEEACHGHKKKTPSNEVLFGEPGRFYIYRSYGIHH
FT                   CLNIVTDKNNFASGVLIRAVFVSNKNERLASGPGLVTKTFEIDDKLNSLDILDNKCLWI
FT                   SKRESFLDKKDLIQTTRIGISKAKNIKWRWYLKRSRSISKREKGDRNPDLKKSTNNLLG
FT                   IT"
FT   gene            247240..247533
FT                   /gene="gatC"
FT                   /locus_tag="P9515_02671"
FT   CDS_pept        247240..247533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="P9515_02671"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit C"
FT                   /EC_number="6.3.5.7"
FT                   /note="COG721 Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71476"
FT                   /db_xref="GOA:A2BUL5"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUL5"
FT                   /protein_id="ABM71476.1"
FT                   /translation="MKRISSDEVKKVAELARLELNENEIHQHAEQLEKILEYIKQLEKI
FT                   NTENIACTTRAIEVVNVLRKDERRDYENSDELLDLAPSRENKFFKVPKIINE"
FT   gene            complement(247534..248433)
FT                   /gene="crtR"
FT                   /locus_tag="P9515_02681"
FT   CDS_pept        complement(247534..248433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtR"
FT                   /locus_tag="P9515_02681"
FT                   /product="Beta-carotene hydroxylase"
FT                   /note="COG3239 Fatty acid desaturase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71477"
FT                   /db_xref="GOA:A2BUL6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUL6"
FT                   /protein_id="ABM71477.1"
FT                   /translation="MFFGGYFLAFLSIWQWYRGVWPLPLLVATAFLALHIEGTVIHDAC
FT                   HKAAHPIPWINQAMGHGSAILLGFSFPVFTRVHLQHHIHVNDPKNDPDHIVSTFGPIWL
FT                   IAPRFFYHEIFFFQRKLWRKNELLQWGLERSIFITIILAGLKFDFMNLIYNLWFGPALM
FT                   VGVTLGIFFDYLPHRPFQSRNKWINSRVYPGNFLNILIMGQNYHLIHHLWPSIPWFEYK
FT                   IAYEKTKPLLEMKGSPQRVGIFETKHDTFNFIYDLLIGIRSHKSKKGKLRKIINSFPIF
FT                   KVKKFLLRIVNKNFIGGN"
FT   gene            248727..248808
FT                   /locus_tag="P9515_tRNALeuVIMSS1309138"
FT                   /note="tRNA-Leu"
FT   tRNA            248727..248808
FT                   /locus_tag="P9515_tRNALeuVIMSS1309138"
FT                   /product="tRNA-Leu"
FT   gene            248892..249419
FT                   /locus_tag="P9515_02691"
FT   CDS_pept        248892..249419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71478"
FT                   /db_xref="GOA:A2BUL7"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUL7"
FT                   /protein_id="ABM71478.1"
FT                   /translation="MVIYLGCFYIFIGITFLLIPLLYIELGRPRDLIKAGLNLMIGMLL
FT                   LVKSNIFVNFYASTLIVVTLLFIFYLVEIFSIRWNQLTNQEQNNLKTFKELKKNFLTFI
FT                   EAISLARKDFLNFNSIFKFGRNNENLNKKKWVRNGENDNISNSNKNNLLTLEMQKKATI
FT                   QSKKDTIDVENI"
FT   gene            249463..252360
FT                   /gene="ileS"
FT                   /locus_tag="P9515_02701"
FT   CDS_pept        249463..252360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="P9515_02701"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="COG60 Isoleucyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71479"
FT                   /db_xref="GOA:A2BUL8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUL8"
FT                   /protein_id="ABM71479.1"
FT                   /translation="MKPKNNKDKKSKFSYKETLNLLKTDFSMRANSVSREPQIQEFWLK
FT                   NKIDLELGSSNLGEKFTLHDGPPYANGSLHMGHALNKVLKDIINKYKTLKGFKVHFVPG
FT                   WDCHGLPIELKVLQSLKSHERKDLDSLGLRKKATDYAKIQIKNQLEGFKRWGIWGDWDN
FT                   PYLTLKNNYESAQIGVFGKMFLNGYIYRGLKPVHWSPSSRTALAEAELEYPEEHYSSSV
FT                   YVSLNISNLSDEILLKLEEKDLKNKLLSNLNKLFIAIWTTTPWTIPGNEAVAINPRINY
FT                   VFAEDQNGDIFLFAKDLISEISEKLEREFNTLIDVKGSMLTGIEYKHPTKNKFCNIVIG
FT                   GDYITTESGTGIVHTAPGHGMDDFNVGKKYHLPITCIVDEKGNLNNHAEKFCGLNVLKD
FT                   ANDLIIEDLKKNNLLLLKEKYKHRYPYDWRTKKPTIFRATEQWFASVEGFRSSALKAIE
FT                   DVEWMPKTGKKRIYSMVVGRGDWCISRQRSWGVPIPVFYEKKGKEILLNSETINHIQKL
FT                   FNEHGADIWWDWDEKDLLPKQYKEESDRWIKGLDTMDVWFDSGSSWAAVCEQREELAYP
FT                   ADLYLEGSDQHRGWFQSSLLTSVAVNNKPPYKKVLTHGFALDENGRKMSKSLGNVVDPN
FT                   IIINGGSNQKIQPAYGADVLRLWVSSVDYSVDVPIGSNILKQLSDVYRKVRNTARYLLG
FT                   NIHDYDPIDEEIDIDQLPILDQWMLNRLVDVSDQITIAYENYEFSKFFQILQSFCVVDL
FT                   SNFYLDIAKDRLYVSAKSSIRRRTCQFVMSKIVENLAVLISPVLCHMAEDIWQNIPYST
FT                   NEKSVFERGWPNLPKSWINPELNERISNLRKLRVEINKAIEGCRTQQIIGAALETEVNY
FT                   LPENEIIKNSLSWLEKFGNKEVDLYSDWLIVSKFNVVNNLFEDYLIIDDNELGKIQILK
FT                   AKGQKCDRCWHYQSNTVMGIEDTKLCKRCANIITS"
FT   gene            complement(252370..252705)
FT                   /locus_tag="P9515_02711"
FT   CDS_pept        complement(252370..252705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02711"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71480"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUL9"
FT                   /protein_id="ABM71480.1"
FT                   /translation="MGGILVFLIMAEIDLIRNLEKISFMIPNRLLKLQGYLLREYSKEF
FT                   LEIIIYKGFSSSTTHQIEIDSEKQVIEFDHFFTKFILYEAPLTQGSEVIVRENTDSLFF
FT                   LNQRNWN"
FT   gene            complement(252665..253288)
FT                   /locus_tag="P9515_02721"
FT   CDS_pept        complement(252665..253288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71481"
FT                   /db_xref="GOA:A2BUM0"
FT                   /db_xref="InterPro:IPR021515"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUM0"
FT                   /protein_id="ABM71481.1"
FT                   /translation="MNIFNQLSIWLSFQLSLVFIVGIPFTLFCWSIKNKSKAISKLLTN
FT                   YWKISLLFFISLILLIGKYNYALLITNISTVIMAISVWFWDDINDELKEYDISHPLSTT
FT                   TKVWRWSLTFISLNFLIQSMNNINCISFINSPECQIWLKPSTNLYFILKNLFNFLFGAS
FT                   FSQPIAKFLGLFALLIYILGLLQWAIIKLPKSGRNSGFSNYGRN"
FT   gene            253415..254044
FT                   /locus_tag="P9515_02731"
FT   CDS_pept        253415..254044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02731"
FT                   /product="Predicted SAM-dependent methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="COG220 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71482"
FT                   /db_xref="GOA:A2BUM1"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUM1"
FT                   /protein_id="ABM71482.1"
FT                   /translation="MRQHVNPLSKNFFEIDPIPPLNEVFENPQLPLHLDIGCASGDFLM
FT                   ELSLKNKNWNYIGIEIREKLVLNANLKIKNREYKNVYFSFGNAINILNNTNNKTLIDAI
FT                   TSISFYFPDPWFKKKHHKRRVIQPEFINLLSNAMRTRSLIFIKTDVQELFEYMELTILE
FT                   SLKFKKLAYEDFRVNESFNPIKTQTKREKYVLLSQFEIYESIYIRI"
FT   gene            complement(254046..255404)
FT                   /locus_tag="P9515_02741"
FT   CDS_pept        complement(254046..255404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02741"
FT                   /product="Phosphotransferase superclass"
FT                   /EC_number="5.4.2.10"
FT                   /EC_number="5.4.2.2"
FT                   /note="COG1109 Phosphomannomutase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71483"
FT                   /db_xref="GOA:A2BUM2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUM2"
FT                   /protein_id="ABM71483.1"
FT                   /translation="MQSIFGTDGIRGRFDKEITYSLAYKVGYALGFIVKTNNPILIGRD
FT                   TRISGEILFEAISKGIKDAGKEFIYLGICPTPAIPFLIKKEKFSSGIMISASHNPPEFN
FT                   GIKIFDKNGEKIKRDFEKRIELIMARVDNNKIITNKYKSVSKNNELLNIYTKGLIDSME
FT                   NENLEGMKIILDACYGSATTCAESVFKKLGANVKVINNDKDGLKINLNCGSTCLDPLNK
FT                   AIKENDADMGFSFDGDADRVIGVDSKGNILDGDHILFLWGRELLEEKVLTNNTIISTRM
FT                   ANLGFERNWNNIGGILYRTEVGDKFIFAALKEKKALLGGEQSGHILSKINNFCGDGILT
FT                   ALQISKYCKKKNINLESWLNSSFLPYPQKLTNILLSFDFKNINNSNKDLINESIESFSS
FT                   IKKNDCRVYIRPSGTEPVLRILVEAQNQKEVDFLSTKITTELRSKINKISNNL"
FT   gene            255538..256086
FT                   /locus_tag="P9515_02751"
FT   CDS_pept        255538..256086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02751"
FT                   /product="thioredoxin-like protein TxlA"
FT                   /note="COG526 Thiol-disulfide isomerase and thioredoxins
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones / Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71484"
FT                   /db_xref="GOA:A2BUM3"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUM3"
FT                   /protein_id="ABM71484.1"
FT                   /translation="MMQSGNKESFLNLSQKSILILSFTLIIGSLLLFKNLVFQPNFLLK
FT                   KFGELTIDPEIAFTNKKPTFLEFYAEWCEVCKEMAPSVADIKEEYEKDINFVFLNVDNP
FT                   KWEKYIRNFNVNGIPQVNLFDEDANLEVTFIGKQQEKTIKESLDNLYEHSQSNLQILNT
FT                   EFSKIRDNKNYQTSPRSHG"
FT   gene            complement(256089..256727)
FT                   /gene="thy1"
FT                   /locus_tag="P9515_02761"
FT   CDS_pept        complement(256089..256727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thy1"
FT                   /locus_tag="P9515_02761"
FT                   /product="possible Thy1"
FT                   /EC_number="2.1.1.148"
FT                   /note="COG1351 Predicted alternative thymidylate synthase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71485"
FT                   /db_xref="GOA:A2BUM4"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUM4"
FT                   /protein_id="ABM71485.1"
FT                   /translation="MSRVELITLTPDAEKTMAFIARVSNPSNQDNDKFAGLLRYCIQHE
FT                   HWSVFEQSCMTLKIETNRGIAAQILRHRSFTFQEFSQRYAETNLLGNDIPIPELRRQDK
FT                   KNRQNSMDDIPNEVKSKFSEKIEKHFQEANNLYEEMLNAGIAKECARFIMPLATPTRIY
FT                   MTGSCRSWIHYIQLRSKEGTQKEHMEIAEDCKTVFIKSFPSVSEALNWE"
FT   gene            complement(256729..257322)
FT                   /gene="dcd"
FT                   /locus_tag="P9515_02771"
FT   CDS_pept        complement(256729..257322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="P9515_02771"
FT                   /product="dCTP Deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="COG717 Deoxycytidine deaminase [Nucleotide transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71486"
FT                   /db_xref="GOA:A2BUM5"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUM5"
FT                   /protein_id="ABM71486.1"
FT                   /translation="MLKNDLWINQKASEGMINPFQSNLVRHLDPTLKKNAVLSYGCSSY
FT                   GYDLRLSSKEFLIFKHVPGTVMNPKKFNPDNLEKTVLHKDKDGEFFILPAHSYGLGVAL
FT                   EKMKVPENITVICIGKSTYARLGIIVNTTPAEAGWEGHLTLEFSNSSGADCRIYANEGI
FT                   CQLLFFEGDPCSTTYEDRKGKYQNQPEQVTLAKI"
FT   gene            complement(257328..257906)
FT                   /locus_tag="P9515_02781"
FT   CDS_pept        complement(257328..257906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02781"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="COG2109 ATP:corrinoid adenosyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71487"
FT                   /db_xref="GOA:A2BUM6"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUM6"
FT                   /protein_id="ABM71487.1"
FT                   /translation="MSVSSLKSYSTSNQQVVNINNKESKLRRPNHNGQIQIYQSSYRGS
FT                   YSSIIRDSLRNAALGRKVLLVQLMKGGVKQGIVNAQKLCGNLTWIRSSNSYDQYEPEEI
FT                   ASNENLAKSINHSINELWDFCKKELLSGEYDQIILDEIFLALELNIISKDDLISTLQNR
FT                   FITGDVILTGTNIPKNFLLMADQITELRS"
FT   gene            258093..258827
FT                   /gene="ntcA"
FT                   /locus_tag="P9515_02791"
FT   CDS_pept        258093..258827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntcA"
FT                   /locus_tag="P9515_02791"
FT                   /product="Global nitrogen regulatory protein, CRP family of
FT                   transcriptional regulators"
FT                   /note="COG664 cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases [Signal transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71488"
FT                   /db_xref="GOA:A2BUM7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR022299"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUM7"
FT                   /protein_id="ABM71488.1"
FT                   /translation="MLPTSRGFNRSTQQPSGQNTINTVGERFPINKTLMEVIKGLEGAS
FT                   TEMVERSKTIFSPGDPAERVYLIRRGAVRLSRVYESGEEITVALLRENSLFGVLSLLTG
FT                   HRSDRFYHAIAFTRVEVITAPANSVLRAIEADASVGLLLLQGLSSRILQTETMIETLTH
FT                   RDMSSRLVSFLMVLCRDFGVASKKGITIDLKLSHQAIAEAIGSTRVTITRLLGDLKDSG
FT                   LLTIEKKKITVFDPIALAKRFN"
FT   gene            258880..259851
FT                   /locus_tag="P9515_02801"
FT   CDS_pept        258880..259851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71489"
FT                   /db_xref="GOA:A2BUM8"
FT                   /db_xref="InterPro:IPR021435"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUM8"
FT                   /protein_id="ABM71489.1"
FT                   /translation="MSGWLFIIFLLLLGGLISTLGDLLGSKIGKARFSVLKLRPKKTAI
FT                   LITILTGSLISASSLFLMILVNRQLRVGLFKLGDLQKKLQESKQVLIPLKKERSILENK
FT                   IKAKETEFKQLERNIIALRSGKFVIRSGQSLIISEITSSSQEDIKSQIENIIINANKYT
FT                   HKIVKPESKNIKNLLLLRKNHIEEMQNTILKGGNWVINIKSVRNVLKGENYVYAFPEIT
FT                   ENKIIVRKGEKITKIDFKEENFNKKDFGDKVNFLLSSSLAEVKRRGSLTNEIKLRSDSV
FT                   KELRDFLNKNDKINFELEAVSISNSKTAQPVIIKLNINYPQS"
FT   gene            259852..260289
FT                   /locus_tag="P9515_02811"
FT   CDS_pept        259852..260289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02811"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71490"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUM9"
FT                   /protein_id="ABM71490.1"
FT                   /translation="MSIILAIDPGISKCGVIVADLTEKKVYEAVVINSCLLLKYVKKKY
FT                   QDQKNIQCLIGNGTSSEIYINDLNQMVPNVIIAEEKNSTFRAKQRYFEIFPLLGIKCFL
FT                   PREIFILNKNLDALAALIIMEDYFQVKFDFSKKIKTKTWLK"
FT   gene            complement(260270..260527)
FT                   /locus_tag="P9515_02821"
FT   CDS_pept        complement(260270..260527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02821"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71491"
FT                   /db_xref="InterPro:IPR021492"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUN0"
FT                   /protein_id="ABM71491.1"
FT                   /translation="MKSKPETTANVSVKEYCFIKKELKGVVEASDFKWQFTWSFGKGIL
FT                   MVKPPLGRALIEDSLLRFLLKKDYELEAGNEYKFTISAKF"
FT   gene            complement(260541..261140)
FT                   /gene="pth"
FT                   /locus_tag="P9515_02831"
FT   CDS_pept        complement(260541..261140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="P9515_02831"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="COG193 Peptidyl-tRNA hydrolase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71492"
FT                   /db_xref="GOA:A2BUN1"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUN1"
FT                   /protein_id="ABM71492.1"
FT                   /translation="MKDNEVFIIGLGNPGKQYIKSRHNIGFLLLETFSKKYDAQFTLKN
FT                   KLKSRYTEFKINDSIYKLFMPHTYMNNSGDAVKAIVDWYKISLDKVFIIVDDIDLPLGK
FT                   IRFRKKGSSGGHNGLKDIINKLQTENFNRIKIGIGSPPINETKKQLNTISHVLGNISSQ
FT                   ENSTLEKVYQKVIESLEELDIKNEDYIISELNSFHK"
FT   gene            complement(261308..261508)
FT                   /gene="psbH"
FT                   /locus_tag="P9515_02841"
FT   CDS_pept        complement(261308..261508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbH"
FT                   /locus_tag="P9515_02841"
FT                   /product="Photosystem II PsbH protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71493"
FT                   /db_xref="GOA:A2BUN2"
FT                   /db_xref="InterPro:IPR001056"
FT                   /db_xref="InterPro:IPR036863"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUN2"
FT                   /protein_id="ABM71493.1"
FT                   /translation="MGQKTALGTLLKAIGNSGQGKVVPGWGAVPIMTVIGLLLLVFLVI
FT                   LLQIYNQSLLLQGFSVDWNGN"
FT   gene            261588..261740
FT                   /gene="psbN"
FT                   /locus_tag="P9515_02851"
FT   CDS_pept        261588..261740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbN"
FT                   /locus_tag="P9515_02851"
FT                   /product="Photosystem II reaction centre N protein (psbN)"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71494"
FT                   /db_xref="GOA:A2BUN3"
FT                   /db_xref="InterPro:IPR003398"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUN3"
FT                   /protein_id="ABM71494.1"
FT                   /translation="MQTLSSAPDPAVSVAVTILAVLLALTGFGLWTAFGPKATKLTDPW
FT                   DDHDD"
FT   gene            261872..262000
FT                   /gene="psbI"
FT                   /locus_tag="P9515_02861"
FT   CDS_pept        261872..262000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbI"
FT                   /locus_tag="P9515_02861"
FT                   /product="photosystem II reaction center PsbI protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71495"
FT                   /db_xref="GOA:A2BUN4"
FT                   /db_xref="InterPro:IPR003686"
FT                   /db_xref="InterPro:IPR037271"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUN4"
FT                   /protein_id="ABM71495.1"
FT                   /translation="MLALKISVYTIVFFFVGIFLFGFLASDPTRTPNRKDLESPQD"
FT   gene            262023..263807
FT                   /locus_tag="P9515_02871"
FT   CDS_pept        262023..263807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02871"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71496"
FT                   /db_xref="InterPro:IPR022244"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUN5"
FT                   /protein_id="ABM71496.1"
FT                   /translation="MNIRNFIKAISLVSSLINFSSLGKTIELIDIETKNTFQTKTYYFD
FT                   NSKETQEELLKKNNNNLIINSEVNINKIFRNNSPLLLVNSSITKKELEIQSQIQSEENN
FT                   ILNAEGNVLVTYKGNILKADSLIYDKTNKIIIANGNVSLNIGEQLFKMVSLKYDFNNRK
FT                   GYLLDVKGLIKTDNLIDDLFSNFENSDAKKIEILKEIKKDKVRHTPKSIENWVLFTDRI
FT                   NISGNKWTSVKTTLTNDLLELKQVKIEVNALEAIARNEELKFKSSVNFLVLDEKINIPF
FT                   WFGDRTLTKEIRYENRWNIGFDNVDKDGFFIGRKLNSINIFDDFILDLEPQFLIQRSLK
FT                   GYTKSFVSQGDSITADKVKRDVTLKDYFALNSQIKGKINKWTLEIDQQNNSFDPEKFSD
FT                   SIRFKANLSKDIYFLNSKWKKSFYGIYRDRVWNGSIGETEIYSAYGSKLEKQNSWVSNG
FT                   ISKTEILSLGLASFKGEALNSKNLVRSTKGNFFYLLDQKFPIIVDESTNEFIDSSYNYI
FT                   PKPIKKGLSLNTKLELLYSFYDSGNNQQYVGFGAGPEFVFGDFKKNLSTIPKLAYYLFI
FT                   NKSGEVCLSLIKFLINLL"
FT   gene            263863..264015
FT                   /pseudo
FT                   /locus_tag="P9515_pseudoVIMSS1362532"
FT                   /note="Pseudogene derived from PMED4_02591"
FT   gene            complement(264020..264640)
FT                   /gene="leuD"
FT                   /locus_tag="P9515_02881"
FT   CDS_pept        complement(264020..264640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="P9515_02881"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="COG66 3-isopropylmalate dehydratase small subunit
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71497"
FT                   /db_xref="GOA:A2BUN6"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUN6"
FT                   /protein_id="ABM71497.1"
FT                   /translation="MNVKFTPPIGRFSQLNGKCISLVGDDIDTDRIIPARFLKCVNFDS
FT                   LGKSVFDDDRKALKGKHPFDLEANKGASILIVNSNFGCGSSREHAPQALMRWGIKAIIG
FT                   ESFADIFYSNCIAIGVPCFTLSKKSIQIIQKYINNKALFFEVDLLKSVALSKDLKFDLE
FT                   IKETSRKMFLSGEWDTTSKLIENNDLIEKKLNELPYIKFNSNF"
FT   gene            complement(264637..266046)
FT                   /gene="leuC"
FT                   /locus_tag="P9515_02891"
FT   CDS_pept        complement(264637..266046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="P9515_02891"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="COG65 3-isopropylmalate dehydratase large subunit
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71498"
FT                   /db_xref="GOA:A2BUN7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUN7"
FT                   /protein_id="ABM71498.1"
FT                   /translation="MSQDTLFDKVWELHKVANLPGGSDQIFIGLHLIHEVTSPQAFGAL
FT                   KDKNLKVKFPNRTVATVDHIVPTDNQNRPFRDNLAEQMIDTLEKNCFEHKIKFFNIGSG
FT                   KQGIVHVVAPELGLTQPGMTIACGDSHTSTHGAFGSIAFGIGTSQVRDVLASQTIAMNK
FT                   LKVRQIWCENKLSNGIYAKDLVLHIINHLGVKAGVGYAYEFAGPAISALSMEERMTICN
FT                   MSIEGGARCGYINPDEKTFSYIKDKLCSPQNENWDKAIKWWKSLQSNENSIFDDVIKID
FT                   ASRVEPTVTWGITPGQSIGISQKIPSLGEIHPNDQFIAGEAYEYMGFKPGQPIKDTPID
FT                   VCFIGSCTNGRISDLRVAARVLGNHKIAKNIKAFVVPGSERVAKEAKEEGLDKVFIDAG
FT                   FQWREPGCSMCLAMNSDKLIGNQVSASSSNRNFKGRQGSPSGRTLLMSPAMVAAAAIKG
FT                   KVSDVRDFLNK"
FT   gene            complement(266059..267360)
FT                   /gene="cinA"
FT                   /locus_tag="P9515_02901"
FT   CDS_pept        complement(266059..267360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="P9515_02901"
FT                   /product="Molybdenum cofactor biosynthesis protein"
FT                   /note="COG1058 Predicted nucleotide-utilizing enzyme
FT                   related to molybdopterin-biosynthesis enzyme MoeA [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71499"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUN8"
FT                   /protein_id="ABM71499.1"
FT                   /translation="MKPNLNHRSNEPNCKGVEILSIGTELLLGNIVNTNAQWISEELSA
FT                   LGLNHFRQSTIGDNSKRISNLIKEISLRSDLLITTGGLGPTPDDLTTEAIAKSFNVTLY
FT                   ERESLWDEIKKKLSLSSSIQNNSSLKKQCFFPKDAQIIHNPRGTAPGMIWKPKKGFTIL
FT                   TFPGVPSEMKVMWKETAIDYIQKNFSDGYIFFSNTLNFSGIGESKVSEKIDNLLKLKNP
FT                   TVAPYANLGELKLRITARATNELQAKNLIKPVKEELKKEFSKFIFGEDNETLSSVLIKE
FT                   LLKRKESLGFAESCTGGLLSSTITKVSGSSQVFKGSIISYSNELKQSLLNIPEDRIKKY
FT                   GAVSEEIAQDMTINAREKLNSDWSIAISGIAGPSGGSKEKPVGIVYISIAGPNNHITNI
FT                   KKIFSSTRNRVEIQRLSVNVCLNSLRLILLSKSK"
FT   gene            complement(267329..268600)
FT                   /gene="glyA"
FT                   /locus_tag="P9515_02911"
FT   CDS_pept        complement(267329..268600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="P9515_02911"
FT                   /product="Serine hydroxymethyltransferase (SHMT)"
FT                   /EC_number="2.1.2.1"
FT                   /note="COG112 Glycine/serine hydroxymethyltransferase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71500"
FT                   /db_xref="GOA:A2BUN9"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUN9"
FT                   /protein_id="ABM71500.1"
FT                   /translation="MNILQNLKKSDPIISNLINSEKNRQETHLELIASENFASMAVMQA
FT                   QGSVLTNKYAEGLPQKRYYGGCEFVDEIEELAIERAKQLFDADWANVQPHSGAQANAAV
FT                   FLSLLNPGDTILGMDLSHGGHLTHGSPVNMSGKWFNAVHYGVDKETNKLNFNVIRDIAL
FT                   ATKPKLIICGYSAYPRTIDFKSFRSIADEVGAFLMADIAHIAGLVASKLHPNPIPYCDV
FT                   VTTTTHKTLRGPRGGLILCKDKEFGKKFDKSVFPGTQGGPLEHIIAAKAVAFGEALQPN
FT                   FVNYSKQVIKNAKVLSSTLINRGIDIVSGGTDNHIVLLDLRSINMTGKVADLLVSEVNI
FT                   TANKNTVPFDPESPFVTSGLRLGTAALTTRGFNDEAFIEVGEIIADRLLNPDDLLIEKE
FT                   CKERVLSLCNSFPLYEAKLESSIK"
FT   gene            complement(268678..268751)
FT                   /locus_tag="P9515_tRNAArgVIMSS1309117"
FT                   /note="tRNA-Arg"
FT   tRNA            complement(268678..268751)
FT                   /locus_tag="P9515_tRNAArgVIMSS1309117"
FT                   /product="tRNA-Arg"
FT   gene            268841..269092
FT                   /locus_tag="P9515_02921"
FT   CDS_pept        268841..269092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02921"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71501"
FT                   /db_xref="GOA:A2BUP0"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUP0"
FT                   /protein_id="ABM71501.1"
FT                   /translation="MPIKWYGNGDSEDPTYKHFSRIVNFVIHCMVFTAVVSGTWLFKEI
FT                   KHDLLFFNNFAIAWTVILVSHLLFVFIKKPKDFQNQST"
FT   gene            269102..269383
FT                   /locus_tag="P9515_02931"
FT   CDS_pept        269102..269383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02931"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71502"
FT                   /db_xref="InterPro:IPR021518"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUP1"
FT                   /protein_id="ABM71502.1"
FT                   /translation="MNSQIQISDLENIISEKIFIKIEKWNLYLGDAGLARNLALECISN
FT                   LDKGSKNAAITSLEAINVKIGDGDQTIQLSKLITSSQICDLEEILDNL"
FT   gene            complement(269391..270971)
FT                   /gene="mviN"
FT                   /locus_tag="P9515_02941"
FT   CDS_pept        complement(269391..270971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="P9515_02941"
FT                   /product="Uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /note="COG728 Uncharacterized membrane protein, putative
FT                   virulence factor [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71503"
FT                   /db_xref="GOA:A2BUP2"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUP2"
FT                   /protein_id="ABM71503.1"
FT                   /translation="MNSYLKNNIVSISFATSLSKAAGCIRQIFIAAAFGVGTTYDAFNY
FT                   AYIIPGFLLILIGGINGPLHNAVVAVITPLNKRDGAIVLTKVSIKLTFLFFLLGIIIFF
FT                   NSDFFINFIGPNLSIESKSIASYQLKLLTPCIPLSAFIGLSFGALNSRNKFFLSSISPA
FT                   FTSLTTILFITISWIINSQNTTSNNFFYTGLLASATLTGTCIQFVIQLWEINKIGLLRF
FT                   KLGVQSVNSEEKRILKLIAPASISSGLGQINVFIDMFFASSFQGAASGLAYGNFLIQAP
FT                   LGILSNVLILPLLPKFSRFQSNQEIRALEKSLISGIEYCFLTTLFLTGFFITFNNQIVQ
FT                   FVFQRGAFNSEAVSLVKNILIAYAVGIPFYLYRDLLVRTYYSIEKPKLPFQLSLGGIIL
FT                   NVFFDWFLLGAPIHNFGNLLPYNFGVIGIILSSGLVNLIICIFLSANFNVYKIKISIPI
FT                   LLKRIFLISLACLITSTTCYAIIKDFDELNSNILSLIILIIGFLAFSIIYFSITRLLGV
FT                   NKLKLPIKM"
FT   gene            271044..271793
FT                   /gene="sfsA"
FT                   /locus_tag="P9515_02951"
FT   CDS_pept        271044..271793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="P9515_02951"
FT                   /product="putative sugar fermentation stimulation protein"
FT                   /note="COG1489 DNA-binding protein, stimulates sugar
FT                   fermentation [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71504"
FT                   /db_xref="GOA:A2BUP3"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUP3"
FT                   /protein_id="ABM71504.1"
FT                   /translation="MDDRIINFEPLIEGVLIKRYKRFLSDIKLDNGEIVTAHCANTGPM
FT                   KGLLNEGAKVRISYSSSPKRKLSWTWEQVEVTGINNEKVWVGINTLFANKLIKTVIEKN
FT                   LLKDKLGDIATIQSEVVYGQDKKSRIDFLLTPKISNPDNRKIFIEVKNTTWKKNKIALF
FT                   PDTETKRGQKHLIELKGVMPESKSVLVPCITRKDVDFFGPGDEADPIYGDLFRDSIDAG
FT                   MLLIPCCFEFHKDHITWKGFKPLKLDG"
FT   gene            271959..273419
FT                   /gene="amt1"
FT                   /locus_tag="P9515_02961"
FT   CDS_pept        271959..273419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt1"
FT                   /locus_tag="P9515_02961"
FT                   /product="Ammonium transporter family"
FT                   /note="COG4 Ammonia permease [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71505"
FT                   /db_xref="GOA:A2BUP4"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUP4"
FT                   /protein_id="ABM71505.1"
FT                   /translation="MTNALQTPHRRSSSKLQDASLVNGPMLLLRSIRGFSSNRSMLWLA
FT                   TVPLSLFGLGIFNLSAHAADLPELNAAFLANNLWLLIATILVIFMNAGFAMVEAGMCRS
FT                   KNAVNILTKNLFVFALAVTSYWFIGYSLMYGGSIADGWLYFGGLFFDPTVTADMVTDAG
FT                   LVPTVDFLFQSAFAGTAATIVSGLVAERVKFGEFVVFAIVLTAFIYPIAGSWKWNGGWL
FT                   DSLGFVDFAGSSIVHSVGAWAGLVGAMLLGPRIGKFRDGKPQAMPGHNMAIATLGALVL
FT                   WIGWYGFNPGSQLAMDQWVPYVAVTTTLAAAAGAIGATIVSTLTSGKPDLTMIINGILA
FT                   GLVSITAGCGDMTLAGAWFAGLVGGIIVVFSVAAVDAAEIDDPVGAFSVHGVCGVWGTL
FT                   VIGLWGTAVQADGAGLGLFNGGGIKLLLVQALGAAAYAIWTLVTCWIAWSVIGGIFGGI
FT                   RVSEEEETQGLDIGEHGMEAYPDFASAK"
FT   gene            273513..274709
FT                   /gene="lytB"
FT                   /locus_tag="P9515_02971"
FT   CDS_pept        273513..274709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="P9515_02971"
FT                   /product="LytB"
FT                   /EC_number="1.17.1.2"
FT                   /note="COG761 Penicillin tolerance protein [Lipid
FT                   metabolism / Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71506"
FT                   /db_xref="GOA:A2BUP5"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUP5"
FT                   /protein_id="ABM71506.1"
FT                   /translation="MDTQAIKHSVQHSGRYNRKGFESPTQRAKALGESYQSDLIASIRE
FT                   NNFSFEKGRLKIKLAKSFGFCWGVERAVAMAYETRRHYPNEDIWMTNEIIHNPSVNNHL
FT                   SRMNVKIISAKNGIKDFSSVSTGDVVILPAFGATVQEMQLLHEKKCQIIDTTCPWVSKV
FT                   WHTVEKHKKHTFTSIIHGKYKHEETLATRSFAGNYLVVFDLDEAEYVSNYIQGHGDKNK
FT                   FMNKFAKACSDGFDPDVHLERIGVANQTTMLKSETEEIGKFFEKTMLMKYGPANINDHF
FT                   LAFNTICDATEERQDAMFSLVNEDLDILVVIGGFNSSNTTHLQEIAISNNIESFHIDIS
FT                   DRISVENNSICHKPLESELILKKNFIPDGKIKVGITSGASTPDKIVADVIEKLIAITQ"
FT   gene            274802..275362
FT                   /locus_tag="P9515_02981"
FT   CDS_pept        274802..275362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_02981"
FT                   /product="Predicted membrane protein"
FT                   /note="COG2259 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71507"
FT                   /db_xref="GOA:A2BUP6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUP6"
FT                   /protein_id="ABM71507.1"
FT                   /translation="MEDTTQSNQEKTAKMNASKAPQKVEVVVANPSSNSEVNILGELSI
FT                   FILRIGFSVLMIHHGLEKLQDPQGFAEFVVGKYFPFLPGDPVIWTFGAAITQLICPLGL
FT                   ALGVFARLCSLGLFSTMAFAVYFHLLDTGLEGFPLAVVEGHNYAFELSFVYGIISLYFL
FT                   CAGPGRLALLRKTNKITYYPKTN"
FT   gene            complement(275364..276917)
FT                   /gene="purH"
FT                   /locus_tag="P9515_02991"
FT   CDS_pept        complement(275364..276917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="P9515_02991"
FT                   /product="AICARFT/IMPCHase bienzyme:Methylglyoxal
FT                   synthase-like domain"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="COG138 AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful) [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_02991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71508"
FT                   /db_xref="GOA:A2BUP7"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUP7"
FT                   /protein_id="ABM71508.1"
FT                   /translation="MSPLALVSVSDKTNIIPFCKDLVEKFGYNILSSGGTAEYLTEAKV
FT                   PVLKVADFTESPEILDGRVKTLHPKIHGGILAKRSNEEHQREILENKLELIDLVVVNLY
FT                   PFKKKVEEQCPWEEAIENIDIGGPSMIRSAAKNHADVAVLVDPNQYQNYIEEIKKGPLS
FT                   KDFKTKLAFEAFQHTASYDSAISNWISKEKDLRPSNFIESYPLIKQLRYGENPHQKALW
FT                   YGLNNIGWNSAEQLQGKELSYNNILDLESALLTVLEFGYETKPNIKTESIAAVILKHNN
FT                   PCGASISNSASSSFKNALKCDSVSAFGGIVAFNANVDKETALILKDIFLECVVAPSFDK
FT                   EALEIFKTKKNLRVLKLTKEMLPKENQTCSKSIMGGILIQDSDNQENSEDSWISVTKKN
FT                   PTEQEYLDLKFAWKICKHVKSNAIVVAKDQQTLGIGAGQMNRVGASKIALEAAKEIDSG
FT                   GVLASDGFFPFADTVRLADKYGISSIIQPGGSIRDEESIKMCDSRGISMIFTHKRHFLH
FT                   "
FT   gene            276951..277568
FT                   /locus_tag="P9515_03001"
FT   CDS_pept        276951..277568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03001"
FT                   /product="probable esterase"
FT                   /note="COG400 Predicted esterase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71509"
FT                   /db_xref="GOA:A2BUP8"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUP8"
FT                   /protein_id="ABM71509.1"
FT                   /translation="MKYDINHEYVSISSQTAKHRIILIHGWGADAEDLLPIGQEIIEIS
FT                   NVDFEVLSLKAPSLHPNNVGRQWYGLYPPDWNKADDEVDQLLRSLRMLGTCNIPLEKTI
FT                   LLGFSQGGAMAIDVGCKLNVGLIVACSGYAHPNWEPNEKCPPILISHGLMDEVVPISAS
FT                   KYIYQKIKNVSHKFCELNEFDGYHQIDPNLIHSINLKIKELF"
FT   gene            complement(277565..277933)
FT                   /locus_tag="P9515_03011"
FT   CDS_pept        complement(277565..277933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71510"
FT                   /db_xref="InterPro:IPR021498"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUP9"
FT                   /protein_id="ABM71510.1"
FT                   /translation="MSKKRKRISRRRLAGQRVMAHVPIYHIETGKHKPVTAARRFIAEN
FT                   ALSAPSVFNVRRNEHTTDRFFWGEKGLFSAQYAEENHFLFPSLKVVVEGIGEEKIFEGL
FT                   ELTADDWEEIEEYEYAFV"
FT   gene            278189..279325
FT                   /locus_tag="P9515_03021"
FT   CDS_pept        278189..279325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03021"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="COG642 Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71511"
FT                   /db_xref="GOA:A2BUQ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUQ0"
FT                   /protein_id="ABM71511.1"
FT                   /translation="MKISQKFEDLTLKQLESFGCLMGVTQLVLYIASAKEGSKATFEMI
FT                   AQWPKVDKLLVSIDDDPTLKVSSPNRRWYPLQEKEILLGVLRVETDLNNGNWPLILDSR
FT                   LKALSISLAKCVSIEIERQNNNKEINVLKNQVDIVIHQLRNPLAAIRTYAKLLVKRLGS
FT                   DLGSIEIVESMMVEQNQINQYVDSFEQLNKPIKLLLDIGEERLLLPPNLDNGKKISIQD
FT                   LLLPILERGNANAKLENRAWIQPEIWPEWTLLAVKPRFMVISEIVANLLENAFKYANKD
FT                   AEIGIFITKRGLCIFDDGKKITKNENEKIFQKGFRGAASKKKEGTGVGLFLARKLAKQI
FT                   GGDLNIVDNSMKDNNEELNALKKKNIFYLELPIKELHL"
FT   gene            complement(279303..280004)
FT                   /gene="cobS"
FT                   /locus_tag="P9515_03031"
FT   CDS_pept        complement(279303..280004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="P9515_03031"
FT                   /product="Cobalamin-5-phosphate synthase CobS"
FT                   /EC_number="2.7.8.26"
FT                   /note="COG368 Cobalamin-5-phosphate synthase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71512"
FT                   /db_xref="GOA:A2BUQ1"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUQ1"
FT                   /protein_id="ABM71512.1"
FT                   /translation="MPFITPKFKNIAQFSPIIGFFIGLIQSLIYLILRNNSWSAYASVP
FT                   ICVASGYLITGGLHLDGLMDTFDGIFAGKNKCLKAMKDSQVGAFGVQSLFFITLMQIAC
FT                   LLKIQSQIISILPICLFWGRFSTLIFIDKFQYITLETKSIQHKKYWNGFKKESLVSLTF
FT                   IFIFIFYFLFLDKSADFIIKQIFLLLIGFFISYAIPKFLGSKIGGFNGDACGASVVLVE
FT                   TTMLFINAVLL"
FT   gene            280142..281260
FT                   /gene="tgt"
FT                   /locus_tag="P9515_03041"
FT   CDS_pept        280142..281260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="P9515_03041"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /note="COG343 Queuine/archaeosine tRNA-ribosyltransferase
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71513"
FT                   /db_xref="GOA:A2BUQ2"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUQ2"
FT                   /protein_id="ABM71513.1"
FT                   /translation="MFNFEVISSCSNTEARTGIFHTPHGQVRTPRFMPVGTLATVKGIS
FT                   SQQLKSTGSEMILSNTFHLHLQPGEKLIKEAGGIHEFMNWDKPVLTDSGGYQVFSLAKL
FT                   NNITNEGVEFKNPRDGSPVFLSPDKVMRIQMDLGSDIAMAFDHCPPHTATENDIQDSLN
FT                   RTHLWLENCVETHKKSNQALFGIVQGGRYPKLREISAKFTSSFGLPGIAVGGVSVGESV
FT                   EQIHNVINFVPKFLPKDKPRYLMGIGSLKEITLAIAKGFDLFDCVLPTRLGRHGTAFFN
FT                   DERWNIRNARFKNDFSPIDKTCKCETCKSYSRAYLHHLVRNDEILGLTLISLHNIAHLL
FT                   RFTNAISAAIKDNCFTIDFAPWKRSSIAHHTW"
FT   gene            281294..281434
FT                   /gene="psbK"
FT                   /locus_tag="P9515_03051"
FT   CDS_pept        281294..281434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbK"
FT                   /locus_tag="P9515_03051"
FT                   /product="Photosystem II protein PsbK"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71514"
FT                   /db_xref="GOA:A2BUQ3"
FT                   /db_xref="InterPro:IPR003687"
FT                   /db_xref="InterPro:IPR037270"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUQ3"
FT                   /protein_id="ABM71514.1"
FT                   /translation="MLTLLNTFAELPEAYKAFAPTVDVLPLIPLFFFLLVFVWQAAVGF
FT                   K"
FT   gene            complement(281450..282454)
FT                   /locus_tag="P9515_03061"
FT   CDS_pept        complement(281450..282454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03061"
FT                   /product="probable oxidoreductase"
FT                   /note="COG673 Predicted dehydrogenases and related proteins
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71515"
FT                   /db_xref="GOA:A2BUQ4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUQ4"
FT                   /protein_id="ABM71515.1"
FT                   /translation="MKPTSSSVKVGVIGIGNMGWHHARVLSLLKDADLVGVADPNENRG
FT                   KLAVEQFQCEWFKDYHELLSKVDAICIAVPTLLHHKVGLDCLKAGINVLIEKPIAANEL
FT                   EAKSLINASKVSNCLLQVGHIERFNPAFRELNKIVQNEEIVVLEARRHSPHADRANDVS
FT                   VVMDLMIHDIDLVLELVNSKIQKLAAVGGRNSEGLIDYVNATLVFNNNIIASLTASKMS
FT                   HKKIRSLSAHCQNGLVETDFLNHSLQIHRKAHESYTAEHGELVYRNDGYVEEVSTTSIE
FT                   PLYAELEHFLKCVQGKESPEVDGEQASRALKIADFIECAVENSGDAISLEIPF"
FT   gene            complement(282505..283773)
FT                   /locus_tag="P9515_03071"
FT   CDS_pept        complement(282505..283773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03071"
FT                   /product="Hemolysin-like protein"
FT                   /note="COG1253 Hemolysins and related proteins containing
FT                   CBS domains [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71516"
FT                   /db_xref="GOA:A2BUQ5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUQ5"
FT                   /protein_id="ABM71516.1"
FT                   /translation="MKITLLFLLLMFPAFFAASELSFLLIRPSKVLRLIEEKRKGAFSI
FT                   LKIQKRFISSLIASQFGVTISLIAIGWLSKGLANDFWNENKFSNRIYDLLMFLFIVLIV
FT                   TLISGLIPKALVINNPESAALRLTTIFDAVRKGMQPIVSVIEFFASACLRLFHLNNKWD
FT                   SLNSVLSAGELETLIETDNVTGLKPDEKNILEGVFALKDTQVKEVMIPRSEMVTLPKNI
FT                   TFAELMKQVDKTRHARFFVIGESLDDVLGVLDLRYLAKPISKSEMEANTLLEPFLLPVT
FT                   KVIETCSLAEILPLVRDYNPFLLVVDEHGGTEGLITAADLTGEIVGEERLSSRIYSDMK
FT                   MLDNFSRKWSIAGKAEIIEINKKLGCFLPEGADYHTLAGFLLEKFQMVPKIGDSLDFKN
FT                   IKFEIISMSGPKIDRVKIFLPKS"
FT   gene            complement(283789..283864)
FT                   /locus_tag="P9515_tRNAMetVIMSS1309116"
FT                   /note="tRNA-Met"
FT   tRNA            complement(283789..283864)
FT                   /locus_tag="P9515_tRNAMetVIMSS1309116"
FT                   /product="tRNA-Met"
FT   gene            284003..284581
FT                   /gene="pyrE"
FT                   /locus_tag="P9515_03081"
FT   CDS_pept        284003..284581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="P9515_03081"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="COG461 Orotate phosphoribosyltransferase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71517"
FT                   /db_xref="GOA:A2BUQ6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUQ6"
FT                   /protein_id="ABM71517.1"
FT                   /translation="MNNFSQENNLNKKNLLKLLIEKSYKKGNFILASGKESAHYLNCKP
FT                   VSLNGKGLQLISNLFLELMDPSSKAVAGLTLGADPLVSGVILTAASKGLLLDALIIRKE
FT                   TKEYGTKAGLEGPTLKEETVVTVLEDVVTTAGSAIKAIKKLRENNFIVKEVLSIVDRKE
FT                   GGYEALKEHNIQLKSLFSIEDFLMNNVQN"
FT   gene            284568..285416
FT                   /locus_tag="P9515_03091"
FT   CDS_pept        284568..285416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03091"
FT                   /product="aminomethyltransferase GcvT-like protein"
FT                   /note="COG354 Predicted aminomethyltransferase related to
FT                   GcvT [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71518"
FT                   /db_xref="GOA:A2BUQ7"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUQ7"
FT                   /protein_id="ABM71518.1"
FT                   /translation="MSKINVKKDQIWLEKFDCFSITGKDSKRFLNGITTGNIVNLNNNV
FT                   LQTCWLSPNGILKSLLEINCLENKLDVIVFVGNTSEIRKYFNEIIFPSDDVLLSDTFSI
FT                   NRLQHVDDINSWRVTQPIFFHNKDKEYAFYNNNPNLMNTNDLQSWKINQAIPSLDSEIN
FT                   GKNNPLELGLADLVDFNKGCYLGQETMSKIRNVSSLKQEIRVWTAKDRVINIESDSKKI
FT                   YNNQNKEKTVGYITSIYKSDSLTTKGLALIKRKYLDKENSFFSDKFGQISIDKSVGSTF
FT                   L"
FT   gene            complement(285417..286757)
FT                   /locus_tag="P9515_03101"
FT   CDS_pept        complement(285417..286757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03101"
FT                   /product="Predicted nuclease (RecB family)"
FT                   /note="COG2251 Predicted nuclease (RecB family) [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71519"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUQ8"
FT                   /protein_id="ABM71519.1"
FT                   /translation="MHKIWSPHLSIEIINRYKNFYKISNGDLYTGTKACKKGSRGVIGL
FT                   KARSKLTNNINAEIQPQLLKKVVGHSKWGDYKYIPVMYKLGHRTTKEHLFDLAFCSILL
FT                   EPFQESKIEAGLVISNYSNQINIERIDLNQRLRKKVLSTFLNLNETLKRSIPDITEDRK
FT                   KCTICSWQKFCDTEAKDNGYLTDIDGIGSKTAFLLHKSGISNIKELATAREIDLGEKLN
FT                   QFKDQKFEKASKFINQSKAYLSGTPIRIFESDNLSSLLSKKDSGFFMFDIESNPDEKHD
FT                   FLYGFLKVNNLFENVKDDFYDPILNLKKNCKKSNQEIIQKLLSEKSWPVLHYGETEKIA
FT                   ILKLARQLNLDVKEIEILKSRFIDLHLIVRGSWILPIRNYSLKTVANWMGFKWRQKNVS
FT                   GSKALYWWIQYKNTLNDLFLKKIIQYNRDDCMATLQIAKWLIKKRNY"
FT   gene            286911..288371
FT                   /locus_tag="P9515_03111"
FT   CDS_pept        286911..288371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03111"
FT                   /product="Phosphotransferase superclass"
FT                   /EC_number="5.4.2.8"
FT                   /EC_number="5.4.2.2"
FT                   /note="COG1109 Phosphomannomutase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71520"
FT                   /db_xref="GOA:A2BUQ9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUQ9"
FT                   /protein_id="ABM71520.1"
FT                   /translation="MSENELDKIKFGTDGWRGIIGFDFNLSNLSRVVVASCQELDYQYF
FT                   DETKSKKILIGYDRRFMASEFANEIASYVKGCGFEPVLSHTYVPTPACSLYAKHNMFLG
FT                   CLVITASHNPYNWLGLKIKSFKGCSVDESFTKEVEKRLLLENSIERLEGPYDKVDIKKF
FT                   HLDQIKSNFNIDFIVNNLKKMNLHIFVDSMHGSAANCISQIFDSYDSNIFTEIRANYDP
FT                   LFGGNPPEPLLKYLENLSEILITNSKKGIKTLGIIFDGDGDRIAVIDEKGRFCSTQVLL
FT                   PFFISYLGEKNKNLFPVLKTVSGSDIIGNIAKNQNREVVELPVGFKYIAKKMINEEIFI
FT                   GGEESGGVGFGDFMPERDALYAAMVLLNGIAEKSKYLCETLDEIQQKFGPSFYRRIDIK
FT                   FPNQSEKEIFKKFINNNIPSEICGHKIISISHVDGIKLRLDNNFWLLFRFSGTEPLLRL
FT                   YCEATSEYDLNEVLQWSQKFINRVKQNQ"
FT   gene            288368..288943
FT                   /locus_tag="P9515_03121"
FT   CDS_pept        288368..288943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03121"
FT                   /product="Xanthosine triphosphate pyrophosphatase"
FT                   /EC_number="3.6.1.15"
FT                   /note="COG127 Xanthosine triphosphate pyrophosphatase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71521"
FT                   /db_xref="GOA:A2BUR0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUR0"
FT                   /protein_id="ABM71521.1"
FT                   /translation="MKILYLASKNFGKIKEYKKLLSNVNCQLLLQPESIEVEENGNTFR
FT                   ENAIKKACEVSKKTGNYAIADDSGICIDALDGKPGIYSSRYAENDQRRIERVLKELDGE
FT                   KNRCAFFIANVCVCSPSGDLILESEAKCFGNIIEKPRGNSGFGYDPIFEEVSSRLTFAE
FT                   MNNELKDECSHRGKALKKIIPQLLEIFA"
FT   gene            complement(288944..290431)
FT                   /locus_tag="P9515_03131"
FT   CDS_pept        complement(288944..290431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03131"
FT                   /product="Retinal pigment epithelial membrane protein"
FT                   /EC_number="1.13.11.43"
FT                   /note="COG3670 Lignostilbene-alpha,beta-dioxygenase and
FT                   related enzymes [Secondary metabolites biosynthesis,
FT                   transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71522"
FT                   /db_xref="GOA:A2BUR1"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUR1"
FT                   /protein_id="ABM71522.1"
FT                   /translation="MTYIQDKQIKTNQAFNKEDWSSAYKNVETELTNESLKITKGENIV
FT                   ELNGTLLRNGPGILERGGQWVHHPFDGDGMITAINFKNGKPSLTNKFVRTKGYIEETKI
FT                   NKFVYRGVFGTQKSGGILNNALDLKFKNIANTHVVKLGNEVLALWEAAGPHALEPSNLD
FT                   TKGLTTLNGVLKANEAFSAHPKADFNSNYSSEVMVTFGVQTGPKSTIRLMEFSNAGENS
FT                   GELIFDRKDTFNGFAFLHDFAITTNWAIFLQNAIDFNPLPFVMGQKGAAQCLKSNPNKK
FT                   AKFFIIPRESGLFKGQPSITIDAPEGFVFHHVNAFEKDSNIILDSIFYDDFPSVGPDEN
FT                   FRDIDFDQYPAGNLKRSIIDLKGKKSQFETLSTQTCEFATVNPKFLGLKATHSWMACTD
FT                   KKTGNAPLQAIKKINLTTKEEIYWSAAPSGFVSEPIMVPSQISNKEDDGYLFVLIWNGS
FT                   RRGSDLVILDANDLKELAIYELPISIPHGLHGSWVNN"
FT   gene            complement(290512..291117)
FT                   /locus_tag="P9515_03141"
FT   CDS_pept        complement(290512..291117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03141"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="COG131 Imidazoleglycerol-phosphate dehydratase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71523"
FT                   /db_xref="GOA:A2BUR2"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUR2"
FT                   /protein_id="ABM71523.1"
FT                   /translation="MSSSRQAEIKRKTNETDISIFINIDGNGISEIDTGIPFLDHMLHQ
FT                   ISSHGLFDLKIRAIGDTHIDDHHTNEDVGIALGKAFTKALGERKGINRFGHFFAPLDEA
FT                   LVQVTLDCSGRPHLSYGLKLKAPRIGNYDTELVREFFIAFVNSSGITLHINQIEGRNSH
FT                   HIVEACFKAFSRSMRMATEIDLRRSGTIPSSKGMLEID"
FT   gene            complement(291139..291921)
FT                   /gene="fabI"
FT                   /locus_tag="P9515_03151"
FT   CDS_pept        complement(291139..291921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="P9515_03151"
FT                   /product="enoyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.3.1.10"
FT                   /EC_number="1.3.1.9"
FT                   /note="COG623 Enoyl-[acyl-carrier-protein]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71524"
FT                   /db_xref="GOA:A2BUR3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUR3"
FT                   /protein_id="ABM71524.1"
FT                   /translation="MLLNLTGKKILVTGIANNRSIAWGIAQQLSKAGAELGITYLPDEK
FT                   GRFESKVRELTKDLKPSLFLPLDVQNPSQIEEIFENIKNNWGQIDGLVHCLAFAGRDEL
FT                   IGDYSATSSEGFDRALNISAYSLAPLCKAAKPLFSDGAGVVSLTYLGSERAIPNYNVMG
FT                   VAKAALEASVRYLSAELGPERQVRVNAISAGPIRTLASSAIGGILDMIHNVEEKAPLRR
FT                   TVTQTEVGNTAAFLLSDLASGISGQTIYVDAGYCINGM"
FT   gene            292023..292616
FT                   /locus_tag="P9515_03161"
FT   CDS_pept        292023..292616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71525"
FT                   /db_xref="GOA:A2BUR4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUR4"
FT                   /protein_id="ABM71525.1"
FT                   /translation="MVKTNSMYLELGTQLPFFEMINVNSSNQEKYNFSRLDNRHLLLMF
FT                   ICAHCPFVKYIENHISVLSADIEDQVQTIAISSNDIVTHPSDSPENLRNQAKLQGWTFP
FT                   YLYDERQVFAKKLKAACTPDFYLFSNAGNKKFPLFYHGQLDSSRPSNDIPITGEDLRAA
FT                   VQELNKNSNYPNPQQPSLGCNIKWTPGGEPDWFK"
FT   gene            292661..293875
FT                   /gene="degT"
FT                   /locus_tag="P9515_03171"
FT   CDS_pept        292661..293875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degT"
FT                   /locus_tag="P9515_03171"
FT                   /product="putative pleiotropic regulatory protein"
FT                   /note="COG399 Predicted pyridoxal phosphate-dependent
FT                   enzyme apparently involved in regulation of cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71526"
FT                   /db_xref="GOA:A2BUR5"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUR5"
FT                   /protein_id="ABM71526.1"
FT                   /translation="MINMQIPPFTLERQFKEIGSDIEDAVLKVLKGGQYVGGHEISRFE
FT                   ENFASLIGVNHAIGCNSGTDALILALRALDIGEGDEVITSSFSFFATAEAISAVGANPV
FT                   LVDINPTNYLINIDLIEREINSNTKAIMPVHLFGNAVNMKSIKVLAKKYDLKIIEDCAQ
FT                   ATCTLWGNSKVGSIGDIGCFSFFPTKNLGAAGDGGAVTTSDYNIARKVRELAVHGSPKR
FT                   YHHTQIGYNSRLDTLQAAVLNIKLKSLSKWISNRQKIANNYFELLEENSFLHFPMIDFD
FT                   SISHSWNQFVIRLKNYNYDINNNYSNLFETDFNKNNSLRNLLKLRLSEKGINSIIYYPI
FT                   PIHAQIAYKNINFSREKLINTEIVCTEVLSLPMYPEISYEEQVYVSKNFNIILKKCIDE
FT                   LQICA"
FT   gene            complement(293860..295296)
FT                   /gene="phrB"
FT                   /locus_tag="P9515_03181"
FT   CDS_pept        complement(293860..295296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="P9515_03181"
FT                   /product="putative DNA photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="COG415 Deoxyribodipyrimidine photolyase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71527"
FT                   /db_xref="GOA:A2BUR6"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUR6"
FT                   /protein_id="ABM71527.1"
FT                   /translation="MNNPRILFWHRKDLRIYDNNALSKAFSLSNAITSTYIFDQNYSQD
FT                   FNANSRAWFLGNSLQELSRNWETLGSRMIIDEGNPLTLIPKLAQLIDAKFVAWNKAIEP
FT                   YEINRDLEIKNTLKKFKIEIIELWDHLLLEPSQIHTGSNKPYTVYGPFYKKLKSKLQLL
FT                   TSKKNLNNIGKLKDLEIGIKESQKIDSSRLILEKFIKKVNFDGINLCPCKPGEIAAEKL
FT                   LDQFINQDKIGSYASSRDFPDQNGTSFLSASLRFGTISIRKVWNSTLFTDLKNKNNHNK
FT                   ISIETWQKELVWREFYQHCLFHFPELEKGPYRKKWDHFPWQNNHEWFDRWSNGETGVPI
FT                   IDAAMRQLNSTGWMHNRCRMIVASFLVKDLICNWQMGEEKFMKVLVDGDLAANNGGWQW
FT                   SASSGMDPKPLRIFNPYTQTKKFDPICKYIKFWIPELSKVPNKDILNGEISDLEKNNYY
FT                   GAIVNHNTQQRLFKDLYAHI"
FT   gene            complement(295296..295856)
FT                   /locus_tag="P9515_03191"
FT   CDS_pept        complement(295296..295856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03191"
FT                   /product="NUDIX hydrolase"
FT                   /EC_number="3.6.1.13"
FT                   /note="COG494 NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes [DNA replication, recombination, and
FT                   repair / General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71528"
FT                   /db_xref="GOA:A2BUR7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUR7"
FT                   /protein_id="ABM71528.1"
FT                   /translation="MDDNIHFKKAIFKEKISELKTKKFSFEINRIELPNGHEDEYGQII
FT                   FPNAALAVPITNENKVILLRQYRFAVSRYLLEFPAGTLEIGETPINSIKREIQEEAGYK
FT                   AEKWDKLGALVNAPGYSDEVIHLFLARDLSKLKNKVKGDLDEDIEVLLMDPQNLDNLIS
FT                   CGDEVLDAKTVTAWFRAKQFLGI"
FT   gene            complement(295902..296480)
FT                   /gene="folK"
FT                   /locus_tag="P9515_03201"
FT   CDS_pept        complement(295902..296480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="P9515_03201"
FT                   /product="possible
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71529"
FT                   /db_xref="GOA:A2BUR8"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUR8"
FT                   /protein_id="ABM71529.1"
FT                   /translation="MFFLVELSNLNIKNGLCISLGANIDSNYGKPIETFIICKPKIETL
FT                   IKSWINQSKYCNKETESSETIFYWSSIYESSPHGVKDNQPNYLNTLVLVKSNSFPKQTT
FT                   ENAKFLLREFKNLERNFGRKKTPNNMKWLSRCLDLDILWWEDFCFKDEELILPHPRFMN
FT                   RNFIISPLSEVLSRTQTVKKVEEERWLVD"
FT   gene            296517..298682
FT                   /gene="chlD"
FT                   /locus_tag="P9515_03211"
FT   CDS_pept        296517..298682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlD"
FT                   /locus_tag="P9515_03211"
FT                   /product="Protoporphyrin IX Magnesium chelatase, ChlD
FT                   subunit"
FT                   /EC_number="6.6.1.1"
FT                   /EC_number="6.6.1.2"
FT                   /note="COG1239 Mg-chelatase subunit ChlI [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71530"
FT                   /db_xref="GOA:A2BUR9"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011776"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUR9"
FT                   /protein_id="ABM71530.1"
FT                   /translation="MILEKKLKGKEDIKDLMKKKDSFRAFPLAAITGHSLLKLSLLLSA
FT                   VDPSLGGVVIAGGRGTGKSVLARGLHSLIPPIEVIDNESILEKLRDNKTSLRPISRNLD
FT                   PTKPEEWDENIHELIANMFGDDYLNQIENIPKKIIQAPFIQVPIGITEDRLVGSIDVAA
FT                   SLNTGEQVFQPGILAEAHRGVLYVDDINLLDDGIVNLILEATGREQNNIERDGLSLSHP
FT                   CRSLLIATYNPEEGALRDHVLDRFAIVLSADQSIDNDQRVEITKSVLSHAENNIKFSEK
FT                   WSDESDNLSTQLILARQWLNDVKITEEQITYLVNEALRGGVEGHRSELFAVKVAKANAA
FT                   LRGDENVNSDDLKVAVRLVILPRAMQIPPEDEDIQPPPPEDQNPPPPQSSNEESEPESN
FT                   ENENDQEQEQQEDNSEGDEDATSEIPEEFILDPEACMVDPDLLLFSSAKSKAGNSGSRS
FT                   VILSQSRGRYVRPLIPKGKVERIAVDATLRAAAPYQKSRRLKNPGKTIIIEENDFRAKL
FT                   LQKKAGALVIFLVDASGSMALNRMQSAKGAVIRLLTEAYENRDEVALIPFRGNQAEVLL
FT                   PPTRSITAAKRRLETMPCGGGSPLAHGLTQSAKVAKNALSTGDIGQVIVVGITDGRGNV
FT                   PLGISLGQVENENEDENVNLKQEVLDIAAKYPMLGIKLLVIDTERKFIASGFGKELAEA
FT                   AKGKYVQLPKATDKTIAAMALNAINEF"
FT   gene            complement(298687..299532)
FT                   /locus_tag="P9515_03221"
FT   CDS_pept        complement(298687..299532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03221"
FT                   /product="possible ABC transporter"
FT                   /note="COG1463 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71531"
FT                   /db_xref="GOA:A2BUS0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR039342"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUS0"
FT                   /protein_id="ABM71531.1"
FT                   /translation="MRRSLRDSIVGFSLLGGILIFTFFSFWLRGVKLSSKNWYLFAEFN
FT                   NASGLSKKSPVTYRGILVGSIEDILFTNESIKAKIVLNNPEIILPKPAFAKVVTNSFLG
FT                   GDVQVSLETSQKTIPKDIAKAISEECDSELIVCQGDTITGKQLSSLSNITNRINQILKE
FT                   SNQENLIENVVNSIDQFDKTQENLDELIYLSKQEILRVKPLIKEVTVAAGHLNSILSAI
FT                   DNEDTLKDIKLTINAAESISGKLDNMSDDFEGLMKDKELTKSLRDLTIGLSKFLNEIYP
FT                   "
FT   gene            complement(299538..300323)
FT                   /locus_tag="P9515_03231"
FT   CDS_pept        complement(299538..300323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03231"
FT                   /product="possible ABC transporter, ATP binding component"
FT                   /EC_number="3.6.3.30"
FT                   /note="COG1127 ABC-type transport system involved in
FT                   resistance to organic solvents, ATPase component [Secondary
FT                   metabolites biosynthesis, transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71532"
FT                   /db_xref="GOA:A2BUS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUS1"
FT                   /protein_id="ABM71532.1"
FT                   /translation="MKNSKPAVETNNLSISWGDQNVLDKVNLKLNEGEKLAIIGPSGSG
FT                   KSTILKILAGLILPNEGELSIFGEKQTYLRLDQTHPPDVRLVFQNPALLGSLTIEENVG
FT                   FILQRNKNLSKQSIREIVRECLQEVGLFDVEEKLPNELSGGMQKRVSFARALITEQDLD
FT                   KKNKPLLLFDEPTAGLDPIASSRIEDLINKTNNKANGSSIVVSHVLSTIERTSEKVVIL
FT                   YGGKFRWAGSIDEFKESNDPYVFQFRNGNLNGPMQPKEI"
FT   gene            300457..301842
FT                   /locus_tag="P9515_03241"
FT   CDS_pept        300457..301842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03241"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG391 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71533"
FT                   /db_xref="GOA:A2BUS2"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUS2"
FT                   /protein_id="ABM71533.1"
FT                   /translation="MKKRKKRVKRTLSYFKKSNLGLINRIIRILSWLLPGLVIKRWMIT
FT                   SAIGLLTSLLGIVIWTNLRPLYWLIAVFFWIIDQLTSILPISILGPLIFIFGLLLIGIG
FT                   QNRSINSIQKALVPEKNTFLVDALRVKSKLNRGPNIVAIGGGTGLSTLLKGLKNYSSNI
FT                   TAIVTVSDDGGSSGVLRKQLGVQPPGDIRNCLAALSNEEPILTRLFQYRFSGGSGLEGH
FT                   SFGNLFLSALTTITGSLEKAVQASSKVLAVQGQVLPATNIDVMLWAELEDGQKIFGESN
FT                   ISQSKKMISRIGYLPENPSALPSALESIKEADLIVLGPGSLYTSLLPNLLVPEIVDALL
FT                   KSNAPKIYISNLMTQPGETDGLDVYQHIKAIEKQLLNFGVKTRIFNAILSQIQFEKSPL
FT                   VDYYQSRGAIPVVCNKEKLISEGYYVLQAPLYSRKITPTLRHDPRRLARAVMFINKKLK
FT                   KLN"
FT   gene            complement(301848..302378)
FT                   /gene="ndhJ"
FT                   /locus_tag="P9515_03251"
FT   CDS_pept        complement(301848..302378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhJ"
FT                   /locus_tag="P9515_03251"
FT                   /product="putative respiratory-chain NADH dehydrogenase
FT                   subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG852 NADH:ubiquinone oxidoreductase 27 kD subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71534"
FT                   /db_xref="GOA:A2BUS3"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUS3"
FT                   /protein_id="ABM71534.1"
FT                   /translation="MDQNNLSKSSEEIVEQRGIVSNRLYKDGITNNSLGNDHIGVELLS
FT                   VKPEKLYEAISSLKKYGFNYLQCQGGYDEGPGKRLVSFYHLISLQDIEELEEIKEIRVK
FT                   VFLNRDSDLSVPSLYKIFKGSDWQERETYDMYGINFQDHPNPKRILMPEDWRGWPLRKD
FT                   YIQPDFYELQDAY"
FT   gene            complement(302378..303112)
FT                   /gene="ndhK"
FT                   /locus_tag="P9515_03261"
FT   CDS_pept        complement(302378..303112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhK"
FT                   /locus_tag="P9515_03261"
FT                   /product="putative respiratory-chain NADH dehydrogenase
FT                   subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG377 NADH:ubiquinone oxidoreductase 20 kD subunit
FT                   and related Fe-S oxidoreductases [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71535"
FT                   /db_xref="GOA:A2BUS4"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUS4"
FT                   /protein_id="ABM71535.1"
FT                   /translation="MNNSLSPKAIRELREETCNPLGAPQVTTDLSENIIMTSLDDLHNW
FT                   ARLSSLWPLLYGTACCFIEFAALIGSRFDFDRFGLVPRSSPRQADLLIVAGTVTMKMAP
FT                   ALVRLYEQMPEPKYVIAMGACTITGGMFSADSTTAVRGVDKLIPVDLYLPGCPPRPEAI
FT                   FDAVIKLRKKVGNESILERNKAEQTHRYLTVKHDMKLVFSENTGEYLNKKSEKAIKSSD
FT                   LEMIEENIKVKIEENLIDEETK"
FT   gene            complement(303117..303479)
FT                   /gene="ndhC"
FT                   /locus_tag="P9515_03271"
FT   CDS_pept        complement(303117..303479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhC"
FT                   /locus_tag="P9515_03271"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 3)"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG838 NADH:ubiquinone oxidoreductase subunit 3
FT                   (chain A) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71536"
FT                   /db_xref="GOA:A2BUS5"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUS5"
FT                   /protein_id="ABM71536.1"
FT                   /translation="MFSLPGYEYFLGFLIIAAAVPILALVTNLIVAPKGRTGERKLTYE
FT                   SGMEPIGGAWIQFNIRYYMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAIL
FT                   VIALAYAWRKGALEWS"
FT   gene            303553..303981
FT                   /gene="rub"
FT                   /locus_tag="P9515_03281"
FT   CDS_pept        303553..303981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rub"
FT                   /locus_tag="P9515_03281"
FT                   /product="probable rubredoxin"
FT                   /note="COG1773 Rubredoxin [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71537"
FT                   /db_xref="GOA:A2BUS6"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUS6"
FT                   /protein_id="ABM71537.1"
FT                   /translation="MSENIQPSSDDKQIVEDLAKEESSEKLPKLNNKELTINLEQNRFE
FT                   CRSCGYIYDPIEGNKKLNIPKNTPFSLIDGNIFACPVCRAGKNLYKDIGPREKPSGFEE
FT                   NLTYGFGFNSLPPGQKNILIFGGLAFAAACFLSLYSLH"
FT   gene            303991..305004
FT                   /locus_tag="P9515_03291"
FT   CDS_pept        303991..305004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03291"
FT                   /product="Uncharacterized protein plant photosystem II
FT                   stability/assembly factor-like protein"
FT                   /note="COG4447 Uncharacterized protein related to plant
FT                   photosystem II stability/assembly factor [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71538"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016705"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUS7"
FT                   /protein_id="ABM71538.1"
FT                   /translation="MKNFLISIPNLILSLTLCLVLTSCSSNGVKMSESSPWETIQFEDQ
FT                   SNALDVDFIDNNHGFLVGSNRLIMESKDGGRSWEKRSLDIPAEENFRLLDIDFKGSEGW
FT                   LIGQPSLVMHTIDEGKNWTRLSLGKLPGQPFLVSTINEGVAQLATTSAAIYETSNSGET
FT                   WEAKVSDPSEQGGIRDLRRTSKGDYVSVSSLGNFFSTLDSGSDTWIAHQRASSKRVQSI
FT                   GFNPSGNLWMLSRGAEIRFNEDINDVEKWSKPIVPILNGYNYLDMGWDPDGNIWAGGGN
FT                   GTLIVSKDDGKTWNSDPIASDLPTNFIKIQFLAKDELDSPKGFILGERGYILKWNG"
FT   gene            305128..305376
FT                   /gene="psbE"
FT                   /locus_tag="P9515_03301"
FT   CDS_pept        305128..305376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbE"
FT                   /locus_tag="P9515_03301"
FT                   /product="Cytochrome b559 alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71539"
FT                   /db_xref="GOA:A2BUS8"
FT                   /db_xref="InterPro:IPR006217"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="InterPro:IPR013082"
FT                   /db_xref="InterPro:IPR037025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUS8"
FT                   /protein_id="ABM71539.1"
FT                   /translation="MAAGSTGERPFFEIITSIRYWIIHAVTLPAIFIAGFLFVYTGLAY
FT                   DAFGTPRPDSYFQASESKAPVVTQRYDAKSQLDLRTK"
FT   gene            305379..305525
FT                   /gene="psbF"
FT                   /locus_tag="P9515_03311"
FT   CDS_pept        305379..305525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbF"
FT                   /locus_tag="P9515_03311"
FT                   /product="Cytochrome b559 beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71540"
FT                   /db_xref="GOA:A2BUS9"
FT                   /db_xref="InterPro:IPR006216"
FT                   /db_xref="InterPro:IPR006241"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUS9"
FT                   /protein_id="ABM71540.1"
FT                   /translation="MSNSQAPMQAVEVRVYPIFTVRWLAVHALAIPSVFFLGAIAAMQF
FT                   ISR"
FT   gene            305537..305656
FT                   /gene="psbL"
FT                   /locus_tag="P9515_03321"
FT   CDS_pept        305537..305656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbL"
FT                   /locus_tag="P9515_03321"
FT                   /product="photosystem II PsbL protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71541"
FT                   /db_xref="GOA:A2BUT0"
FT                   /db_xref="InterPro:IPR003372"
FT                   /db_xref="InterPro:IPR037266"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUT0"
FT                   /protein_id="ABM71541.1"
FT                   /translation="MQVNENPNKVPVELNRTSLYLGVLSVLVLGILFSSYFFN"
FT   gene            305666..305860
FT                   /gene="psbJ"
FT                   /locus_tag="P9515_03331"
FT   CDS_pept        305666..305860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbJ"
FT                   /locus_tag="P9515_03331"
FT                   /product="photosytem II PsbJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71542"
FT                   /db_xref="GOA:A2BUT1"
FT                   /db_xref="InterPro:IPR002682"
FT                   /db_xref="InterPro:IPR037267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUT1"
FT                   /protein_id="ABM71542.1"
FT                   /translation="MSKLKGPDGRIPDRLPDGRPAVAWERRWTEGTLPLWLVATAGGIA
FT                   VIFVLGIFFYGSYQGVGAG"
FT   gene            complement(305898..306797)
FT                   /locus_tag="P9515_03341"
FT   CDS_pept        complement(305898..306797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03341"
FT                   /product="5'-methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="COG5 Purine nucleoside phosphorylase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71543"
FT                   /db_xref="GOA:A2BUT2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUT2"
FT                   /protein_id="ABM71543.1"
FT                   /translation="MNKQHLLPIKESRLGVIGGSGFYSIDKIECHEEFEVNTPYGKPSD
FT                   SIRLFKIGNLEIAFIARHGRTHSLNPTDIPYKANIWALRSIGVRWIIAPSAVGSLQEQI
FT                   RPLDIVIPDQFIDRTHKRPTTFFNEGAVAHVTMGDPFCRNLSEILANVGEKTIPGGRQL
FT                   HRGGTYLAMEGPAFSTRAESNLYRSWGCSIIGMTNHTEARLAKEAEIAYSSLSMVTDYD
FT                   CWHQTHQEVSVEMVLENLRTNTEVANKIVFEIAKVIDRDRPKSKSHFSLKDGLITPKEN
FT                   IPSSTKEKLKILTDIYWS"
FT   gene            306808..308976
FT                   /locus_tag="P9515_03351"
FT   CDS_pept        306808..308976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03351"
FT                   /product="Selenide,water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /note="COG1252 NADH dehydrogenase, FAD-containing subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71544"
FT                   /db_xref="GOA:A2BUT3"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR030805"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUT3"
FT                   /protein_id="ABM71544.1"
FT                   /translation="MTINHLVLIGGGHTNVLLMRKWLMNPKLMPEIPISIISRDTDLVY
FT                   SAMFPSVISKSISLNDSLIDIRSLAKKAKISFIQNEVLNIDFHLKKICLKNRPSIGYSK
FT                   LVLNYGSQTKISGEFEDLVNNQIAFPIKPFFKAYELIKNEDKNDSEPEKPFIIVGSGLA
FT                   AIEIAFALRKRWEKRSLKILCKTYKIDTKISKSLYRSNIELVKSLPVDYGKILLCTGNS
FT                   SPLWVQSYNSELDSKGRFLTNQNLRLKNFSGIFATGDCAVIETSKRPSSGIFAVKALNI
FT                   LAANIQQDIKGKSLKRWYPQKIGLQIVNSYPRKIPKAFAFYGDVVFGPSFFLWYLKNKI
FT                   DEGFIKKFRILEPKMNHKIREGEEMDCRGCAAKIPQNILNKSLRSAQLENFATSPEDAV
FT                   QIYNNNQETILQSVDGFPALISDPWLNAKITVLHACSDLWACGAKLSSVQALISLPKVG
FT                   KDFQSYLFTHCLKGIKTTVEEQGGELIGGHTFESRSLVDKPYSLGIDISLTVQGVLRNG
FT                   AKPWFKSGMQKGDILLMSRPLGVGIFFAAQMQNINLKDSSEEIMKNLVKSQQPLIEQIY
FT                   FLQDKFGETFINAATDITGYGFMGHLKEMIDSSNLSRKDNNLEPINVLLDLLAFKAYPG
FT                   VFELIRKGVKSSLFESNKEIIDQILSEKPKNRIISFSKKNKVNSESFKEKISLLLDPQT
FT                   CGPLLISCDPKYESFLNDEWYKVGEVIN"
FT   gene            complement(308980..310227)
FT                   /locus_tag="P9515_03361"
FT   CDS_pept        complement(308980..310227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03361"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /note="COG617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71545"
FT                   /db_xref="GOA:A2BUT4"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUT4"
FT                   /protein_id="ABM71545.1"
FT                   /translation="MNDISAHINQSILKIPFDLFNIISNYIKLHSNVKVAIVGGYIRDL
FT                   LINKIHKKTFFSPIDIDIVTEGSSVDLAKFIKKNISNVELCLIKEFEIYDTVELNINNL
FT                   KIDIASARKETYEAPGLNPIVQHTSIEEDLKRRDFSINAIAFEFSKQEIYDYFDGIKHI
FT                   KEKELHLLHENSIQDDPSRIIRCARYASRLGFKISKKSLKQSQDTVKRWPWAVINDDTK
FT                   SRFPPGISIRIRMELSEIYKYDNLAKIVSLLNDWEVISILNKNISIDNKFLRGLKWIKK
FT                   LKGNYILYLLKNSENFELTCQRFFINSKEKKILKDYLNISNQLENEKEKFLYLTPSNWT
FT                   EFIETKNLDEETVKLLICNGGEFWKSFFRWLFIYKFIKSKKSGASLKSEGWHPGQEMGN
FT                   EIKRLRYIEIDKIKRN"
FT   gene            complement(310235..312643)
FT                   /gene="uvrD"
FT                   /locus_tag="P9515_03371"
FT   CDS_pept        complement(310235..312643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="P9515_03371"
FT                   /product="UvrD/REP helicase"
FT                   /note="COG210 Superfamily I DNA and RNA helicases [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71546"
FT                   /db_xref="GOA:A2BUT5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUT5"
FT                   /protein_id="ABM71546.1"
FT                   /translation="MSQTHNFLFNSLNNAQLKAVNHINGPLLVVAGAGSGKTKALTHRI
FT                   ANLIENHSVDPHNILAVTFTNKAAKEMKARLQVLLAQELAFNQFGQPWATLKEFDQNQL
FT                   RTNIDQERLKDLWIGTFHSLFSRLLRYDIEKYQDPEGLRWTRQFSIYDETDSQTLVKEI
FT                   ISQDMSLDPKRFDPKKIKRAISNAKNQCFTAKELEEKADNHFDKVIADAYRRYKISLSK
FT                   NNALDFDDLLLLPVFLLRQNDLVRDYWHKRFQHVLVDEYQDTNRTQYELIKLITAGNTK
FT                   PNKFCEWNNRSIFVVGDADQSIYSFRAADFRILIGFQEDFKGPSNNDKKASLVKLEENY
FT                   RSSSNILNAANSLIENNTERIDKVLKPTKEEGELLKLLSCDDEISEAEAITTKLRSLNN
FT                   YNNQPIWRNFAILYRTRAQSRVLEESLVRWRIPYTIFGGLRFYDRREVKDAVAYLKVLV
FT                   NSSDNVSLLRIINVPRRGIGKTTIQKLSDLSIKLNIPLWEVINDKQSLDETIGRSSKGI
FT                   NKFTDLMNDLLCYVENSGPAQILQLILEKSGYLNELLRSGSEESEDRRNNLQELINAAT
FT                   QFEEETENANVEGFLSTAALTTDNDTKKNHPNSVTLMTLHNSKGLEFQNVFITGLEQGL
FT                   FPSHRSIDTPSLLEEERRLCYVGITRAKERVFLSHARERRLWGGMREPTIPSIFLSEIP
FT                   EELIDGELPQSGGASIRRDRHLDRLTRVDRNNSNEFLNKPINAVRKLYSGPSKGKSWII
FT                   GDKVIHSKFGKGEIIHIFGSGEKISLAVKFGDKGSKILDPRLAPIRAIN"
FT   gene            complement(312680..312880)
FT                   /locus_tag="P9515_03381"
FT   CDS_pept        complement(312680..312880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03381"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71547"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUT6"
FT                   /protein_id="ABM71547.1"
FT                   /translation="MDKQELILSKKLVSSYKKRLEKEILERSIKLKMPQNKFEEIIKNN
FT                   NELINLKKALEELESKTQSSN"
FT   gene            313061..313588
FT                   /gene="cpeB"
FT                   /locus_tag="P9515_03391"
FT   CDS_pept        313061..313588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeB"
FT                   /locus_tag="P9515_03391"
FT                   /product="Phycobilisome protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71548"
FT                   /db_xref="GOA:A2BUT7"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUT7"
FT                   /protein_id="ABM71548.1"
FT                   /translation="MSVPNNNQILSTDRKLENINNKNIEYIKEFINTANSRLDAINSIT
FT                   NNSHAIAADAVTAMICENQDSINSKISIDSTNKMSVCLRDGEIILRIVSYLLISDDESV
FT                   LSKSCLKDLKNTYLALGVPLKNAIRVFELMRDATISDLKSTVNEMSGEKRFLQDLISNT
FT                   EFQFERIINLLK"
FT   gene            complement(313572..314123)
FT                   /gene="cpeS"
FT                   /locus_tag="P9515_03401"
FT   CDS_pept        complement(313572..314123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeS"
FT                   /locus_tag="P9515_03401"
FT                   /product="phycoerythrin linker protein CpeS"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71549"
FT                   /db_xref="GOA:A2BUT8"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR018536"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUT8"
FT                   /protein_id="ABM71549.1"
FT                   /translation="MTKNLITINEFIRKSLGEWKSIRSTHSLAFQEVENSSSRILIQEL
FT                   EINNKNVVELLEKSNLGFKPSVIAISISWQAISDWEMDQKIEKDKTILLFSPKDKNKGI
FT                   VIRNKGYSESVIVSSEYLIDGNNNLNIKTVYSTTISEERICFLSTHIRSRFSVIRNLEN
FT                   NTVIQTSHASEIRNISTLRD"
FT   gene            complement(314098..314277)
FT                   /locus_tag="P9515_03411"
FT   CDS_pept        complement(314098..314277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71550"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUT9"
FT                   /protein_id="ABM71550.1"
FT                   /translation="MTPFRPTSYDRPGEQISTTPSGLKVTSAKRLMVDSMVRMIQKANH
FT                   YSVEEKLDEESHNN"
FT   gene            complement(314387..314902)
FT                   /locus_tag="P9515_03421"
FT   CDS_pept        complement(314387..314902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03421"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71551"
FT                   /db_xref="GOA:A2BUU0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUU0"
FT                   /protein_id="ABM71551.1"
FT                   /translation="MGIWAPVGIFVLRGVSIILPALPSSAYSLLAGSLLGFQKGYITIV
FT                   FSDIVFCQAAFFIARYFGRGPVRGLVGSKAMKRIESFNQNQLEENFFLMTGLLMTGLFD
FT                   FLSYAIGIGGTRWKIFTPALLISLLISDSILVAVGAGVSQGAGLFLGIALLGMFALATI
FT                   SGLAKRKI"
FT   gene            315235..315654
FT                   /locus_tag="P9515_03431"
FT   CDS_pept        315235..315654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03431"
FT                   /product="possible Pollen allergen"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71552"
FT                   /db_xref="GOA:A2BUU1"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUU1"
FT                   /protein_id="ABM71552.1"
FT                   /translation="MTQIKTKLSSIVSQNTLALILSIIVVFSISIKQTYALSHEWVGVP
FT                   ISEYGEQLWDRKSIKRNEDGSVRVLSKFIPKTKSEITQDILYTMDINCFEKSFRDVDVF
FT                   TDEANSRLNNLADWKDPNGDQLILGVIGQVCRVEN"
FT   gene            complement(316363..316438)
FT                   /locus_tag="P9515_tRNAPheVIMSS1309115"
FT                   /note="tRNA-Phe"
FT   tRNA            complement(316363..316438)
FT                   /locus_tag="P9515_tRNAPheVIMSS1309115"
FT                   /product="tRNA-Phe"
FT   gene            complement(317165..318406)
FT                   /gene="metK"
FT                   /locus_tag="P9515_03441"
FT   CDS_pept        complement(317165..318406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="P9515_03441"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COG192 S-adenosylmethionine synthetase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71553"
FT                   /db_xref="GOA:A2BUU2"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUU2"
FT                   /protein_id="ABM71553.1"
FT                   /translation="MSDFIFTSESVTEGHPDKICDQISDAVLDALLKEDPESRVACETV
FT                   VNTGLCLLTGEITSRAKLDYIKLVRKVIKEIGYEGAKAGGFDSNSCAVLVALDEQSPDI
FT                   SQGVNEADDLNEDLENNTGAGDQGIMFGYACDETPELMPLPISLAHRLARQLAKVRHEN
FT                   VLEYLLPDGKTQVSIDYKKGVPVSINTILISTQHRAEIDGIINEKEIRQKITDDLWINV
FT                   VLPVTEDLEIKPSKEKTRFLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAF
FT                   SGKDPTKVDRSAAYAARYVAKSIVKAKLAKKAEVQLSYAIGVAKPISILVDTFGTSVIS
FT                   QDNLKELIENNFDLRPAAIIKEFDLRNLPKKLGGEFYRKTASYGHFGRNDLNLPWESVE
FT                   VKAAQLVEASKDFL"
FT   gene            complement(318527..319618)
FT                   /gene="rps1a"
FT                   /gene_synonym="rpsA1"
FT                   /locus_tag="P9515_03451"
FT   CDS_pept        complement(318527..319618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps1a"
FT                   /gene_synonym="rpsA1"
FT                   /locus_tag="P9515_03451"
FT                   /product="30S ribosomal protein S1, protein A"
FT                   /note="COG1098 Predicted RNA binding protein (contains
FT                   ribosomal protein S1 domain) [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71554"
FT                   /db_xref="GOA:A2BUU3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUU3"
FT                   /protein_id="ABM71554.1"
FT                   /translation="MIENSSETIKEISDDKEIENSTVKENTSETPKIEDLSFESKDIPS
FT                   ADSSSSRRNSDLDSAGFTQEDFASLLGKYDYNFKPGDLVNGTVFALEPKGAMIDIGAKT
FT                   AAFMPMQEVSINRVEGLSDVLQPSESREFFIMSEENEDGQLALSIRRIEYQRAWERVRQ
FT                   LQKEDATIYSEVFATNRGGALVRVEGLRGFIPGSHISARKIKEDLEGEYLPLKFLEVDE
FT                   ERNRLVLSHRRALVEKKMNRLEVGEVVVGSVKGIKPYGAFIDIGGVSGLLHISEISHEH
FT                   IETPHNVLNVTDQMKVMIIDLDSERGRISLSTKALEPEPGDMLTDPQKVFDKAEEMAAK
FT                   YKQMLLEQTDENDEQTADIPESE"
FT   gene            complement(319725..320204)
FT                   /locus_tag="P9515_03461"
FT   CDS_pept        complement(319725..320204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03461"
FT                   /product="Predicted transcriptional regulator, consists of
FT                   a Zn-ribbon and ATP-cone domains"
FT                   /note="COG1327 Predicted transcriptional regulator,
FT                   consists of a Zn-ribbon and ATP-cone domains
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71555"
FT                   /db_xref="GOA:A2BUU4"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUU4"
FT                   /protein_id="ABM71555.1"
FT                   /translation="MQCPTCQNTDSRVLESRSADTGKSVRRRRECLNCSFRFTTYERVE
FT                   TMPISVLKKDGSRELFNKDKLVTGISRACEKTTFSREAIIDFVDSIESQIIQDSNKDIK
FT                   SSQIGELILKGLRKENEVAYIRYASVYRKFNGVKDFVSTLESLKGSSKNELASIL"
FT   gene            complement(320428..321951)
FT                   /gene="psbB"
FT                   /locus_tag="P9515_03471"
FT   CDS_pept        complement(320428..321951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbB"
FT                   /locus_tag="P9515_03471"
FT                   /product="Photosystem II PsbB protein (CP47)"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71556"
FT                   /db_xref="GOA:A2BUU5"
FT                   /db_xref="InterPro:IPR000932"
FT                   /db_xref="InterPro:IPR017486"
FT                   /db_xref="InterPro:IPR036001"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUU5"
FT                   /protein_id="ABM71556.1"
FT                   /translation="MGLPWYRVHTVVINDPGRLLAVHLMHTALLAGWAGSMALYELAIF
FT                   DPSDAVLNPMWRQGMYVMPFMARLGITSSWNGWDITGATGVDPGFWSFEGVAAAHIVFS
FT                   GLLMLASIWHWTYWDLDLWEDERTGEPALDLPRIFGIHLLLAGITCFGFGAFHCANVGI
FT                   WVSDPYGLTGHVEPVAPSWGADGFNPFNPGGIVANHIAAGLLGIIGGIFHITNRPGERL
FT                   YKALRLGSLEGVLASALAAVLFVSFVVAGTMWYGSATTPVELFGPTRYQWDSGYFKTEI
FT                   NRRVQAAIDDGATREEAYAAIPEKLAFYDYVGNSPAKGGLFRVGALVNGDGLPTGWQGH
FT                   TVFTDKEGNDLEVRRIPNFFENFPVILEDKQGNVRADIPFRRAEAKYSFEQTGITATIY
FT                   GGDLNGQTFTDPAVVKRLARKAQLGEAFKFDRETYKSDGVFRSSPRAWFTYAHLCFGLL
FT                   FLFGHWWHASRTLYKDRFAGIDAEIGDQVEFGLFKKLGDETTRRIPGRV"
FT   gene            322176..322538
FT                   /gene="fdx"
FT                   /locus_tag="P9515_03481"
FT   CDS_pept        322176..322538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /locus_tag="P9515_03481"
FT                   /product="possible ferredoxin"
FT                   /note="COG633 Ferredoxin [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71557"
FT                   /db_xref="GOA:A2BUU6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUU6"
FT                   /protein_id="ABM71557.1"
FT                   /translation="MTTIRFIREGVDIKCKPGENLRELVIKEKLQLYGLKGLLGNCGGV
FT                   GQCSTCFISLEGGTKNSLSPITAVEQEKLKNRPENWRLACQTLISSSAIILTKPQSPPP
FT                   NLKELKESAENKKLPR"
FT   gene            322641..322793
FT                   /gene="psbM"
FT                   /locus_tag="P9515_03491"
FT   CDS_pept        322641..322793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbM"
FT                   /locus_tag="P9515_03491"
FT                   /product="possible Photosystem II reaction center M protein
FT                   (PsbM)"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71558"
FT                   /db_xref="GOA:A2BUU7"
FT                   /db_xref="InterPro:IPR007826"
FT                   /db_xref="InterPro:IPR037269"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUU7"
FT                   /protein_id="ABM71558.1"
FT                   /translation="METTNFGFVASLLFVGVPTIFLIGLFISTQDGEKSSFYSDSGKGK
FT                   LGPKR"
FT   gene            322806..323675
FT                   /gene="hemK"
FT                   /locus_tag="P9515_03501"
FT   CDS_pept        322806..323675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="P9515_03501"
FT                   /product="putative protein methyltransferase"
FT                   /EC_number="1.3.3.4"
FT                   /note="COG2890 Methylase of polypeptide chain release
FT                   factors [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71559"
FT                   /db_xref="GOA:A2BUU8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUU8"
FT                   /protein_id="ABM71559.1"
FT                   /translation="MFEISAENFSVWKKKQLLKGGDKKSFSLLIDLLGGLSKKELNSLT
FT                   IKAEKNLKFKLDLDSLEFFWGKHLSTNIPIQYLSGICYWRNLKLEVSDKVLIPRPETEL
FT                   VVEIISRKFDNNKGQIIFADLGTGSGAISISLALENPSWNGIATDINKNAVEIASRNFA
FT                   NNSNQSNLKFYSGNWWEPLTYLKGEIDFAVANPPYIPKNTYEELPIEVKNFEPKNALLG
FT                   GEDGLDHVREIVKYAPLYLKEKGWLLIENHFDQGARVKQLFIENQFTDVEVLKDLSGIG
FT                   RFTIGRYK"
FT   gene            323694..324275
FT                   /gene="sua5"
FT                   /locus_tag="P9515_03511"
FT   CDS_pept        323694..324275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sua5"
FT                   /locus_tag="P9515_03511"
FT                   /product="Putative translation factor (SUA5)"
FT                   /note="COG9 Putative translation factor (SUA5)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71560"
FT                   /db_xref="GOA:A2BUU9"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUU9"
FT                   /protein_id="ABM71560.1"
FT                   /translation="MNVIANKLAVEKLNIGLPIIFHTDTLPAIGCLPKFSEIIYKIKQR
FT                   DVKKPLILMGAESFQLNEFVHKTAFEDYKYMASRYWPGPLTMIIPISEKSKPLFSNKNL
FT                   TLGLRIPNSIMANYLIKESGPLLTSSANISGLPPSTNAKDISFDLPNVDILGPVPWPKC
FT                   SGKASTIISWVNNEKWKLIREGEVFIPGIK"
FT   gene            complement(324455..324526)
FT                   /locus_tag="P9515_tRNAThrVIMSS1309114"
FT                   /note="tRNA-Thr"
FT   tRNA            complement(324455..324526)
FT                   /locus_tag="P9515_tRNAThrVIMSS1309114"
FT                   /product="tRNA-Thr"
FT   gene            complement(324592..324909)
FT                   /gene="minE"
FT                   /locus_tag="P9515_03521"
FT   CDS_pept        complement(324592..324909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="P9515_03521"
FT                   /product="possible septum site-determining protein MinE"
FT                   /note="COG851 Septum formation topological specificity
FT                   factor [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71561"
FT                   /db_xref="GOA:A2BUV0"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUV0"
FT                   /protein_id="ABM71561.1"
FT                   /translation="MTLRDLINKLLGRETSSANTARERLQLVLAHDRVDMSSLTTDLLD
FT                   KMRKEILDVVAKYVEIDFEEVAVSLETEDRMTALVANLPIKRTLTGEIEFKKNHDNPKK
FT                   K"
FT   gene            complement(324916..325731)
FT                   /gene="minD"
FT                   /locus_tag="P9515_03531"
FT   CDS_pept        complement(324916..325731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="P9515_03531"
FT                   /product="putative septum site-determining protein MinD"
FT                   /note="COG2894 Septum formation inhibitor-activating ATPase
FT                   [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71562"
FT                   /db_xref="GOA:A2BUV1"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUV1"
FT                   /protein_id="ABM71562.1"
FT                   /translation="MPENSRTILVCSGKGGVGKTTLTANLGIALANSGATTAVLDADFG
FT                   LRNLDLLLGLENRIIYTAQDVLDKNCRLDQALVRHKKEPNLALLPAGDPRMLDWMKPED
FT                   MKQISKLLSEKFDYVLVDCPAGVEDGFKNALSACKEAIVVTNPELSAVRDADRVIGILN
FT                   TSDIKPIQLVINRVRPNMMANQEMLSIEDVQSILSLPLLGIVLEDEQVIISTNRGEPLT
FT                   LSDNKSPAKKCYLNVSQRLTGKDIPIIDPKNEGQSIKDKFMRLMQTKIF"
FT   gene            complement(325841..326509)
FT                   /gene="minC"
FT                   /locus_tag="P9515_03541"
FT   CDS_pept        complement(325841..326509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="P9515_03541"
FT                   /product="possible septum site-determining protein"
FT                   /note="COG850 Septum formation inhibitor [Cell division and
FT                   chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71563"
FT                   /db_xref="GOA:A2BUV2"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUV2"
FT                   /protein_id="ABM71563.1"
FT                   /translation="MKLILRNSNNDFIKSISFAKFEAYQNFISELSSIKEPVEAHLFTA
FT                   NERITSNELAKLKFHLKQLNIKFSDIYSNNRETVLSGKSLKINSSLLNNKKNINKSFLD
FT                   NQSQKKDILHKGTIRSGDRISSNGDLFIMGDVNPGAIVSANNNVYVWGKLLGTAFAGEN
FT                   GNKNASIASLWLNPIQLRICEIIAIGPKEKPKHQYPEIAILEAKKIIIKPYEPIRDCNK
FT                   "
FT   gene            complement(326509..327768)
FT                   /locus_tag="P9515_03551"
FT   CDS_pept        complement(326509..327768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03551"
FT                   /product="HD superfamily phosphohydrolase"
FT                   /note="COG1078 HD superfamily phosphohydrolases [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71564"
FT                   /db_xref="GOA:A2BUV3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUV3"
FT                   /protein_id="ABM71564.1"
FT                   /translation="MNKKRIFHDPIHKEIIIDSDKPEELMIMQLIDTLAFQRLRRIKQL
FT                   GAASLLFHGAESSRFTHSIGVFCVARKIYRRLLETKPEFSKSKFILFGAALLHDLGHGP
FT                   LSHTSEVIFPHNHEYWSKNLVENYSPITSILKNFGDELPKQIGDLFTTQNLFSNPLKTL
FT                   ISSEIDCDRLDYLLRDSYNTGTKYGLVDLERIISALTFSPDGNIAIKPKGVIAIEHFLV
FT                   LRNIMYRTIYNHRINEISTWILEKIIYSIKNNSRKKSIWIDEIMYKWIFTPKDLEIREF
FT                   LANDDIVFYFHLMKWKDKSFEPLETLCKMFIDRNLLKASNISFLSKLKRMEVLAFARKK
FT                   CKLNNYDSEIFCGIKERSFKGFESNNSLKIWDGTYQNLLENHSALIKTLMTSNNSSLII
FT                   YPGEFRREIENQIAILRDDP"
FT   gene            complement(327803..329092)
FT                   /locus_tag="P9515_03561"
FT   CDS_pept        complement(327803..329092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03561"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="COG793 Periplasmic protease [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71565"
FT                   /db_xref="GOA:A2BUV4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUV4"
FT                   /protein_id="ABM71565.1"
FT                   /translation="MNSSFNKFLIFKRWIIIIMICIFSTNFLHIQSVNALSDSRQFVLD
FT                   AWTLINEGYYDPERLDEIQWKRIRQKTLQKQIETSDEAYSAIEDMLKPLEDPFTRILRP
FT                   KDYELLKTSNFGSEINGVGLQLGKDEMTKKIKVISTLAGSPAEEAGIISGDVIDKVDGI
FT                   SSSELGLANTASKLRGESGTKVLVQITSMSDEIKEIDLERRSVDLRPVRTKRLRDDSHT
FT                   IGYLRITQFSESVPKKIEEALEELKDKEVEGIILDLRNNSGGLVSSGIAVADSFLSEQP
FT                   IVETKDRNGIKDAIISQKKTYFDGPMVTLVNKGTASASEILAGSLQDNERSTLIGEQTY
FT                   GKGLIQSLKSLGDDSGIAITVASYLTPKGNNIQGTGITPDKLLDLPEAREYGNSEDKWV
FT                   KNAEIYLNSLFDKNEVEETVNQLEKKDPEH"
FT   gene            329162..329818
FT                   /gene="petB"
FT                   /locus_tag="P9515_03571"
FT   CDS_pept        329162..329818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="P9515_03571"
FT                   /product="Cytochrome b6"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71566"
FT                   /db_xref="GOA:A2BUV5"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR023530"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUV5"
FT                   /protein_id="ABM71566.1"
FT                   /translation="MSNSSSVYDWFQERLEIQDITDDVTSKYVPPHVNIFYCLGGITLV
FT                   CFLIQFATGFAMTFYYKPTVTQAYNSVSYLMTDVSFGWLIRSVHRWSASMMVLMLILHV
FT                   FRVYLTGGFKRPRELTWVTGVVMAVITVAFGVTGYSLPWDQVGYWAVKIVSGVPAAIPI
FT                   IGDFMVELLRGGESVGQSTLTRFYSLHTFVLPWSLAVFMLMHFLMIRKQGISGPL"
FT   gene            329862..330344
FT                   /gene="petD"
FT                   /locus_tag="P9515_03581"
FT   CDS_pept        329862..330344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petD"
FT                   /locus_tag="P9515_03581"
FT                   /product="PetD protein (subunit IV of the Cytochrome b6f
FT                   complex)"
FT                   /EC_number="1.10.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71567"
FT                   /db_xref="GOA:A2BUV6"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR005870"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUV6"
FT                   /protein_id="ABM71567.1"
FT                   /translation="MSTLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIL
FT                   GTIACVVGLAVLDPAMLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLI
FT                   PLGLMILPFIENVNKFSNPFRRPVAMVVFLFGTFLTIYLGIGACLPIDKSLTLGLF"
FT   gene            complement(330351..331790)
FT                   /locus_tag="P9515_03591"
FT   CDS_pept        complement(330351..331790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03591"
FT                   /product="putative neutral invertase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71568"
FT                   /db_xref="GOA:A2BUV7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUV7"
FT                   /protein_id="ABM71568.1"
FT                   /translation="MAERFSQKNLRVRPSSDEDKIVTNAKEHFEKTLIKISGELVGSVA
FT                   ALEHPSKNLKLNYGEIFLRDNVPVMIYLITQKRYDIVRKFLSVCLELQSTSYQTRGVFP
FT                   TSFVEEKGKLIGDYGQRSIGRITSADASLWWPILCWYYVNKSGDYSFGKSQSVQRGIQL
FT                   LLDLVLHPTFEGTPVLFVPDCAFMIDRPMDVWGAPLEVEVLLHGCLKSCINLMELSRED
FT                   HVSRLLDQRLILTSQWVEDLRSFLLKHYWVTSQTMQILRRRPTEQYGEDQHFNEFNVQP
FT                   QVVPSWLQEWLENRGGYLIGNIRTGRPDFRFYSLGNSLACMFGVLPSSEQRALFRLVLH
FT                   NRQHLIAQMPMRICHPHMDVEEWQNKTGSDPKNWPWSYHNGGHWPSLLWFFGTSVLLHQ
FT                   KRFPTEDVILMEEMRSLIEESYWCQLNQLPKQEWAEYFDGPTGTWVGQQSRTYQTWTIV
FT                   GFLLMHHFLREENNDLDMFDL"
FT   gene            332422..333886
FT                   /locus_tag="P9515_rrsVIMSS1309392"
FT   rRNA            332422..333886
FT                   /locus_tag="P9515_rrsVIMSS1309392"
FT                   /product="16S ribosomal RNA"
FT   gene            334009..334082
FT                   /locus_tag="P9515_tRNAIleVIMSS1309139"
FT                   /note="tRNA-Ile"
FT   tRNA            334009..334082
FT                   /locus_tag="P9515_tRNAIleVIMSS1309139"
FT                   /product="tRNA-Ile"
FT   gene            334095..334167
FT                   /locus_tag="P9515_tRNAAlaVIMSS1309140"
FT                   /note="tRNA-Ala"
FT   tRNA            334095..334167
FT                   /locus_tag="P9515_tRNAAlaVIMSS1309140"
FT                   /product="tRNA-Ala"
FT   gene            334434..337307
FT                   /locus_tag="P9515_rrlVIMSS1365721"
FT   rRNA            334434..337307
FT                   /locus_tag="P9515_rrlVIMSS1365721"
FT                   /product="23S ribosomal RNA"
FT   gene            337375..337490
FT                   /gene="rrf"
FT                   /locus_tag="P9515_rrfVIMSS1309393"
FT   rRNA            337375..337490
FT                   /gene="rrf"
FT                   /locus_tag="P9515_rrfVIMSS1309393"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(337535..338416)
FT                   /gene="mutM"
FT                   /locus_tag="P9515_03601"
FT   CDS_pept        complement(337535..338416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="P9515_03601"
FT                   /product="Formamidopyrimidine-DNA glycolase (FAPY-DNA
FT                   glycolase)"
FT                   /EC_number="3.2.2.23"
FT                   /note="COG266 Formamidopyrimidine-DNA glycosylase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71569"
FT                   /db_xref="GOA:A2BUV8"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUV8"
FT                   /protein_id="ABM71569.1"
FT                   /translation="MPELPEVETVRKGLEQKLKNFIIKRVEICRESTVAYPIDKQDFVK
FT                   GLQNSLINKWDRRGKYLIAKLKKADRNHTYIENEMSLKNNGSLVVHLRMTGYFTFNKNP
FT                   TSPCKHTRIRLFDNNNNELRYIDVRSFGQMWWVREGLSPKNIIKGLGALGPEPFSEKFN
FT                   ISYLTKIILNKTRSIKSILLDQTIVAGIGNIYADESLYSAGISPFREARTIEKHELIKL
FT                   RIAIIEVLKKSIGAGGTTFSDFRDLEGENGNFGLQTNVYRRTGKKCHACKNLIERQKIS
FT                   GRSTHWCRKCQK"
FT   gene            complement(338421..338630)
FT                   /gene="psaE"
FT                   /locus_tag="P9515_03611"
FT   CDS_pept        complement(338421..338630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaE"
FT                   /locus_tag="P9515_03611"
FT                   /product="Photosystem I PsaE protein (subunit IV)"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71570"
FT                   /db_xref="GOA:A2BUV9"
FT                   /db_xref="InterPro:IPR003375"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BUV9"
FT                   /protein_id="ABM71570.1"
FT                   /translation="MTIARGDFVRIKRKESYWYNDTGKVASIDKSGIKYNVTVKFDRVN
FT                   FYGISGTDGGNVTNNFAEVELEKI"
FT   gene            complement(338711..339472)
FT                   /locus_tag="P9515_03621"
FT   CDS_pept        complement(338711..339472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03621"
FT                   /product="possible LysM domain"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71571"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUW0"
FT                   /protein_id="ABM71571.1"
FT                   /translation="MKSTFILFACIINFFNPNFIKAEEIIDSSNNQIENATNAESTKTE
FT                   ISDFNKIHIVQVGDTITSISKFYSLKKDLIIKLNNLKDENYIYVGQNLKISDPSQEIKH
FT                   NDGLDNSYHIVQEGESLTEISAKYGLNFKDLIEINNLKNPDSLQVSSKLFLRKKNIISK
FT                   KVKASYKEEEIDQLISKKKKNYGPITTQQNELEELNGRKILNALNQNNKKVIISIKCET
FT                   KDLDVRIPGRKWRGWIPAKEEFEKNLINDFC"
FT   gene            complement(339545..340936)
FT                   /locus_tag="P9515_03631"
FT   CDS_pept        complement(339545..340936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03631"
FT                   /product="Putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /EC_number="1.2.1.16"
FT                   /EC_number="1.2.1.39"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71572"
FT                   /db_xref="GOA:A2BUW1"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUW1"
FT                   /protein_id="ABM71572.1"
FT                   /translation="MNILDKSYKSNLNALKNKVITGQTESISWRIQQISKVAQLLDENK
FT                   KEIIKALYLDLGKSEIEALSEILLIEEEISLTKKNLKSWIRPKKVKTPIYLFPSFSKVI
FT                   YEPLGCVLILGPYNYPLLYLLKPLVNIFSAGNTAVIKPSEKCSTISTLIKKLTDKYFQK
FT                   DTLLTIEGDYKESIKLVEQNFDHIFFTGSTETGKSIMKSASRNLTPLTLELSGTNPVII
FT                   FKNANLEIAAKRIVWGKFFNSGQSCMAPNHIFVEKEIETQLVEELKKFITIFYGENPLI
FT                   SKNLSKLQKNQFSKTSELLKRFKKEKLILFGGTSSKKRMKISPTILKVKLQDKNIFQKE
FT                   LFSSLLPVIGIETKESALKKINQASKPLAIYIFGGNKKIHDHISKVTSSGTVCINDVML
FT                   PVLIPNLPFGGVGKSGMGKFHGEEGFKNFSNQKSITYKGFLFDLDLRYPPYENVMKIIK
FT                   FIFKI"
FT   gene            341023..341643
FT                   /locus_tag="P9515_03641"
FT   CDS_pept        341023..341643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03641"
FT                   /product="possible Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71573"
FT                   /db_xref="GOA:A2BUW2"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUW2"
FT                   /protein_id="ABM71573.1"
FT                   /translation="MLFNNNIIKSFFILRNIKKEAQFIIPSCLCFLLFIVVNLTHFYLV
FT                   SDLSYWSSYIINQPYRILSYSFVHKDINHLLSNLFGIIVVRYCFINLKLKNIFLFLYLI
FT                   ILLIPIQTFLLFMMDSFLFYERNRALVGFSGIIFGTVSFILLSSLYGKQYIFNIFIGLN
FT                   KNNEIYRLTTVFLSLGVVYSFLPSISLSGHIAGILSGFIIFIF"
FT   gene            341731..342621
FT                   /locus_tag="P9515_03651"
FT   CDS_pept        341731..342621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03651"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71574"
FT                   /db_xref="GOA:A2BUW3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUW3"
FT                   /protein_id="ABM71574.1"
FT                   /translation="MNKNFSIRLISNNEIQKVTDWAKLEGFAPGFDDISIYKNTDKKGI
FT                   WVGCLDNDPIGSIACVKYNSSYGFIGLFIVKKEFRNMGYGVRLWKHALDYLKNVDCIGL
FT                   EAAPNRLDDYQKWGFKKSSITNRWKSEGIQDLPNGKFYKDENNAFKVVPGNQISPEAVL
FT                   IYDSQREPSPRPHFLNDWLKNSFGNVSALVDNNGMCHGFGRIRPCILQDNNQGWRIGPL
FT                   LADTPPLAELLIRKLVRNLEAQILLDCSSLNPYANYLLSSMGFKEISQTYRMYKGIQPS
FT                   CPMNQVYGLACLELG"
FT   gene            complement(342719..342973)
FT                   /locus_tag="P9515_03661"
FT   CDS_pept        complement(342719..342973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71575"
FT                   /db_xref="InterPro:IPR021453"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUW4"
FT                   /protein_id="ABM71575.1"
FT                   /translation="MVSSEVYEFLFVNPGDYVMVRNDNTLENVQNGQNNYWIGQVINCI
FT                   GGARNPNSWTLFQVADIDNGEIKIINADTVERILKKAEH"
FT   gene            complement(343446..343580)
FT                   /locus_tag="P9515_03671"
FT   CDS_pept        complement(343446..343580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03671"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71576"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUW5"
FT                   /protein_id="ABM71576.1"
FT                   /translation="MSEVQTQERDSTPQPQQQQKSYQDLNGYAAETEQLYLKMKEGWL"
FT   gene            complement(343687..343788)
FT                   /locus_tag="P9515_03681"
FT   CDS_pept        complement(343687..343788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03681"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71577"
FT                   /db_xref="GOA:A2BUW6"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUW6"
FT                   /protein_id="ABM71577.1"
FT                   /translation="MLTISEILLASAIFLGIVYWEVQFLYSKTTAAK"
FT   gene            343933..344367
FT                   /locus_tag="P9515_03691"
FT   CDS_pept        343933..344367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03691"
FT                   /product="NADH-plastoquinone oxidoreductase chain 5-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71578"
FT                   /db_xref="GOA:A2BUW7"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUW7"
FT                   /protein_id="ABM71578.1"
FT                   /translation="MENSINISILIPLIPMGMSLFILILLLSFNRTMNRLTKPVSALLI
FT                   FSLLSSALISSFLYLKKIEGEVFLSNYLKLFENSNLVLHLNSLTEKIVIFFTVIMAIVI
FT                   GFLFYKLPRQKGYVSMIVGIILISSSVIFALMFLDFSVLI"
FT   gene            complement(344367..344796)
FT                   /pseudo
FT                   /locus_tag="P9515_pseudoVIMSS1362533"
FT                   /note="frameshift; Pseudogene derived from PMED4_03461"
FT   gene            345025..345165
FT                   /locus_tag="P9515_03701"
FT   CDS_pept        345025..345165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03701"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71579"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUW8"
FT                   /protein_id="ABM71579.1"
FT                   /translation="MTSTEKIANAKKRINELERLIKYWDDSEEKNIKKIGFKVNNEKIA
FT                   A"
FT   gene            complement(345453..345761)
FT                   /locus_tag="P9515_03711"
FT   CDS_pept        complement(345453..345761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03711"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71580"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUW9"
FT                   /protein_id="ABM71580.1"
FT                   /translation="MLLSKLKRLKIQEIVRRISLNEEVTLKERIYVEQYAKKNSTISLW
FT                   LKKATSIRRYGAQSKGSINELIQSLGIDGLDGENHFNPNKDEIPHWFGGSPDWIKRS"
FT   gene            346291..346590
FT                   /locus_tag="P9515_03721"
FT   CDS_pept        346291..346590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71581"
FT                   /db_xref="InterPro:IPR023810"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUX0"
FT                   /protein_id="ABM71581.1"
FT                   /translation="MSVDRELLKEVTQELWNTVKKLRPEIDRETRLQLVLKALLTIGDL
FT                   PDQLQAAMVVGVCAEMDKSDNKNVDGNSSIKEDNSSSSVDTSTGRKVFRRSSAK"
FT   gene            complement(346608..346811)
FT                   /locus_tag="P9515_03731"
FT   CDS_pept        complement(346608..346811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03731"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71582"
FT                   /db_xref="GOA:A2BUX1"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUX1"
FT                   /protein_id="ABM71582.1"
FT                   /translation="MFFLSIPQAWHLAGTWSEQLPKDSNLIGMSQTELMMTLHSIFVPL
FT                   LLVISYFLFLKLSKEESKKVKG"
FT   gene            complement(346927..348456)
FT                   /locus_tag="P9515_03741"
FT   CDS_pept        complement(346927..348456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03741"
FT                   /product="Bacterial-type phytoene dehydrogenase"
FT                   /note="COG1233 Phytoene dehydrogenase and related proteins
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71583"
FT                   /db_xref="GOA:A2BUX2"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUX2"
FT                   /protein_id="ABM71583.1"
FT                   /translation="MNKYDVVIVGSGIGGLCCGSILALAGKRVLICEAHSQPGGVAHSF
FT                   NLKGYKFESGPSLWSGLGRWPTTNPLGQILRLIDEKVELIKYQGWLVNVPEGNFNLEVG
FT                   EEPFKSRIKLLRGNRSVEEWDSLMSAIKPLSKLVSEIPLLSSSPETINILGFIKLASKF
FT                   LPNLNLLPKLNGGFGDIVDNHLKDPFLRNWVDLLSFLISGMPMHDTNSAAMATLFDEWF
FT                   KPTSYLEYPKGGSESIVKALINAFKKNGGELIVSSKVEAINFRKNIALGVTLENGSKFT
FT                   SDFVVLNTDIWTSRKLIPQELQKKWKPKAKNINKCGSFLHLHLGFDASGLQNLPIHSIH
FT                   VDDWGRGITAERNVVVFSIPSVLDKSMAPKGKHVLHGYTPANEPWEIWENLNSNDLTYK
FT                   KLKEERCSIFLKSLRKIIPDIDNRIEIKLLGTPLTHKKFTNTYCGSYGPALSAAQGLFP
FT                   GCKTPIKNLLTCGASTFPGIGIPAVSASGAYAAEKIIGKKEYKNLLKMIDL"
FT   gene            348760..349260
FT                   /locus_tag="P9515_03751"
FT   CDS_pept        348760..349260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71584"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUX3"
FT                   /protein_id="ABM71584.1"
FT                   /translation="MILGPKNLPQYKEIKLLESISIKEGSGIDNEDLIGTWKFNSVWKK
FT                   GSEEIDNISSSILQVLSAKLELKKNNSQNKSFDFEIINSISFGILSIIFCGQASLKGKR
FT                   PLLPFFFEKLIINIGNFTLVNKPLKKIIEKQRPFFSLIALSKENNWMCARGKGGGLAIW
FT                   IKS"
FT   gene            complement(349265..349444)
FT                   /locus_tag="P9515_03761"
FT   CDS_pept        complement(349265..349444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03761"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71585"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUX4"
FT                   /protein_id="ABM71585.1"
FT                   /translation="MQSEDNLKKDVTSSATADDVALIAQKLGYNFSGDDLLRFNGQTVD
FT                   KVTVRKVDHPGEYH"
FT   gene            349579..349899
FT                   /locus_tag="P9515_03771"
FT   CDS_pept        349579..349899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03771"
FT                   /product="possible Helper component proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71586"
FT                   /db_xref="GOA:A2BUX5"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUX5"
FT                   /protein_id="ABM71586.1"
FT                   /translation="MTYLFLYVVGLVLIWWIYRVGWIEALKTVIKVLVPSILIILFNIK
FT                   AGRLLFKNPLVGIVSALPTSIFIYKGSLPLVASINNWIDTKRSNYDESKDVIDTESVPL
FT                   DD"
FT   gene            complement(349909..350316)
FT                   /locus_tag="P9515_03781"
FT   CDS_pept        complement(349909..350316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03781"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71587"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUX6"
FT                   /protein_id="ABM71587.1"
FT                   /translation="MINEIIQRPITPVEEFEIALNKAELSEADYELIDYIRYTSVFTQP
FT                   SLVKDLKRPSKPPLLTNLCQICRKIGSEMPEHFTKVIDWSVQISEHNTRWDGHLICAEA
FT                   LNVDKVPISPTHGTSLFDVLVVHKELFLGFD"
FT   gene            complement(350306..350593)
FT                   /locus_tag="P9515_03791"
FT   CDS_pept        complement(350306..350593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03791"
FT                   /product="mttA/Hcf106 family"
FT                   /note="COG1826 Sec-independent protein secretion pathway
FT                   components [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71588"
FT                   /db_xref="GOA:A2BUX7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUX7"
FT                   /protein_id="ABM71588.1"
FT                   /translation="MNIFGVGLPEVTVILILALLIFGPKKLPELGKQLGKTLKSLKKAS
FT                   NEFQQEIDQVINESGKEDLPKSPRENFTNNLDQLTKESEQTDLSKSDNDK"
FT   gene            complement(350686..350931)
FT                   /locus_tag="P9515_03801"
FT   CDS_pept        complement(350686..350931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03801"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71589"
FT                   /db_xref="GOA:A2BUX8"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUX8"
FT                   /protein_id="ABM71589.1"
FT                   /translation="MKNCLIDNKNLLINQFNPINSDIKLKLSNKCMFLKLIKRIFKRHR
FT                   LFINWYQKKFNLSDYQLLWLVFFKGILITIIFNKLF"
FT   gene            351043..351282
FT                   /locus_tag="P9515_03811"
FT   CDS_pept        351043..351282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03811"
FT                   /product="non-structural protein (NS2)-like protein"
FT                   /note="similar to influenza non-structural protein (NS2)"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71590"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUX9"
FT                   /protein_id="ABM71590.1"
FT                   /translation="MKILLVPFLLFAFISPSKAVTTKMFKVLDTCARYRLKEIDAKAAV
FT                   EKLKLESNNFSELGLRNIVSKYCSVFTPNQKIEF"
FT   gene            351584..352033
FT                   /locus_tag="P9515_03821"
FT   CDS_pept        351584..352033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03821"
FT                   /product="putative bacterioferritin comigratory protein"
FT                   /note="COG1225 Peroxiredoxin [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71591"
FT                   /db_xref="GOA:A2BUY0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUY0"
FT                   /protein_id="ABM71591.1"
FT                   /translation="MKIGDKVPLFSLLDQNGTRRTNEGLKSPLVLFFYPKDDTPGCTIE
FT                   VCGFRDKYDLFKVLGAQVWGVSNGTSSSHLAFANKNKLQYPLLCDIDDSLRKTFKVPKV
FT                   LGLLDGRVTYVIDRNGFVKHIFRDLLNGPEHIKEAIRVLKEIQNQ"
FT   gene            352102..352374
FT                   /locus_tag="P9515_03831"
FT   CDS_pept        352102..352374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03831"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71592"
FT                   /db_xref="InterPro:IPR025149"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUY1"
FT                   /protein_id="ABM71592.1"
FT                   /translation="MKKKGMQAVDDAIKKGIDLDGTPIPSKMLELYSRIMNAENQRERS
FT                   GVKKSMRNRCVKTGSKHFDKETLNQLLIDSGWEGLKEKEILFFYN"
FT   gene            complement(352760..353104)
FT                   /locus_tag="P9515_03841"
FT   CDS_pept        complement(352760..353104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71593"
FT                   /db_xref="GOA:A2BUY2"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUY2"
FT                   /protein_id="ABM71593.1"
FT                   /translation="MDKLSREQVLATSSGWVASLLNFFPGVGTGYLYQRRWIPYFLTAG
FT                   AVTAWFTIGIILQGDKEPTQTNQLIGIAGLFLISTITLVEANLAFKKAVKIANIKVQET
FT                   NSPTKKGWFK"
FT   gene            complement(353319..353520)
FT                   /pseudo
FT                   /locus_tag="P9515_pseudoVIMSS1362534"
FT                   /note="frameshift; Pseudogene derived from PMED4_03661"
FT   gene            353761..354177
FT                   /locus_tag="P9515_03851"
FT   CDS_pept        353761..354177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03851"
FT                   /product="Class I peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71594"
FT                   /db_xref="GOA:A2BUY3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUY3"
FT                   /protein_id="ABM71594.1"
FT                   /translation="MDLIITPKLVIPSRELKWLFSRSSGPGGQKVNKTNTKVEIIFNIE
FT                   ESIILNDYQKMVIKKNLKTKLINNCIRLTVQDQRNQLVNRQIAIVRISSLIRNSLKNSS
FT                   KVRKLTKPSYAVQKRRIDAKKKRGELKKNRQRKY"
FT   gene            354286..354534
FT                   /locus_tag="P9515_03861"
FT   CDS_pept        354286..354534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03861"
FT                   /product="possible TIR domain"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71595"
FT                   /db_xref="InterPro:IPR012447"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUY4"
FT                   /protein_id="ABM71595.1"
FT                   /translation="MKKENDFWLIDSNSVGVIRFYKKNKNKKDLIEYMFIEEGIVMGIH
FT                   GENPPLMKTTKEIKIEEARMFWESLINQGWQKTNPQW"
FT   gene            complement(354731..354949)
FT                   /locus_tag="P9515_03871"
FT   CDS_pept        complement(354731..354949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03871"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71596"
FT                   /db_xref="GOA:A2BUY5"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUY5"
FT                   /protein_id="ABM71596.1"
FT                   /translation="MIFYYKFAIFKKDQIKNMNFEAGFEFIIFLILFGIINYLMMLRRY
FT                   ENDLMKRKIFQRNKISVLYPKGTFINL"
FT   gene            355049..355312
FT                   /locus_tag="P9515_03881"
FT   CDS_pept        355049..355312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03881"
FT                   /product="possible Small, acid-soluble spore proteins, a"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71597"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUY6"
FT                   /protein_id="ABM71597.1"
FT                   /translation="MENIQKAEKAFNQLLLHIIGKNFLENLSTDKFDAKSIIEKSIEEI
FT                   KEEYSYSLSLQAQCVPDAGRLISQAKRKLEGLEALLTLAKLL"
FT   gene            complement(355290..356174)
FT                   /locus_tag="P9515_03891"
FT   CDS_pept        complement(355290..356174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03891"
FT                   /product="Abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71598"
FT                   /db_xref="GOA:A2BUY7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUY7"
FT                   /protein_id="ABM71598.1"
FT                   /translation="MFYILNSIKTIYEKFLLIKPRILTIILFMPCLYLLGWLLANPLLF
FT                   TGVGEDKISLIGTIITFLLFITAMPKWFEIRWGLNDTWMLLGINKIDKKPERFIYFLRG
FT                   LLYAFILLSLILIPIISNEWGNWLGRLSPEILLNSLVLIIGIGFAEELIFRGWLLEELK
FT                   NQYGFKKACIIQSLVFSMAHTGFDMPFWQMISILFGLFLLGILLSIIRIKDDNSLWGCA
FT                   GMHGGLVGIWFLMNNGLVEISLDAPNWLIGPGYINTNPLGGFYGISLLIITLFYNFFKY
FT                   KKKISKFITISQE"
FT   gene            complement(356271..357113)
FT                   /locus_tag="P9515_03901"
FT   CDS_pept        complement(356271..357113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03901"
FT                   /product="Glycosyl transferase family 11"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71599"
FT                   /db_xref="GOA:A2BUY8"
FT                   /db_xref="InterPro:IPR002516"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUY8"
FT                   /protein_id="ABM71599.1"
FT                   /translation="MIFSRMVGGLGNQLFQTAACLKYRKPREKVIISFLGDIHIPKRIN
FT                   CLNSIFEKPTWLYYDNSKDLNILKKFVAKTSASLRFGSFMPLISVNDRNFNSRDYDFNE
FT                   KKLLFLDGYFNQKWTYSNLKNYFSQLKLRPIELNNEYLKIRDNDVVIHLRGSDFLKISD
FT                   LNICKLDYYKKSIKYAISKGHRSFKLISEDQQYGKEFLKEIKKCFIDLKISMLNSDTIK
FT                   NDFNLIRSSKFAILSNSTFSWWASFLSITKKEFIVPENFSLKEKRVILPNETILNRNT"
FT   gene            357212..357988
FT                   /locus_tag="P9515_03911"
FT   CDS_pept        357212..357988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03911"
FT                   /product="possible Glycosyl transferase"
FT                   /note="COG463 Glycosyltransferases involved in cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71600"
FT                   /db_xref="GOA:A2BUY9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUY9"
FT                   /protein_id="ABM71600.1"
FT                   /translation="MNKLKKELDPIEENELLFNIIVPIFNAEKYIEKCLNSIINQSYKR
FT                   FQVQVVDDCSGDSSYEIASSICKNNKNLKIVRNPRRIGALNNISNLLNNNIKEPSKTVD
FT                   LIIDGDDYLYSGDVFNILKEKYMETNCLITYGSHISSKGVQGKKYPRLIREFNLFRKYF
FT                   WYASHLKTFRHDLWLALNPKDLINKKGEYFSVASDLAIMFPMLEMAGNRQEFISEILYV
FT                   YNDNNPISDHKIRRKDQILSAKEIRRKRIYNKRTFS"
FT   gene            complement(358389..358499)
FT                   /locus_tag="P9515_03921"
FT   CDS_pept        complement(358389..358499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03921"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71601"
FT                   /db_xref="GOA:A2BUZ0"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUZ0"
FT                   /protein_id="ABM71601.1"
FT                   /translation="MSIFNMDFIKKNKILSLMAAIAILSFILEKAGMIYP"
FT   gene            358653..358994
FT                   /locus_tag="P9515_03931"
FT   CDS_pept        358653..358994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03931"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG5470 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71602"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUZ1"
FT                   /protein_id="ABM71602.1"
FT                   /translation="MDKKGAKGYWISTAKIINQELFDEYVNQVGPWLKNVGGEVFAKDK
FT                   EPIGKERTEDSNLAVICEFPSMRAAVQAYESKEYAELSKLRKKATENSTFTIMEGLDEA
FT                   AKLRRAMGK"
FT   gene            359062..359202
FT                   /locus_tag="P9515_03941"
FT   CDS_pept        359062..359202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03941"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71603"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUZ2"
FT                   /protein_id="ABM71603.1"
FT                   /translation="MEPNYVGDLIPSIASYQKIIDKYERGLKKGEFYDEPTGEDLIYPD
FT                   W"
FT   gene            359196..359393
FT                   /locus_tag="P9515_03951"
FT   CDS_pept        359196..359393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03951"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71604"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUZ3"
FT                   /protein_id="ABM71604.1"
FT                   /translation="MVIMLTTKITYALADWIREWRKFRKENPSLDDCIKFAEWKIKNYK
FT                   LTDSDLIIIESILLYETEES"
FT   gene            359937..360878
FT                   /locus_tag="P9515_03961"
FT   CDS_pept        359937..360878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03961"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="COG596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71605"
FT                   /db_xref="GOA:A2BUZ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUZ4"
FT                   /protein_id="ABM71605.1"
FT                   /translation="MKEKKLFPIIEPREKGFLQVSRIHSIYWERSGNQNGKKILVIHGG
FT                   PGGGSQPRYRRYFNPEKFDIIQFDQRGCGASRPFSELRENTTKDLVDDIEKLRLNLNID
FT                   SWHLFGGSWGSTLALIYAIKHPSRVKSMTLRGIFLCRKFELSWFYQYGASEIFPEEFEK
FT                   YISVIPKDERSDLVSSFYKYLTSPNIELRSKAAAAWTTWELSTSHLIKRDIDVGKSKTN
FT                   SFSDAFARIECHYFINHIFLEEDFIMKNIKTIESIPTKIIQGRYDVVCPVRSAWDLNKK
FT                   LKNSELIIIDEAGHSMSEKGITLKLLELVEKL"
FT   gene            complement(360920..361093)
FT                   /locus_tag="P9515_03971"
FT   CDS_pept        complement(360920..361093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03971"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71606"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUZ5"
FT                   /protein_id="ABM71606.1"
FT                   /translation="MSNRFEWDDTNSSGIWWSTNVSIRDECILLKEDTECEDSDIVELL
FT                   RSIAKNIEDNGL"
FT   gene            complement(361098..361349)
FT                   /locus_tag="P9515_03981"
FT   CDS_pept        complement(361098..361349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03981"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71607"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUZ6"
FT                   /protein_id="ABM71607.1"
FT                   /translation="MKKPTIELKSTEFTEVIELERIITPDEEKRVDHVFVRRKKVCKRH
FT                   PEGFATEEYARFDIEWPEEVKEEIKENIKEQEEVNIKS"
FT   gene            complement(361515..363026)
FT                   /locus_tag="P9515_03991"
FT   CDS_pept        complement(361515..363026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_03991"
FT                   /product="putative deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="COG415 Deoxyribodipyrimidine photolyase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_03991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71608"
FT                   /db_xref="GOA:A2BUZ7"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUZ7"
FT                   /protein_id="ABM71608.1"
FT                   /translation="MKNINILWFKKDLRINDNEALIESLKDRDIIPIFIIEKEIWSQKT
FT                   YSDRQWQFCKESLLDLRISLANIGQPLIIRTGKVIEIFDQISNNFEIKAIYSHQETGDY
FT                   LTYKRDQEVRKWASMKKIIWKEYLQFSVFRGKLDRNNWSTKWKKNMERKLFTEPSKINP
FT                   IEIDPGEIPPDNFFCFKDDFCKGRLKGGREIGLKRMEYFFSNKLSYYSKDISSPEKSFD
FT                   SCSRLSPYISWGCISIKEIIHKANSITNPNSKMLKSRLTWHCHFIQKLESEPELEFKEF
FT                   HPYFQKIRKKDSHLLKLWSEGKTGFPFLDACMRSLNFHGWLNFRMRAMLMSFASYNLWI
FT                   PWQESGSELASKFLDYEPGIHWNQCQMQAGTTSINVNRIYNPIKQGKDHDPKGNFIKKW
FT                   VPEIQNYPENFVHEPWLMEKFNSKEYENSEYIKPIINLSETTKNARKRIQEITQREGYW
FT                   DISKGIYMKHGSRRKALNKRKNYPKKSNLRKKRELQNQLNLDLLI"
FT   gene            complement(363086..363469)
FT                   /locus_tag="P9515_04001"
FT   CDS_pept        complement(363086..363469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04001"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71609"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUZ8"
FT                   /protein_id="ABM71609.1"
FT                   /translation="MKLIEDYTERFHNYTLPSPEKCFELEDGDEFYIKKWITNGKINGK
FT                   IKDIFEWIEKKYLSSKEELEKTDKKKYDEIQRRFPMENWRIILLMSEYQIKYRYYTKVI
FT                   ESIKEKSFSGMDNKDFLKLFQKD"
FT   gene            complement(363474..363833)
FT                   /locus_tag="P9515_04011"
FT   CDS_pept        complement(363474..363833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04011"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71610"
FT                   /db_xref="GOA:A2BUZ9"
FT                   /db_xref="InterPro:IPR021362"
FT                   /db_xref="UniProtKB/TrEMBL:A2BUZ9"
FT                   /protein_id="ABM71610.1"
FT                   /translation="MWTKIRLGIYGATCLAGLLWPFYFIIQFISLVRNGNIQGSVIDIG
FT                   TAFFDDAWITPTSGFISADTVILLIAIFIFYVAEGKRLKLKLWGIYFPLTFLISLAFSF
FT                   GAFMFMREIELNKKD"
FT   gene            364457..365080
FT                   /locus_tag="P9515_04021"
FT   CDS_pept        364457..365080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04021"
FT                   /product="TENA/THI-4 protein"
FT                   /note="COG819 Putative transcription activator
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71611"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV00"
FT                   /protein_id="ABM71611.1"
FT                   /translation="MLVTKRLWESNLNLALSSLQTNFVQGIKNGNLPKNIFQEYLAQDY
FT                   FFLESFARAYGLAISKSRDKNSIKALSQLLVGVSEELILHETYSKKWDINLNNNHIKPA
FT                   TQNYTDFLEEVSKKKSAVEIMFAMTPCMRLYSWIGKSLSSKVLNNPYKEWIITYSDENF
FT                   DNLAKSLENLIDSAKEEYDTNQANYLYKRAMELELEFFNAYSNY"
FT   gene            365111..365899
FT                   /gene="thiD"
FT                   /locus_tag="P9515_04031"
FT   CDS_pept        365111..365899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="P9515_04031"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.1.49"
FT                   /EC_number="2.7.4.7"
FT                   /note="COG351
FT                   Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71612"
FT                   /db_xref="GOA:A2BV01"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV01"
FT                   /protein_id="ABM71612.1"
FT                   /translation="MYSKIALSIGGSDSGGGAGIQADLKTFMALNVHGCSAITCITAQN
FT                   SFEVSCVEAVQKETLISQIDTLFSDFDINALKTGMLLNESIIDTTALKLKSYSIPKIID
FT                   PVMVSRTGSKLLEDAAINAYKKLLLPIADIVTPNIFEANLLSNIEIKNKKDIELAAHNI
FT                   IELGAKAVLIKGGGLKEMQGKDFYFDVTGKSKWFINKFINTKNTHGSGCTLSSAICGYQ
FT                   ALGFELIESIERAKAFIERSLEKSYKIGSGPGPLGHYQSL"
FT   gene            366324..366467
FT                   /locus_tag="P9515_04041"
FT   CDS_pept        366324..366467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04041"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71613"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV02"
FT                   /protein_id="ABM71613.1"
FT                   /translation="MRNQEKPMLKTIVNVGFCESNSEWLNRIMTELADENKNFVDLSVL
FT                   CA"
FT   gene            366815..367282
FT                   /locus_tag="P9515_04051"
FT   CDS_pept        366815..367282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04051"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG3542 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71614"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV03"
FT                   /protein_id="ABM71614.1"
FT                   /translation="MNFDKNTSDIINKFKLSIHPEGGWYREIFRGENYVTRKDGQKRTN
FT                   ITSIYYLLCKGENSSWHRVNNADEIWIFLQGSPLNLRCLDEDNKKIKNLNLHTNNPIEI
FT                   IPAGYWQCASTSGEFTLTSCCVGPGFDFLDFEMLRDLDPSLRPSKAMKDFI"
FT   gene            367314..367691
FT                   /locus_tag="P9515_04061"
FT   CDS_pept        367314..367691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04061"
FT                   /product="possible Phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71615"
FT                   /db_xref="GOA:A2BV04"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV04"
FT                   /protein_id="ABM71615.1"
FT                   /translation="MNKDNIKIIGRRQISREEALFFNLSEVEGLYDTFDKDFSIWSDFD
FT                   SWKNINAQQWIFSRAIDVYGGKKIDIKCECCESIYLTKSDLKITPNQKCYGVKSAYMIQ
FT                   KVLEEIILAKVRREHDGIYSA"
FT   gene            complement(367782..368582)
FT                   /locus_tag="P9515_04071"
FT   CDS_pept        complement(367782..368582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04071"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71616"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV05"
FT                   /protein_id="ABM71616.1"
FT                   /translation="MNVGSNYNDQFYKSLTNGSYISAKHYVSILSSVLIKPNKVVDIGC
FT                   GRGPWLKAFADSGAKELVGIDGDWVCQENMLDKKIKFHSIDLSSTVIKNPVNKKFDLAM
FT                   SLEVAEHLKPEQATTFVNYLTNFSETILFSAAFSGQGGTDHFNERPHSYWAKIFIKNGY
FT                   LPYDLFRSKVWENQEIEVWYRQNTFLYLKSNSKFEKIFKEKGIEPIRETALMNYIHPDL
FT                   YQIRVEESKQLTQLIIKLRKSTISGLIKRIMPKSIVNFLRKIRK"
FT   gene            369136..370188
FT                   /locus_tag="P9515_04081"
FT   CDS_pept        369136..370188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04081"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71617"
FT                   /db_xref="GOA:A2BV06"
FT                   /db_xref="InterPro:IPR005299"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042086"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV06"
FT                   /protein_id="ABM71617.1"
FT                   /translation="MVIAMTKGYSEQTAGAKLCIDLASDWAGQCIEALDIENNCFLMDY
FT                   GAADGGTASEFWGKIIKDIKERKTSSQISLIGNDLFSNDNQSLINNLSLHSSGQESAFT
FT                   LICAGSFYEQLVPNGLIDFGFSATAMHWLNKKVDTLDDHTHVLASNNKVAKNDFLEQAL
FT                   YDWNQILEMRSRELKVGGKLLTVNLSRDYEDRYLGNNGGRTVNVHDQIHSIWKELLNEK
FT                   IISEIEYKNGTIQNFYKSPEEFTSPLTNENSAAYKNGLRLLKERTVYVDCPYRKKWKEN
FT                   QNTEEFSIGLMETIRSWSRHSFVAALDENSERKVNPVDLLFDRLTCRINSDPENWSLDY
FT                   VEHHLMMEKV"
FT   gene            370188..371231
FT                   /locus_tag="P9515_04091"
FT   CDS_pept        370188..371231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04091"
FT                   /product="Hypothetical protein"
FT                   /note="COG334 Glutamate dehydrogenase/leucine dehydrogenase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71618"
FT                   /db_xref="GOA:A2BV07"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV07"
FT                   /protein_id="ABM71618.1"
FT                   /translation="MVNLQTHLKSEVGVLAEYISEELSVFIVAENKPVQYPSNGGLRLL
FT                   NYETDIECLQDGFRLANLMKSKHDIYSTGFSGGKVVARSPNISSVKEKLISVTSELLEN
FT                   LGGRMITGCDLNTDMNDMEKLFKLTPHVLAAVNSKVDASTATAMGVIGAFEAFKEFIPY
FT                   DLPNGVLVHGCGSVGSKVASELIKRDIKTYVVDIDTEKTYINGAISLGNDKNWYRKTFD
FT                   VILPCSISGLINTNISQFLLKTKAIISAANAPFGNDVIPEKLRNSNVIVIPDPLVNAGA
FT                   VIADSIERYAPVKWSNTRPEKIYDFVKNEVRKKCISYLALEQNGLSSLEILELIKNKKQ
FT                   QIIGEKF"
FT   gene            371236..372420
FT                   /gene="solA"
FT                   /locus_tag="P9515_04101"
FT   CDS_pept        371236..372420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="solA"
FT                   /locus_tag="P9515_04101"
FT                   /product="putative sarcosine oxidase"
FT                   /EC_number="1.5.3.1"
FT                   /note="COG665 Glycine/D-amino acid oxidases (deaminating)
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71619"
FT                   /db_xref="GOA:A2BV08"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV08"
FT                   /protein_id="ABM71619.1"
FT                   /translation="MNIKIPEHVDIAIIGGGMAGLSAAASLSEMGVKNIAVFESEKLAH
FT                   SEGSSFGESRMYREMYSDPVLCKLAKESNKLWAEQESIAKYSLRKEHGLLFYGESWDEE
FT                   TIEGSIPGAQKVMDEQNIPYEFLTSEKISERFPIKPKEHFVGLFEPSAGSILSDRAIEN
FT                   WIKIIRSNGNQIYEGCKIKRIEEKNNSLEIIGNQSVSFDQLIVASGMWTNELLEPIGLK
FT                   QDVKIWPMLWAHYLVDEDFINSYPQWFCFQKSRGDDGGLYYGFPVLSRNKNNIPRIKVG
FT                   IDWTSPKLIGGDEGAMKKPFMEPLIKMLDDFIINNFEGVIVCDETFVSPYTMTNDVNFI
FT                   LDKPKSNITVFSGGSGQSFKFAPIIGKCLAEKALNKNCSFDISCWEFDRFLTTK"
FT   gene            372429..372662
FT                   /locus_tag="P9515_04111"
FT   CDS_pept        372429..372662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04111"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71620"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV09"
FT                   /protein_id="ABM71620.1"
FT                   /translation="MFKQYFYKLKFSNLSFLKTMSTENNLEKSSQDYKKSQYGSWYKKN
FT                   AENKKKDKKEEKNKKEVKISFFKKIKSLFNNS"
FT   gene            372689..373156
FT                   /locus_tag="P9515_04121"
FT   CDS_pept        372689..373156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04121"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71621"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV10"
FT                   /protein_id="ABM71621.1"
FT                   /translation="MKLFDFFFKNLNKRAEIISEESLDNSNDLWADSVTTGWEYTCNLS
FT                   LTTPKICIVNDGFITNDTSVKPKLIGEPNNFGKDGDPSGDFGSWIRRHGHEEEFEELAN
FT                   ISQDMIYARPTDIGRIPPKSKLEVDFKSFLIDFRSIVESNISVEKKIIYDK"
FT   gene            373146..373400
FT                   /locus_tag="P9515_04131"
FT   CDS_pept        373146..373400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04131"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71622"
FT                   /db_xref="GOA:A2BV11"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV11"
FT                   /protein_id="ABM71622.1"
FT                   /translation="MINEELSIKSQAYKDIYKKLVREKKFPDSFFINILCELNGVESKT
FT                   ASILWEYGYLTKEQVLNAPYSELIEIKGLGKNLISKIKN"
FT   gene            373405..373596
FT                   /locus_tag="P9515_04141"
FT   CDS_pept        373405..373596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04141"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71623"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV12"
FT                   /protein_id="ABM71623.1"
FT                   /translation="MNTCSSVNSISLGKLLKKYNLTPKNKQKVILSAQRKISTWSGLHR
FT                   LARKLEFKQSAENQKLLN"
FT   gene            373596..373850
FT                   /locus_tag="P9515_04151"
FT   CDS_pept        373596..373850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04151"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71624"
FT                   /db_xref="GOA:A2BV13"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV13"
FT                   /protein_id="ABM71624.1"
FT                   /translation="MTEQKDNLERIYQKLNEEEDTVLKRWYESLIPKIILLFPLIAFAL
FT                   TFLKVNTDKSIFDLLIFIALGVLLVMGGILFNYFLSKGE"
FT   gene            complement(373912..374520)
FT                   /locus_tag="P9515_04161"
FT   CDS_pept        complement(373912..374520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04161"
FT                   /product="Hypothetical protein"
FT                   /note="COG398 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71625"
FT                   /db_xref="GOA:A2BV14"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV14"
FT                   /protein_id="ABM71625.1"
FT                   /translation="MVEALSGNWGILLILLLRFTSIVIPILPGTYCLLISGYLFGLVNG
FT                   LLISFIADLVACSISFSLSRRFGRKILQRVMSKKYLDKFENLSKKYLEKNLFLLTGFLM
FT                   TGWFDFVSYGVGLTKLRFRKFLLALIVSSLLSDLPFVATGNGFRELQNQNFNIKKIIDG
FT                   EVPSLQREYLIVFIVSVILIFSMGIIRNLIDRKYLKSTN"
FT   gene            complement(374611..375204)
FT                   /locus_tag="P9515_04171"
FT   CDS_pept        complement(374611..375204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04171"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71626"
FT                   /db_xref="GOA:A2BV15"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV15"
FT                   /protein_id="ABM71626.1"
FT                   /translation="MYVVDVTRKDWFQSNSVQGWVDILNKVKDTVNIALVENNSTKIDF
FT                   IGHSSGGVMMRLYLSDEPFNNKIFNGKSHTKNLITLGSPHQAVKATALRKFVDEKYPGN
FT                   FFKNINYISVGGEVEIKSKQTSLITKLVARGSYKSISGDKNANGDGLVPLSSSLLEGSQ
FT                   QIILPETVHGGLFGNNWYCSSSKVREWWKQIHWK"
FT   gene            complement(375393..375590)
FT                   /locus_tag="P9515_04181"
FT   CDS_pept        complement(375393..375590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04181"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71627"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV16"
FT                   /protein_id="ABM71627.1"
FT                   /translation="MANTINDIDIYYAVGNSNTKRQESEIASIMKIRNAAGWKLISTTT
FT                   AVVETKNQFSNLYLFWEKDI"
FT   gene            375836..377020
FT                   /locus_tag="P9515_04191"
FT   CDS_pept        375836..377020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04191"
FT                   /product="Hypothetical protein"
FT                   /note="COG1215 Glycosyltransferases, probably involved in
FT                   cell wall biogenesis [Cell envelope biogenesis, outer
FT                   membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71628"
FT                   /db_xref="GOA:A2BV17"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV17"
FT                   /protein_id="ABM71628.1"
FT                   /translation="MFFFLLVSIVTFMLALGTFLIERYSFNNAPFLENNNSEKPIETSL
FT                   TIIVPAYNEELNIIKCLKSLSEIKRPSENFKILVIDDLSTDKTFLEAKNLKEKIFKNSK
FT                   ELEIISSGERPQDKNWVGKNWPCYVGAQKTNSKWLLFIDADVILGKNCIHNALSKACAD
FT                   DIDLLSLAPKVNCNCLAEWMVQPIMTSLLMLGFPIYATNDSKNNSSFAAGPFMLFKRQS
FT                   YEFIGGHEGTFDEVVEDISLAKKIKSNNLKLNFLIAIEDISLNMYRDFNSLIEGWSKNW
FT                   FLGLEKDLLKSISGSIFVFLNFSVPWLLFITSTTLLINNYSFKIFCINLISALSLITYL
FT                   FKRLWLKAKYEIPSKYWYLNGIGGVIVVYISLLSIYKTYTGNGWTWKGRNLFKS"
FT   gene            377170..377376
FT                   /locus_tag="P9515_04201"
FT   CDS_pept        377170..377376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04201"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71629"
FT                   /db_xref="GOA:A2BV18"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV18"
FT                   /protein_id="ABM71629.1"
FT                   /translation="MEITLVGIGLLIGLVLSWIMGLSGGDVFIWIFCLYFGLEVGQLIF
FT                   SDDSNDDDDDFDGGILTPVFQSN"
FT   gene            complement(377373..378137)
FT                   /locus_tag="P9515_04211"
FT   CDS_pept        complement(377373..378137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04211"
FT                   /product="Putative dehydrogenase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71630"
FT                   /db_xref="GOA:A2BV19"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV19"
FT                   /protein_id="ABM71630.1"
FT                   /translation="MNLQIKEQTVLITGAGRGLGSEIAKSFHREGAKVVINYRKSFKSA
FT                   QKLSASLGENVILIQGDIREKDQVSKMHDELHNKDIKVDTVVHNAINDFVFNGDQRKKI
FT                   DTIEWQDFQNQIETSQKGFLNLLNIFNPNMKKNSFGRFISIGTNLFQNPVIPYHDYTAA
FT                   KGGLLSLTRTAAIDLGQFNITVNMVSGGLLKVTDASKGTPDSVFEYISSITPLRKVTTT
FT                   EDFSDAVLFFASPWSRAVTGQNLVVDGGLVLN"
FT   gene            complement(378588..378752)
FT                   /locus_tag="P9515_04221"
FT   CDS_pept        complement(378588..378752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04221"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71631"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV20"
FT                   /protein_id="ABM71631.1"
FT                   /translation="MNDLVLIREKINKARRLNQAKLLATKNGEVTPYKISVFMKRIKQS
FT                   QKDLKLQDS"
FT   gene            complement(378952..380301)
FT                   /gene="amtB"
FT                   /locus_tag="P9515_04231"
FT   CDS_pept        complement(378952..380301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="P9515_04231"
FT                   /product="Hypothetical protein"
FT                   /note="COG4 Ammonia permease [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71632"
FT                   /db_xref="GOA:A2BV21"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV21"
FT                   /protein_id="ABM71632.1"
FT                   /translation="MFKKLPAKIAIATLTVPAIQLIFASLAPIHASESNISDADNTLIL
FT                   TSSALVLLMTPGLAFFYGGFTQAKNVLNTMGMSFVMMGIATLVWSIVGFSLAFSDGGAS
FT                   NAFIGNPSTYAFLENLPLNWEGLQIPGLSFALFQGMFAIITPALISGALVERISFRFWC
FT                   FFTPIWILFVYAPLAHMVWGGGLLGKDLDFAGGTVVHISSGVSALVLASLAGSRRNWPR
FT                   GIKPPHDITQILLGTGLLWFGWFGFNGGSQLSVGGAELPFTTTHVSAAAGLVTWALIES
FT                   IKDGKASAIGMATGAVAGLVGITPAAGFVNPSSGMLIGAITSGICFLSLKLKIKLSFDD
FT                   SLDTFAVHGVGGTVGALLTGLFAKSELIATHPAGLVLQEQGRIALILGQLQAVLIAYAI
FT                   AAIGTLIIALVLKSLGCSFRVNETDEEDGLDISQHGEEAYGEKTGSPKTI"
FT   gene            380836..381093
FT                   /locus_tag="P9515_04241"
FT   CDS_pept        380836..381093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04241"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71633"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV22"
FT                   /protein_id="ABM71633.1"
FT                   /translation="MTNKFYQWWKNHRRVVTFGGFLLLLGFYLSPVIKEAKYKNICISI
FT                   SEKGALNKFKGDDIGETLLKETGLTIAELAKIEGYKNCIK"
FT   gene            381126..381257
FT                   /locus_tag="P9515_04251"
FT   CDS_pept        381126..381257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04251"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71634"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV23"
FT                   /protein_id="ABM71634.1"
FT                   /translation="MKPKENKVKAIDQIIKIIHDFKYNNELSEKYKREILDQDKIYE"
FT   gene            382357..382785
FT                   /locus_tag="P9515_04261"
FT   CDS_pept        382357..382785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04261"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71635"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV24"
FT                   /protein_id="ABM71635.1"
FT                   /translation="MRKFRNLLLSAITISSVLLPLEIAKAQEKIEVIPLIKSTKGLGGK
FT                   KIFYPRWKQAELRFFKVIIPVGAKTPIHIHPAPMVVYLAQGELKHTRGDVINYFSSKQS
FT                   LIESNNGDEHFVENIGSKPAVLYVVAASAVGLPTTINK"
FT   gene            382846..383109
FT                   /locus_tag="P9515_04271"
FT   CDS_pept        382846..383109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04271"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71636"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV25"
FT                   /protein_id="ABM71636.1"
FT                   /translation="MEKLFIVCTFDCSFQYYEETIHRWVKEQGEGTVIDYELVKINDHK
FT                   SHSFFTVSNLEEFSEILDSEWAREWDKANNCKDIVYKIELIE"
FT   gene            383514..383654
FT                   /locus_tag="P9515_04281"
FT   CDS_pept        383514..383654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04281"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71637"
FT                   /db_xref="GOA:A2BV26"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV26"
FT                   /protein_id="ABM71637.1"
FT                   /translation="MITKKEETEYEKPKLFRIWNVLIYGSFFSIGAFLVYLYSAYIFIN
FT                   K"
FT   gene            383902..384069
FT                   /locus_tag="P9515_04291"
FT   CDS_pept        383902..384069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04291"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71638"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV27"
FT                   /protein_id="ABM71638.1"
FT                   /translation="MIFDLRYGEISKFFMSSTMRDFLDKFFDLCREYQEEISPQKMAEV
FT                   LRDYADRLDG"
FT   gene            complement(384508..384630)
FT                   /locus_tag="P9515_04301"
FT   CDS_pept        complement(384508..384630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04301"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71639"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV28"
FT                   /protein_id="ABM71639.1"
FT                   /translation="MKNLNLIKKEPSKKDREISFQNPSKLLAEFFNGVVIKLEE"
FT   gene            complement(384636..384926)
FT                   /locus_tag="P9515_04311"
FT   CDS_pept        complement(384636..384926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71640"
FT                   /db_xref="InterPro:IPR012447"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV29"
FT                   /protein_id="ABM71640.1"
FT                   /translation="MTLGGANVWTNFSYGYRNESPSGWLLKPDRSRLILFTRNKKSGRN
FT                   NIRIFAHTYYTNDLGEPMAIKSSSQMYLDDAWNKWHDLQLEGWTFEELELP"
FT   gene            385096..385500
FT                   /locus_tag="P9515_04321"
FT   CDS_pept        385096..385500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04321"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71641"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV30"
FT                   /protein_id="ABM71641.1"
FT                   /translation="MGKETSQLTEKEALSIYARMMHTLDSSEFESFLSEDFSYSSQKVL
FT                   TDMNSKDEFIEYIRPKLEIIKKTKSAVYAELGVCPAYGHTDCLILAQGDKSNLLGVAYA
FT                   SVDKGKICSLALCIVPTHNSAERSGIYPGL"
FT   gene            385582..386436
FT                   /locus_tag="P9515_04331"
FT   CDS_pept        385582..386436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04331"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71642"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV31"
FT                   /protein_id="ABM71642.1"
FT                   /translation="MIDLKRNSKKEPVKATGLRTRASSSYSPNQKQDFKISRGRFSNFL
FT                   TCKRCFYLDRVKGLDPPGTPGWTLNETTDLLLKKEFDFCRERQIPHRLFIDNDLSHLVP
FT                   FDHPQIDDWRNSLHKGLMLRHKDTNIILTGGVDDIWQHKITKQLIVVDYKSQAKLGRVD
FT                   KKDYLDDPYHAGYKIQMDFYAYLLKGMGFDVHKTAYFLVCNAKRDDEEFNKRMNFDEYL
FT                   VPYDWNVDWIEEEIDEMVALMNNEKIPEPNLSCKNCAYSEQYAKLVYNPLKIEGEEIQG
FT                   NLF"
FT   gene            complement(386486..386821)
FT                   /locus_tag="P9515_04341"
FT   CDS_pept        complement(386486..386821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04341"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71643"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV32"
FT                   /protein_id="ABM71643.1"
FT                   /translation="MLPYKNVKSKSDKYYCLEPKYICSNKDFRLEVFMKKECDLMPLID
FT                   NSYYFYGEKWQQKDIVTQSRFLPKLRRKVNDKLGSDKSKEVCEKGLKITNLRQFNKLYK
FT                   EYFGNKN"
FT   gene            complement(386975..387154)
FT                   /locus_tag="P9515_04351"
FT   CDS_pept        complement(386975..387154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04351"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71644"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV33"
FT                   /protein_id="ABM71644.1"
FT                   /translation="MELFTRENIGNYTSDPDAKNDHKYCKEMQEIRKELRKLDQETKRD
FT                   GGVIDWNYMLNDMM"
FT   gene            387408..388190
FT                   /locus_tag="P9515_04361"
FT   CDS_pept        387408..388190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04361"
FT                   /product="probable periplasmic protein"
FT                   /note="COG2859 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71645"
FT                   /db_xref="GOA:A2BV34"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="InterPro:IPR016907"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV34"
FT                   /protein_id="ABM71645.1"
FT                   /translation="MKIIKKLRSLPSDSLSVIRRTPPLVFAMAVLSLGGFIGASTVLVK
FT                   GFRTVENTITVTGASTESFESDIAKWSVQVKTSGKTQIDSFTKHKQSIKKTMEFLKANG
FT                   IEDSVKQDVYLGPASISEYTTKHPKTNEIIRTEWITYQNIEIESRDVYNIQKTHSQITE
FT                   LLGKGVRVKPSRPEFTYSKLADKRVDMLAKAAKDARVRAEAIALQAGSEVGGLKRVNTG
FT                   VFQITVPNSTRVSSWGSYDTSTIKKDITAVMGVTFAVK"
FT   gene            complement(388287..388478)
FT                   /locus_tag="P9515_04371"
FT   CDS_pept        complement(388287..388478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04371"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71646"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV35"
FT                   /protein_id="ABM71646.1"
FT                   /translation="MPLSSYRMHKIYLAAIMNYGLGSDDPEELAYYNKLRKEMDEIEKD
FT                   AVKKGIPLTWDIPDGMDK"
FT   gene            388795..389220
FT                   /locus_tag="P9515_04381"
FT   CDS_pept        388795..389220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04381"
FT                   /product="Hypothetical protein"
FT                   /note="COG3727 DNA G:T-mismatch repair endonuclease [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71647"
FT                   /db_xref="GOA:A2BV36"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV36"
FT                   /protein_id="ABM71647.1"
FT                   /translation="MSSEVIHKVSEQRSRNMSAIKSKNTKPEIAVRKLLHSMGYRFRLH
FT                   RKDLPGSPDIVLPKYKTAIFVHGCFWHRHANCKYASTPKTRKEFWENKFRANVKRDLEI
FT                   QEKIKIMGWKSVVIWECEIKNKSIFEKNFNNLFLDDF"
FT   gene            complement(389217..390023)
FT                   /locus_tag="P9515_04391"
FT   CDS_pept        complement(389217..390023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04391"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71648"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV37"
FT                   /protein_id="ABM71648.1"
FT                   /translation="MNNLKLLTRSSVSLLTGKASDANLANENIQKYSSYSNPFLNELEQ
FT                   YEFFDTQLKPIEEKFLDSSNDFITAKYLFETLKIDRIQASDSRLWITLTHRDSWSYMQK
FT                   RWNLKDSDKGTNLNNKILSRWHLDGSPRNALARNGLSRLWWAAELTYAPWEKDSELECF
FT                   RCEDPYKYTKIITENKKSQALFDVLDREFGGSPLFRICYLEAFSILVDQRGLAPTIASA
FT                   KLSVLFNALLIPRSVSAHKESPENLLERILNLQKYIPNKKIENDTI"
FT   gene            complement(390020..390943)
FT                   /locus_tag="P9515_04401"
FT   CDS_pept        complement(390020..390943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04401"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71649"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV38"
FT                   /protein_id="ABM71649.1"
FT                   /translation="MPSSTSKQISYPCPVIGNEGDYQSTAKMDIDYAVEKFPKKIIFRF
FT                   YKPSISDTKIQNLFDEGQLSFFVELNSPATFSLICKELDFNNKNKEEITFDYGVLNNRV
FT                   RVRFFLSSIKELDVAPTLLANDYPKRNFIAKELNILGKSKSKFENIPHRFDPFEAEPES
FT                   IFLITPNTNKTIKEPIHDFTQEKILIKLPEDTFKQYQSIKRKSLGPFIYNNIVLPALQM
FT                   AIHYIEILKSAEEKLSEAELNAQIEYASYVNKGWFNNLCELIDENNLQGTPFEKANKIL
FT                   KSPLISLIKSKYEEHQSQIDDEILGE"
FT   gene            complement(390943..392997)
FT                   /locus_tag="P9515_04411"
FT   CDS_pept        complement(390943..392997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04411"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71650"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV39"
FT                   /protein_id="ABM71650.1"
FT                   /translation="MSIFNYSNPWNFPSLGYGKEKGLNNASDIFKHLDNVGLETAQNSR
FT                   NSCMKDDNGEDVEVSVEYRLKNIESRFFPGIEDYKKRLESAIEYFQNKEASSGSNKPIG
FT                   KEIIQLSRALRILNQDTIPVLTIRDYGTKGLKGGEDEDFAPYFRLIKSTGISAAQGTKA
FT                   GRFGHGQNALVAKSDIKAYTLFSQFTNEYEEKETLFAGNSILCSHIDPTQNYKTQETGF
FT                   IGNVINPNKFVSYRNNDLLNINFPYERSTNGTDIYIWGFKHESDNWDLLLAKGLIKGFF
FT                   AAIREKLINFKIINDNTNEILHEINHENLDEYYSTLEVQVKKRLSSKAWNKEMQSIYGF
FT                   LKTTCNEHSISITGKRSTHLIDVKKIGKVEMTLYQDKDDQKLTKEWCIMRQPLMKIRNF
FT                   SKPIGIPFNAVVKVLSDKGNDVFMDLEDPTHLKLVRDYCDEEYVNEYWSIYQDLSKKVQ
FT                   IIIENLDPLSSQTQDIPGLADLIPDLRTGIGDGSFFSSQEGIPNTNNKEGFNPSIITDS
FT                   NKSTITSIQKNSSSISTKRTASSQGTSGGTVGTVKTDKKVNPQGGNPGSGAGDKQGNAK
FT                   FDPKGKKESLTINEDIKIRLLRNSSTENRYLLRIIALQDIHGDINLGMVVNNEKKSCVP
FT                   LPVESKISFNRKEIQWHENKIKDIKMQTNEFYDCEIVLPNSAEFAISTI"
FT   gene            complement(392998..393225)
FT                   /locus_tag="P9515_04421"
FT   CDS_pept        complement(392998..393225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04421"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71651"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV40"
FT                   /protein_id="ABM71651.1"
FT                   /translation="MATKNNSEHFIELANKRVPKALKYLDLVGNLANKSNYSYTEQQSQ
FT                   QIKKALKDKVNEICRKFDSGTNNDSSFKLL"
FT   gene            complement(393288..393593)
FT                   /locus_tag="P9515_04431"
FT   CDS_pept        complement(393288..393593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04431"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71652"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV41"
FT                   /protein_id="ABM71652.1"
FT                   /translation="MSTRFTLIYSFYFSIMTSKSIAQDLNSVESRRDIFCRLANSRVEK
FT                   VAYALDILSKLSSRRSDYTEEDIKNIKKFLQSELDKALAAFTPANETGKKTFVLKA"
FT   gene            complement(393777..395846)
FT                   /gene="dcm"
FT                   /locus_tag="P9515_04441"
FT   CDS_pept        complement(393777..395846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcm"
FT                   /locus_tag="P9515_04441"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="COG270 Site-specific DNA methylase [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71653"
FT                   /db_xref="GOA:A2BV42"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV42"
FT                   /protein_id="ABM71653.1"
FT                   /translation="MIHKNAVGKIDPHRLTPVRGPSTELDPHIDSCEFDELPGYAAKVR
FT                   SLKKDPNFAVDLFSGAGGLSLGLHRANFDVILACDIRNDSIMTHRHHFGGCSYECDLSK
FT                   RKVVNEIADKLNECGEISLIAGGPPCQPFSRNIKWRKHNEEVSAQHQELNEDRRELWES
FT                   FISIVEQVKPKAFLMENVSDIAQGGEQEIFRSIINRAEKAGYRIDPKLIYAWQYGVPQL
FT                   RPRLFISGTKINECAPMKWPKPTYNSVDKAVTLEDAISDLPPLEGGWNEKWDERYSYGG
FT                   PITPYQTSMREWLEIDDDVIHDHLIRKVREDDLETFKLMRSTGVKYSQLSEAQRRYSVT
FT                   SRAFREGKKVKENQKNSFGDKYNILKPNEPCLTITAHMSKDGYWYIHPQQNRTLSVREA
FT                   ARVQSFPDGFNFHGGPSNRFHQIGEAVAPIVAYELGKALIKSIKNKKDYMQADLVPQLR
FT                   KNLISWYELNKKEVELIWTKKREGRKIIPNEVRAWNACLGILLPETFKKDHKDKKKKNV
FT                   GESDKNLEGRKKETYRQLKKSWPNPESFLHDNIKMRTMKIKSFSLEKYIPSLELLAEDL
FT                   NKDEIDWSEIARKDYGLFSRNSVRGALATVGLTTEIKQSLVITKIISKLMDLDYEKLKF
FT                   SNMNREIHIGHLLEKDSEGTGYCSLLALSKQEDTDEIIQNKLKLLPKEQKIEAA"
FT   gene            complement(395843..396556)
FT                   /locus_tag="P9515_04451"
FT   CDS_pept        complement(395843..396556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04451"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71654"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV43"
FT                   /protein_id="ABM71654.1"
FT                   /translation="MREELFRLKNPLINSGLISALRYPESIGLEKVESEVDLTDLSKLV
FT                   DQLILENIKGSNLDERLVECVHKTFKPLPSHVLTDMRMWHWLCVIKYPNIPWLRWRGSI
FT                   PIDPEDGFTVGTGKKHVPSIRFLGTSSINGHGRNTFSRLFFAADRMMDKSQSDYTLVKK
FT                   LFTSQELHLGLSDREFGLIPKINRVLTEKLVELPDSKVRIAIRKLNSLGGSICLDLLSE
FT                   EQLQKLIDIQDKEAS"
FT   gene            complement(396553..397584)
FT                   /locus_tag="P9515_04461"
FT   CDS_pept        complement(396553..397584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04461"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71655"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV44"
FT                   /protein_id="ABM71655.1"
FT                   /translation="MHFVPWRTIDLDGAFRITAPESISEEVIQEVSNGIIFKFNGKLEK
FT                   TKLEILLTAPYEWEETIHPSERENPPVKFICRLISRSTGRRETIDLEDGGGGFFFSEIS
FT                   YIPFMNGEEIRAEALLVRTEKFKGSDSKSGYASEMGQIIGRSLIHTIRFANAEISNESI
FT                   FDIRWQSFPSESRDQLWRLIPSEPPVIEMNEDVTASLKKLLMSKSLRKDTNCLQRDVIF
FT                   TSICSTVWTMLVATAMNSIQNILNTNRELSSEEVIEQLPQSQLQTLSLFSNSLLETNIS
FT                   PNEAVIALANELRSPESFQNLILKMSSIIQQETKIMELAEIMARGCSFESESSKMPKKE
FT                   EVA"
FT   gene            complement(397587..399551)
FT                   /locus_tag="P9515_04471"
FT   CDS_pept        complement(397587..399551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04471"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71656"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV45"
FT                   /protein_id="ABM71656.1"
FT                   /translation="MSEEDLNTTKTPLKWIGTPSLGQGRSSGGNAASEIFEAGASQRKR
FT                   SLLETLVREICQNSLDQRKDKKVKIFFDLIILKGEKKEEFLKSINSETLIPHLSSVKGS
FT                   SGTALTLKAGLESMKSSDLVCLRISDYGTDGLTGDDWDEKGNFRKLCVQNFSTGKESGL
FT                   GGSFGLGKAVSWMHSRIFTVLFSSRIEGEKDLRIFGRSELPAHEMNGKSWLDGAYMGSE
FT                   IKKDGIPVAESTWLKDGDAEKILLNRDNETECGTTILIPTFHEPDRDDTGSSGIREPEE
FT                   LCRDFTEAASKWFWPAISWKRLDFKARVFREEGKSAEFVSEAAANGIWSSFVECGRVEP
FT                   FENTKSLFPGDSSSIDIEFPIPARVEPSDNPELLHDELKSFVRLGVTRVSSKEESLPCR
FT                   STIALIRGSGMVVDYAEGTRLNDGGSYCAAAFVGTSLNEIAESEKTELNKENALFAEEY
FT                   FRAGEPVTHDDWLPTTRRLRESYTWKGHANRLRGIRYELRQILIQNLLTSFVSRPDEGP
FT                   EMLRRMLNLGRGMKQKKIQSKARNSSLEVVIDRQRSFFNKKTNGWRITGELVRSGDSKR
FT                   SAKVHLSFQSIADSGQGEMWGISDMQILGSEKHISLDDSDSKRFVFSAENQFSSVPFEC
FT                   TVKPPIGVNPEIAGFRKVG"
FT   gene            complement(399717..399998)
FT                   /locus_tag="P9515_04481"
FT   CDS_pept        complement(399717..399998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04481"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71657"
FT                   /db_xref="GOA:A2BV46"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV46"
FT                   /protein_id="ABM71657.1"
FT                   /translation="MRVVPLPDKAREIIEELQEREGRIIDLTKGSARHGFDKARKKAGL
FT                   ETLRFHDLRHIAISRMWSSGMNATEISACSSHRDIKMLMSYSHFQLSI"
FT   gene            complement(400298..400369)
FT                   /locus_tag="P9515_tRNAThrVIMSS1309113"
FT                   /note="tRNA-Thr"
FT   tRNA            complement(400298..400369)
FT                   /locus_tag="P9515_tRNAThrVIMSS1309113"
FT                   /product="tRNA-Thr"
FT   gene            complement(400381..400462)
FT                   /locus_tag="P9515_tRNATyrVIMSS1309112"
FT                   /note="tRNA-Tyr"
FT   tRNA            complement(400381..400462)
FT                   /locus_tag="P9515_tRNATyrVIMSS1309112"
FT                   /product="tRNA-Tyr"
FT   gene            400564..401004
FT                   /gene="aroQ"
FT                   /locus_tag="P9515_04491"
FT   CDS_pept        400564..401004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="P9515_04491"
FT                   /product="Dehydroquinase class II"
FT                   /EC_number="4.2.1.10"
FT                   /note="COG757 3-dehydroquinate dehydratase II [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71658"
FT                   /db_xref="GOA:A2BV47"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BV47"
FT                   /protein_id="ABM71658.1"
FT                   /translation="MNILLINGPNLNLLGTREPEIYGSKTLNDIENDLSSIANDKIINL
FT                   ECFQSNHEGEIVDKIQDSIKNVQGILINAGAFTHTSISIRDALIGSKIPFVELHISNIF
FT                   SREEFRKESFLTDKAIGIISGFGISSYSLGLYGIIEYLKNKK"
FT   gene            401005..401613
FT                   /gene="miaE"
FT                   /locus_tag="P9515_04501"
FT   CDS_pept        401005..401613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaE"
FT                   /locus_tag="P9515_04501"
FT                   /product="putative tRNA-(MS[2]IO[6]A)-hydroxylase-like
FT                   protein"
FT                   /note="COG4445 Hydroxylase for synthesis of
FT                   2-methylthio-cis-ribozeatin in tRNA [Nucleotide transport
FT                   and metabolism / Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71659"
FT                   /db_xref="GOA:A2BV48"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV48"
FT                   /protein_id="ABM71659.1"
FT                   /translation="MIVENKRPDFQIKHLTSSTSDVWIKLALSNPIDILIDHAHCERKA
FT                   AGVAIQLMFRYPTEPNLSEVLSPIAREELEHFEKILYFLKDLGHSLKALKPPPYGSELA
FT                   KNVRKEEPHRMLDSFLIAGLIEARSHERLSILSLNSENKSFRVLYKSLLESEARHFGIY
FT                   WKLAKNKFSKDETGKRLKELAKIESEILSETYFLPRVHS"
FT   gene            401639..402403
FT                   /gene="cobI"
FT                   /gene_synonym="cbiL"
FT                   /locus_tag="P9515_04511"
FT   CDS_pept        401639..402403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobI"
FT                   /gene_synonym="cbiL"
FT                   /locus_tag="P9515_04511"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /note="COG2243 Precorrin-2 methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71660"
FT                   /db_xref="GOA:A2BV49"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV49"
FT                   /protein_id="ABM71660.1"
FT                   /translation="MMKIKNFLYRFLIKKSNFGSLTIVGVGPGHSSLLTIAAVQAIKKA
FT                   KVIVFPISSDDKKSSAAEIVKDYIKFKKKIPIVFPMARQEFEPDEIWSNAVDIIVKSIK
FT                   NNKSVALLCLGDTSIFASSSNILRIIKNNHPEIITRTIPGISSFSAAAALSNFNLASKG
FT                   ETLIIKECPSHKKELVDLISINREKKTVLVLLKVGKRWEWVKTLLKKEDIFSKTVIAIN
FT                   VGMPSQIVQEASKFDLNKVPYFSLLLMRFNDD"
FT   gene            402393..402884
FT                   /locus_tag="P9515_04521"
FT   CDS_pept        402393..402884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71661"
FT                   /db_xref="InterPro:IPR014952"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV50"
FT                   /protein_id="ABM71661.1"
FT                   /translation="MMIRKAYYLPEKKFTWPLSKKLLFSILDDQVSDVFVCELIWERLF
FT                   YIKEKPIENWICSEYTPSYWSEKYNNSPQIISERGASIHLTRSIPKDHKQNLKKVLDFK
FT                   GYKINELTPRKTRRATAVNWLICWVIEYESMLKEYDKLPILSSPPFNPMHGHKGDPEIK
FT                   "
FT   gene            402957..404333
FT                   /locus_tag="P9515_04531"
FT   CDS_pept        402957..404333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04531"
FT                   /product="GTP-binding protein (HSR1-related)"
FT                   /EC_number="1.1.1.95"
FT                   /note="COG1160 Predicted GTPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71662"
FT                   /db_xref="GOA:A2BV51"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BV51"
FT                   /protein_id="ABM71662.1"
FT                   /translation="MTLPSIAIIGRPNVGKSTLVNRLCQSNDAIVFDKPGVTRDRTYQN
FT                   ASWGGKEFQVVDTGGLVFEDDSEFLPEIRTQVFLALEEASIALFVVDGNQGVTTGDLSI
FT                   AKWLRNSDCKTIVAVNKCESLSLGISMASEFWKLGLGEPYPVSAIHGSGTGDLLDLVID
FT                   ELPKDFDVEDKEDKVMMSIIGRPNVGKSSLLNAICGEKRAIVSDISGTTTDSIDTLIKK
FT                   NSHLWKIVDTAGIRRKKNVKYGTEFFGINRAFKSIDRSDVCVLVIDAIDGVTDQDQKLA
FT                   GRIEEQGRACVIVVNKWDLVEKNNSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVEN
FT                   IFEHALNAVTQHRMRVTTSVVNEVLKEALGWKSPPTKRSGKQGRLYYGTQVKNQPPTFT
FT                   LFVNDPKLFGITYRRYIEKQIRLNLGFEGSPIILLWRGKQKRDLEKETSKKNINIIQKD
FT                   "
FT   gene            404333..405247
FT                   /gene="cbiQ"
FT                   /locus_tag="P9515_04541"
FT   CDS_pept        404333..405247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="P9515_04541"
FT                   /product="possible cobalt transport protein"
FT                   /note="COG619 ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters [Inorganic ion
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71663"
FT                   /db_xref="GOA:A2BV52"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV52"
FT                   /protein_id="ABM71663.1"
FT                   /translation="MNILTKFSIGQYVDGNRSWLRIIDSRLKIIAVLIFLITPIWAGPL
FT                   WRLSLVICLILITFVSLLPSRVWWRSLALLLGLSLLIGFLSLIAAADIQSLDSPYRDPN
FT                   ELNLILENQEKWNILEISSKKIGFITIGPYNLSRKAFELGIKTSTLIFTVIHSVNLMLL
FT                   TTLQEDIVWAFSWFMNPLRKVGLPIDKWLFQLLLALRFIPLVQEEFQNILKSVSVRSIN
FT                   LRSLGFKKSINVLLTMFERLFLNIFLRIDQGADSLLSKKNILIKTNRLKTIDKKNHLTL
FT                   IINSLSIFFICVAIFLRKQYGAL"
FT   gene            405266..405532
FT                   /locus_tag="P9515_04551"
FT   CDS_pept        405266..405532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71664"
FT                   /db_xref="InterPro:IPR021926"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV53"
FT                   /protein_id="ABM71664.1"
FT                   /translation="MSSESYLNHPTFGMLYQVSPGNEGKYIYATLYAQKMFFLVENKER
FT                   EFSFEVIRYLDARNQSELNLQRSRKKTPEDYQKWENLFKQTFL"
FT   gene            405536..406174
FT                   /locus_tag="P9515_04561"
FT   CDS_pept        405536..406174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04561"
FT                   /product="Predicted enzyme with a TIM-barrel fold"
FT                   /note="COG325 Predicted enzyme with a TIM-barrel fold
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71665"
FT                   /db_xref="GOA:A2BV54"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV54"
FT                   /protein_id="ABM71665.1"
FT                   /translation="MEISNYLQIKKELPLNVNLLAVSKGFGSQDIKIINDKGQNDFGES
FT                   RFQEAIEKKLLLKDFKDIKWHFIGRIQSNKIRKIVQNFDYIHSVDSYEKLLKISNIAFE
FT                   EHKNPLIMLQVKLMDDPSKGGFNPKDLLGKWDEIKQLKSIKIKGLMTINPKGLNSTQNI
FT                   KLFKECRNLANSLKLHDCSMGMSQDWKEAVEAGSTWLRLGSIIFGNRSY"
FT   gene            406331..406906
FT                   /locus_tag="P9515_04571"
FT   CDS_pept        406331..406906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04571"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG1799 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71666"
FT                   /db_xref="GOA:A2BV55"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BV55"
FT                   /protein_id="ABM71666.1"
FT                   /translation="MSLISRLKAVVAGDDYLDDDFDELDYASEDELNGVNDYKENRKNS
FT                   NALSNSNPFDFMNNNRSSNVVGMPGISNSSSEVSLMEPRSFDEMPQAIQALRERKTVIL
FT                   NLTMMDPDQAQRAVDFVAGGTYAIDGHQERVGESIFLFAPSCVNVTSSFPEEVSPSNIS
FT                   SKKTSPYSLETNTTPEPAWGESKLSAFS"
FT   gene            406914..407726
FT                   /gene="proC"
FT                   /locus_tag="P9515_04581"
FT   CDS_pept        406914..407726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="P9515_04581"
FT                   /product="Delta 1-pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="COG345 Pyrroline-5-carboxylate reductase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71667"
FT                   /db_xref="GOA:A2BV56"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV56"
FT                   /protein_id="ABM71667.1"
FT                   /translation="MTSKIAVIGFGNIAKAIITPLFDKKILNPKDFYCLVNTKKSLENI
FT                   RNNYKYNINIFQANSKDSEIIWDCPVKILSVKPQQLKNIIELEKNKNNRNLLVSILAGV
FT                   SLEKLIKRFPNHKCVRVVTNIPITIGKGSTGIAWGDEISENQKEAVRRLFENTSKINEF
FT                   PEDLLDIFLALTSSGPAIIALIIEALSDGGLSGGLPKQLSEELVMDMILGTISLIRETN
FT                   LTTTELKNMVTSPGGTTISALRVLENKSLRSALIEAVVSASNRSKEFR"
FT   gene            complement(407723..408889)
FT                   /locus_tag="P9515_04591"
FT   CDS_pept        complement(407723..408889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04591"
FT                   /product="possible Glycosyl transferase, group 1"
FT                   /note="COG438 Glycosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71668"
FT                   /db_xref="GOA:A2BV57"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV57"
FT                   /protein_id="ABM71668.1"
FT                   /translation="MVHIAWLGKKSPFCGNVSYGNLTTEQLKVKGHKVSFIHFDNPSSA
FT                   NESKPLFLANDPEVSLPYLIKSQVYTIPSPRAETELRHSLERLKPDIVHASLTLSPLDF
FT                   RLPELCKQINLPLVGTFHPAFDKKNRNLTASTQQLTYQLYAPSLAKFDKIIVFSEPQKT
FT                   LLENLGVSKEKQIIIPNGVDENIWQPMKVKSKKYNSVKSKLGEGRIFIYMGRIANEKNI
FT                   EALLKSWRQTKTNNCKLVIVGDGPMKPTLENSFSNLGKDKLIWWGSEIDLETRVAIMQI
FT                   AEVFFLPSLIEGLSLSLLEAMSTGTACVATDAGADGEVLDKGAGIVISTDNVVTQLKTI
FT                   IPILIDHPSFTKALGEKGRARVIERYTIKKNIQALEQLYLDIIKASKV"
FT   gene            complement(408975..409754)
FT                   /gene="recO"
FT                   /locus_tag="P9515_04601"
FT   CDS_pept        complement(408975..409754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="P9515_04601"
FT                   /product="possible Recombination protein O (RecO)"
FT                   /note="COG1381 Recombinational DNA repair protein (RecF
FT                   pathway) [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71669"
FT                   /db_xref="GOA:A2BV58"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV58"
FT                   /protein_id="ABM71669.1"
FT                   /translation="MLGESRLKGLCIKASPLGESGRLITVLTDEQGIIRLAAPGARRPK
FT                   SSLAAATPLTYLSFQIFGKRSLKSVRQIKILKSYNGLGKNIECLAAAQAITELTFLLVG
FT                   NNDKQKDYLPSLLIHLDRIYEYKIESEDDFKMLSMSIQSLIHLLAIGGINIPVNFCCST
FT                   GEPIIPPLGNWDWKCSYLPNEGFSTVEKTESALKVNASEIALLQRLIFAELPIKSNGEL
FT                   LGPKNVWLKILSIVESWIAAQLEKELSSLKMLRDFYS"
FT   gene            complement(409755..410414)
FT                   /gene="deoC"
FT                   /locus_tag="P9515_04611"
FT   CDS_pept        complement(409755..410414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="P9515_04611"
FT                   /product="Putative deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="COG274 Deoxyribose-phosphate aldolase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71670"
FT                   /db_xref="GOA:A2BV59"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV59"
FT                   /protein_id="ABM71670.1"
FT                   /translation="MFNIDYELNEKIHAIIINPYLSLEELNANCALIQKYNIKNVSTSL
FT                   NFLSHIKNVLGNYKLNINSLISYPFADLPFEFIDEFVCYAQDAGATGIEYTPNFLNLSK
FT                   NNLNNFASEIESINASELKVTIIINKSKLDKELFEKAIKISLELGITNFQFGDGFGPAI
FT                   SNVDIVEILKFVGIQNSIKVVGGIKTLSQVIDFFDLGIDCIGTSNFDEIFKEIKRI"
FT   gene            complement(410421..411005)
FT                   /gene="lrtA"
FT                   /locus_tag="P9515_04621"
FT   CDS_pept        complement(410421..411005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrtA"
FT                   /locus_tag="P9515_04621"
FT                   /product="light repressed protein A-like protein"
FT                   /note="COG1544 Ribosome-associated protein Y (PSrp-1)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71671"
FT                   /db_xref="GOA:A2BV60"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV60"
FT                   /protein_id="ABM71671.1"
FT                   /translation="MKILIHGKNIELTGALKEYTEAKIEKATHHYKDIVKEADIHLSIE
FT                   KNPRLSYQTAEVTIFASGTIIRAEEKTENLYSSIDLVSNKLCRKLRKYKERHYKNLNYN
FT                   LEKNKHSFTNTNEHLDSIDKNIFNDKREAKLPEPSIKNKYFEMIPISLEEARKQLDLID
FT                   HDFYVFRNKKNNELQVIYKRKHGGYGLIQSK"
FT   gene            411050..411694
FT                   /gene="lipB"
FT                   /locus_tag="P9515_04631"
FT   CDS_pept        411050..411694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="P9515_04631"
FT                   /product="putative lipoate-protein ligase B"
FT                   /note="COG321 Lipoate-protein ligase B [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71672"
FT                   /db_xref="GOA:A2BV61"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BV61"
FT                   /protein_id="ABM71672.1"
FT                   /translation="MINRTSIIKQPDKISSFCDVYKLQKKYQDALISGKSNIDFIWLGE
FT                   HQLCYTIGRGSNMGNLLFSLDEQDVFKIDRGGEVTCHMPGQLVTYLVLDLHNFNKDLNW
FT                   YLRKIEKIIIKVLSSFNIDSSTKDGFTGVWTGERKIASIGIGCKRWVTIHGFSINVNCK
FT                   LENFDKIVPCGIQGCQMANMSDYKKNLDIKEVKIIVKKIIQEEFYFNFISE"
FT   gene            411726..413651
FT                   /gene="fadD"
FT                   /locus_tag="P9515_04641"
FT   CDS_pept        411726..413651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="P9515_04641"
FT                   /product="putative long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /note="COG1022 Long-chain acyl-CoA synthetases
FT                   (AMP-forming) [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71673"
FT                   /db_xref="GOA:A2BV62"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV62"
FT                   /protein_id="ABM71673.1"
FT                   /translation="MNELAYWPASKSHPKNEKFIRERKYINNLVHVDQIWEYLKFKCGD
FT                   TLAINDLRGKNKEKYSYSELANLITKVSLSFKTYGLVKGDVVTVISENSPRWLIADQGL
FT                   MRLGAINAVRGINSPSVELEYIIDHSKSVGLIVQSKEVWLKLNEKEKLKKRFKFIINLE
FT                   DEQFEDLINWQEFIKVGDKGYFENNSFEKDNNQINDIASILYTSGTTGKPKGVPLTHAN
FT                   FLHQIINLAYIADPETGTSVLSVLPIWHSYERSAEYFFFSCGCTQFYTNPKFLKDDIKK
FT                   VKPVVMATVPRLWEAIHDGFFLALKKMNPKKQKTIKFLIKNSSIFKRNLRKIRNIEINQ
FT                   VSSLAKICLIISVLGRFFLHKISSTFLWPSILKQLCGEKLKFPINGGGALPEHVDLFFE
FT                   SLGIDVLVGYGLTETSPVLTCRRRELNVRGSSGQPLAFTEIKIVNEEKDKILEFREVGK
FT                   ILVKGPQVMKGYLNNDSATKDVLSKDGWFDTGDLGFLIPNGSLVITGRAKDTIVLSSGE
FT                   NIEPNPLETQILSSEFINQVQLVGQDKKFLTALVVPNIELVKNKFFANDLSTLNSNKNI
FT                   GLFFKSEINSLLKKRLGARFEEQILDCYFVDAFTLENGLLTQTLKQKRREIVDMYSSKI
FT                   EDMYKK"
FT   gene            413709..414155
FT                   /locus_tag="P9515_04651"
FT   CDS_pept        413709..414155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71674"
FT                   /db_xref="InterPro:IPR021297"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV63"
FT                   /protein_id="ABM71674.1"
FT                   /translation="METKNSISIKRSIAIKAIVTPIWKEDAEKELSNAISAVDQQLSQL
FT                   EQEGQQIVSNIRSQSVNPLDPRVQEQVGQVQQQVGAKRNELEEQKRNLLQQQSQVRDLK
FT                   MDEIVDQGQVDSFCDVSVGDNLIKKMQVSITVKDGIIQSINNNE"
FT   gene            414289..415656
FT                   /gene="pdhC"
FT                   /locus_tag="P9515_04661"
FT   CDS_pept        414289..415656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /locus_tag="P9515_04661"
FT                   /product="Dihydrolipoamide acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /EC_number="2.3.1.61"
FT                   /note="COG508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71675"
FT                   /db_xref="GOA:A2BV64"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV64"
FT                   /protein_id="ABM71675.1"
FT                   /translation="MSHEIFMPALSSTMTEGKIVEWLKNPGDKVERGESVLVVESDKAD
FT                   MDVESFQDGYLAAVLMPAGSTAPVGETIGLIVENEDEIASIQEQNKGKQIEVSSDAQLK
FT                   LPNKKSEIIEEKQKELPQINEQQVEIKREKVINTSNEIQFNASTSNNSSRVIASPRAKK
FT                   LASTMGVELTKVHGSGPHGRIQAEDVLKANGQPVSIPWIGEGSSPASIGSSHVQAESKS
FT                   ETLGNSFGKPGETVKFNTLQKAVNNNMESSLNVPCFRVGYSINTDKLDNFYKKVKQNGV
FT                   TMTALLVKAVAKTLKKHPQVNSSFSENGISYPENINIAVAVAMEDGGLITPVLKEPCNT
FT                   DLFELSREWKDLVKRSRAKQLEPDEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAIA
FT                   SSKPTVVANNDGSISVKKIMQVNLTADHRVIYGADGASFLKDLSSLIENEPETLVS"
FT   gene            415663..416784
FT                   /gene="queA"
FT                   /locus_tag="P9515_04671"
FT   CDS_pept        415663..416784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="P9515_04671"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="COG809
FT                   S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
FT                   (queuine synthetase) [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71676"
FT                   /db_xref="GOA:A2BV65"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BV65"
FT                   /protein_id="ABM71676.1"
FT                   /translation="MNFEIYNEEIDHKLEAYDYCLDESLIAGKPSKVRHESRLMIVRDS
FT                   SLKEDYSTNKYTKDLLAELREGDLVVINDTKVMKARLKVELENGQLVELLVLEKSDQST
FT                   WLCLAKPAKKLKINKQLNLKSPFAKDIKLKISGIDDETGGRFIKFPENINDLISMNKLL
FT                   DIFGEIPIPPYIKSSEEESFHENSYQTEYACNPGAVAAPTAGLHLSKSLISNLKKKGIL
FT                   VMPITLHVGYGTFKPIDQEDLSDLKLHKEWVSVSKKVVEEIKRIKKTDRRVIAIGTTSV
FT                   RALESCYSYAMKDFIPIAKYVDLVIKPGYKFKAVDGLLTNFHLPKSSLLLLVSAMIGRE
FT                   RLLDLYKKATKEKFRFFSYGDAMYISPDSFLEK"
FT   gene            complement(416790..417776)
FT                   /locus_tag="P9515_04681"
FT   CDS_pept        complement(416790..417776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04681"
FT                   /product="O-acetylserine (thiol)-lyase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="COG31 Cysteine synthase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71677"
FT                   /db_xref="GOA:A2BV66"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV66"
FT                   /protein_id="ABM71677.1"
FT                   /translation="MAKIYEDNSFAIGNTPLVKLKSVTKNAKATVLAKIEGRNPAYSVK
FT                   CRIGANMIWDAEKSGKLTKDKTIVEPTSGNTGIALAFTASARGYKLILTMPESMSIERR
FT                   RVMAVLGAEIVLTEASKGMPGAIAKAKEIAESNPSQYFMPGQFDNPANPEIHFKTTGPE
FT                   IWDDCDGAIDVLVAGVGTGGTITGVSRYIKQEKGKNITSVAVEPSHSPVITQTLNGEEV
FT                   KSGPHKIQGIGAGFIPKNLDLSIVDKVEQVTNDESIEMALRLAKEEGLLVGISCGAAAA
FT                   AAVKLAEQDEYAGKTIVVVLPDLAERYLSSIMFTEVPSGIIEEPINA"
FT   gene            complement(417861..419288)
FT                   /locus_tag="P9515_04691"
FT   CDS_pept        complement(417861..419288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04691"
FT                   /product="possible Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="COG626 Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71678"
FT                   /db_xref="GOA:A2BV67"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV67"
FT                   /protein_id="ABM71678.1"
FT                   /translation="MGFSIPDSKHAVSVALPTWNDVINYEEKDPKCIEALKSIYPRFGL
FT                   NPLVKRLCEKIKKESQFNNKNIWPYPDERIALKAKKYCDKNTFQGYSYIERRHNFTLLI
FT                   TQESANIYARSFWQHSGLGLSSRAAAIELGLEHCPSKSLANESYQRIKNRISKFTKTDS
FT                   NDIHLTSSGMSALYTILEIIYKLFPEKPTLQIGFPYVDVLKLPMNIFHGAKLITEEDCK
FT                   DIELEILRINPAALIIELPSNPMLKCVNIKKISKIANKLNIPVIVDDTIGSNLNINSLE
FT                   HADIVFTSLTKIFSGSGDILAGSLILNPKSRWIDQFRNALKQINLPILSDGDIVSLEKV
FT                   SRDVKQRVFQQNKACLELKKRLETHKEVKNIFHPENCPNFNSILTSDGGYGCLLSFELK
FT                   GGKEKAKKFYDSLQISKGPSLGTKFTLVCPYVLLAHYEELEWAESFGVPSHLLRVSVGL
FT                   EDENHLWHTFSEALNNF"
FT   gene            complement(419334..420497)
FT                   /gene="metB"
FT                   /locus_tag="P9515_04701"
FT   CDS_pept        complement(419334..420497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="P9515_04701"
FT                   /product="putative Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="COG626 Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71679"
FT                   /db_xref="GOA:A2BV68"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV68"
FT                   /protein_id="ABM71679.1"
FT                   /translation="MGNKENNIKKPGVKTLTIHHGETFAEETGCVMPPIFSTSTFKYGN
FT                   KQNFDYTRSGNPNFKILENILKSVEDSKYCTVFGSGISAVTAITSTLKSGDKILCESNL
FT                   YGCTVRMFDKIFKKFGIETLYTDFTDKESIKKIKDFKPTLIWLESPTNPLLKILDIKSI
FT                   CDEANKHKIPVVLDNTFTTALIQKPLELGATLSLISTTKFINGHSDALGGAVLTNDEEW
FT                   NSKLLFSQKALGLQPSPFDSWLITRGVKTLPLRIEQQTKSAEIISKEFENHRIIRKALY
FT                   PFNQKHPQFNLAKSQMKSGGSMITLKLNLNKADTFNFCKSLKYFSLAESLGGVESLICH
FT                   PATMTHASVDDKTKNLLGIDDSLVRLSVGCEDTNDLISDILFALNKF"
FT   gene            complement(420573..421181)
FT                   /gene="rpsD"
FT                   /locus_tag="P9515_04711"
FT   CDS_pept        complement(420573..421181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="P9515_04711"
FT                   /product="30S ribosomal protein S4"
FT                   /note="COG522 Ribosomal protein S4 and related proteins
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71680"
FT                   /db_xref="GOA:A2BV69"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BV69"
FT                   /protein_id="ABM71680.1"
FT                   /translation="MSRYRGPRLRVTRRLGELPGLTRKASKKSNPPGQHGQARRKRSEY
FT                   AIRLEEKQKLRFNYGVSERQLVRYVKKARAQEGSTGTNLLRLLENRLDNVCFRLGFGGT
FT                   IPGSRQLVNHGHVTVNGKVLDIAGYQCKSGDVISIKEKKASKKLVEGNIEFPGLANVPP
FT                   HIELDKPKLTGKINGKCDREWVALEINELLVVEYYSRKV"
FT   gene            421322..421513
FT                   /locus_tag="P9515_04721"
FT   CDS_pept        421322..421513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04721"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG759 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71681"
FT                   /db_xref="GOA:A2BV70"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV70"
FT                   /protein_id="ABM71681.1"
FT                   /translation="MISFYQKWFSPFFGPRCRFIPSCSSYGYEAITRHGPWRGGWLTLR
FT                   RLSKCHPLTPCGCDPVPD"
FT   gene            421518..421820
FT                   /locus_tag="P9515_04731"
FT   CDS_pept        421518..421820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04731"
FT                   /product="Thioredoxin family protein"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71682"
FT                   /db_xref="GOA:A2BV71"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV71"
FT                   /protein_id="ABM71682.1"
FT                   /translation="MKIFIFVRQGCCLCDSLKNKLAKINLDELFPNLVELKEIDIDRVD
FT                   LYKDKYKKYDYEVPVIAVEGIRSNEIIELPRISPRLKDDQLKNWFQKNINTILNK"
FT   gene            421829..423364
FT                   /gene="murE"
FT                   /locus_tag="P9515_04741"
FT   CDS_pept        421829..423364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="P9515_04741"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /EC_number="6.3.2.13"
FT                   /note="COG769 UDP-N-acetylmuramyl tripeptide synthase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71683"
FT                   /db_xref="GOA:A2BV72"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV72"
FT                   /protein_id="ABM71683.1"
FT                   /translation="MRSVKLHKLLDLVGIIPSLDLIDHKINNISFNSKEVQKGTLFLGM
FT                   PGLNVDGGKYCIEAIENGAEAAIIGSAAKQKIGSIDRKRILVIEDNLDYIFGQIVAEFW
FT                   NRPSRKLKLIGVTGTNGKTTITFLLEYLLKKLGKKTALYGTLFNRWPGFSEVASHTTDF
FT                   ADKLQKKLNAAVEAESEFAILEVSSHSIAQNRISGCEFEAAIFTNLTQDHLDYHSDMES
FT                   YFQIKRKLFFPPYLTEKDGISVLNIDDPWISKLSFDLEKGSSLVSTKITDSEFEKDDFF
FT                   FVTDKKFTESGSTCIFHTPREKIKLFVPLVGEFNLMNAIQAITILYKLNFSLKDLSKLI
FT                   QSFPGAPGRMEKIEIDNDDVSSLLPTLIVDYAHTPDGLKKVLKSIKKLCEGKLITVFGC
FT                   GGDRDCSKRPLMGSIAAEFSDHLFITSDNPRSEDPQKIVNDILMGIEKRDQITIEIDRF
FT                   KAINESIKFANKEDIVLIAGKGHEDYQILNDKVIDFDDRKIAYKLLQEKSKSK"
FT   gene            423447..424151
FT                   /locus_tag="P9515_04751"
FT   CDS_pept        423447..424151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04751"
FT                   /product="putative short chain dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71684"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV73"
FT                   /protein_id="ABM71684.1"
FT                   /translation="MKGLALIVGAGGIGTQIAKDLSENEKDLEVILCGRKSEFNSFWEL
FT                   DIEDSQSLLQLKNKISNHPSKLRLVVNATGRLHSDSLQPEKRLQHLDKKNMMESFSINA
FT                   FSPILLAKAIEEFIPKDFYFNFASISARVGSIGDNQTGGWYSYRAAKSAQNQFFKSLSI
FT                   EWTRRFPKATITLLHPGTVDTDLSRPFHKFVPKHKLFTKEKSSKFLINIIKNQTPEFTG
FT                   KFIAWDSSEIIW"
FT   gene            complement(424270..425445)
FT                   /locus_tag="P9515_04761"
FT   CDS_pept        complement(424270..425445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04761"
FT                   /product="putative L-cysteine/cystine lyase"
FT                   /note="COG520 Selenocysteine lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71685"
FT                   /db_xref="GOA:A2BV74"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV74"
FT                   /protein_id="ABM71685.1"
FT                   /translation="MTINLREQIPALKNKYYFNYGGQGPLPKSSLEEIVKTWEIIQDIG
FT                   PFTNNMWPFIYKEILTTKRIIAQKLGVNSKNVALTENISSGMILPFWGIKVKEGEELLI
FT                   SDCEHPGVVAASREFCRRNKLIFKILPIQKIKNLNDENIILEIQKNLNSKTKILIISHI
FT                   LWNFGYKIPLKKISIELKNNRENSYLLVDGAQTFGHIKIEDDVFYSDLYSITSHKWACG
FT                   PEGLGAIYVSDRFIHETDPTIIGWKSLKKEQGIYEPPDNLFHEDARKFEVATSCIPLLA
FT                   GLRNSLDLLDKDCHEKEKTKNIKRLSGKLWDKLNQLNGVELVLEKKYLNGIVSFNIGNV
FT                   VDKDKFVKRLGEQKIWIRVLEDPKWFRACVHQMTTEAEINLLSKEIKKILT"
FT   gene            complement(425478..426272)
FT                   /locus_tag="P9515_04771"
FT   CDS_pept        complement(425478..426272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04771"
FT                   /product="putative methyltransferase"
FT                   /note="COG500 SAM-dependent methyltransferases [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71686"
FT                   /db_xref="GOA:A2BV75"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV75"
FT                   /protein_id="ABM71686.1"
FT                   /translation="MSSDCCNTDESNKNLKGLDHKDAIQERYGSAALEKESCLCTPVGF
FT                   NPVLLEAIPEEVIERDYGCGDPTKYVQKNDIVLDLGSGSGKNAFICSQIVGEEGKVIGV
FT                   DQNPDMLTLSRSASKKFSEKIGFNNTEFLKGSIENLDELNKDLNPLIADKSIDIILSNC
FT                   VLNLVNPESRNNLLRNIKRVLKGNGRIAISDIVSSKKVPLRLQNDHDLWTGCISGAWYE
FT                   PEFLNDFKDLGFKNLEFAERSNEPWKVIEDIEFRTVTLVGNI"
FT   gene            complement(426346..426534)
FT                   /pseudo
FT                   /locus_tag="P9515_pseudoVIMSS1362535"
FT                   /note="Pseudogene derived from P9312_04371"
FT   gene            426786..427046
FT                   /locus_tag="P9515_04781"
FT   CDS_pept        426786..427046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71687"
FT                   /db_xref="GOA:A2BV76"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV76"
FT                   /protein_id="ABM71687.1"
FT                   /translation="MTGFLYFLGNTLRWPALKPKEFFSLHAYFTIIYLITFTLSKNEVN
FT                   QSNLVFTLGILAPLLIAIGQGLPINCLDYKTSLMKEIGKES"
FT   gene            complement(427065..427310)
FT                   /locus_tag="P9515_04791"
FT   CDS_pept        complement(427065..427310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04791"
FT                   /product="NifU-like protein"
FT                   /note="COG694 Thioredoxin-like proteins and domains
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71688"
FT                   /db_xref="GOA:A2BV77"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV77"
FT                   /protein_id="ABM71688.1"
FT                   /translation="MSTETLPLTNENVEKVLDELRPFLISDGGNVEIAEIDGPIVKVRL
FT                   QGACGSCPSSTMTLKMGIERKLKEMIPEISEVVQVL"
FT   gene            427380..428873
FT                   /gene="mqo"
FT                   /locus_tag="P9515_04801"
FT   CDS_pept        427380..428873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqo"
FT                   /locus_tag="P9515_04801"
FT                   /product="putative malate/quinone oxidoreductase"
FT                   /EC_number="1.1.5.4"
FT                   /note="COG579 Predicted dehydrogenase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71689"
FT                   /db_xref="GOA:A2BV78"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BV78"
FT                   /protein_id="ABM71689.1"
FT                   /translation="MTSKKFSDKKNNYDAILVGAGIMSGTLALLLTEILPELKILIIEK
FT                   LKIPGSESSGAFNNAGTGHAANCELNYTPLDDYGHLKIEKALSINRSFEKSMSLWASLY
FT                   SSQKIDIKKFLKFIPHISFVTGSENVSFLKKRFKKMTEYKEFEDMEFSSSFNQISSWAP
FT                   LITKSRNPLDEVAATRVKRGTDINFEVLTREYLKYISKNKNVEISYETELNDLKKTSNK
FT                   EWELNISMEGRKVNLKTSYVFLGAGGKTINYLQKSNIPEAKVYGGFPVSGKWLICEENS
FT                   LTEKHNAKVYGRADIGSPPMSVPHLDTRWIEGKKFLLYGPFAGFTTKFLKQGSYLDLFN
FT                   SLKKNNLLSMLDVGIKNNDLINYLFSQSIKSHKSRVENLRNMMPSADPSNWYLENAGQR
FT                   VQIIKKTKKGGSLKFGTEIVNAADGSLSALLGASPGASTAVSIMIEVLKKSCLFTLDKS
FT                   ILEQKISHLLYESELKNQNENDFLENLKKRNNSILGFHP"
FT   gene            428930..430738
FT                   /gene="lepA"
FT                   /locus_tag="P9515_04811"
FT   CDS_pept        428930..430738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="P9515_04811"
FT                   /product="GTP-binding protein LepA"
FT                   /EC_number="3.6.5.3"
FT                   /note="COG481 Membrane GTPase LepA [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71690"
FT                   /db_xref="GOA:A2BV79"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027518"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BV79"
FT                   /protein_id="ABM71690.1"
FT                   /translation="MTDISVSKIRNFCIIAHIDHGKSTLADRLLQDTGTVKQRDMQDQF
FT                   LDSMDLERERGITIKLQAARMKYKAEDSQEYILNLIDTPGHVDFSYEVSRSLQACEGAL
FT                   LVVDASQGVEAQTLANVYLALENNLEIIPVLNKVDLPGADANKIKQEIEEVIGLDTSNA
FT                   INCSAKTGEGIEDILEAVVSRIPHPQNEIKSPTRALIFDSYYDPYRGVIVYFRVISGSI
FT                   NKRDKILLMASKKHYELDEIGIMAPDEKQVDELHAGEVGYLAASIKSVADARVGDTITL
FT                   FNSAAKEPLPGYKTANPMVFCGLFPTDADQYPDLRESLEKLQLSDAALKYEPETSSAMG
FT                   FGFRCGFLGLLHMEIVQERLEREYDLDLIVTAPSVIYKINLNDKEQIFIDNPSTIPDPQ
FT                   SRESIEEPYVKMEIYSPNEFNGTLMGLCQERRGIFVDMKYITTDRVTLIYEIPLAEVVT
FT                   DFFDQMKSRTQGYASMEYHLIGYRKNDLVRLDVLINSERADPLTSIVHKDKAYGIGRGL
FT                   VEKLKELIPKQQFKIPIQASIGSRIIASESISALRKDVLSKCYGGDISRKKKLLKKQAK
FT                   GKKRMKAMGKVDVPQEAFMAVLKLNQ"
FT   gene            430911..431657
FT                   /gene="dppC"
FT                   /locus_tag="P9515_04821"
FT   CDS_pept        430911..431657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="P9515_04821"
FT                   /product="putative ABC transporter, oligopeptides"
FT                   /note="COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components [Amino acid
FT                   transport and metabolism / Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71691"
FT                   /db_xref="GOA:A2BV80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV80"
FT                   /protein_id="ABM71691.1"
FT                   /translation="MKVLEANNFFGYSVSSFSSDVFSPPSLKHLCGTDRLGRDVCLRTL
FT                   QGSSIAIEVVFLSIFFALILGLPLGLLSGYFGGIFDKCLSLIMDTIFSIPVILLSVVVA
FT                   FVLGKGIINASIALCIVYSPQYFRLIRNQTILIKSETYVEAARVSGADIKTIIFKYIFP
FT                   NVITPLPILLTLNAADAVLVLGSLGFLGLGVPADVPEWGSDLNLALAALPTGIWWTALF
FT                   PGLAMFFLVLGLSFIGEEIENIFEKQ"
FT   gene            complement(431672..432346)
FT                   /locus_tag="P9515_04831"
FT   CDS_pept        complement(431672..432346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04831"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /EC_number="2.1.1.34"
FT                   /note="COG566 rRNA methylases [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71692"
FT                   /db_xref="GOA:A2BV81"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV81"
FT                   /protein_id="ABM71692.1"
FT                   /translation="MSILPRRFERIKNVLNCRMENLTVLVEAVNKPHNLSAILRTCDAA
FT                   GVFEANFICKRDEVKTFNSTAQGSQKWVKLNNHETTISAVSHLKKKGFKLYGTTLNDSS
FT                   TDYRNFDYAENTCFVLGAEKWGLSDELISKVDESIFIPMTGMVQSLNVSVAASILLFEA
FT                   IRQRQIKSLLPLNGEGLSQKEYQKTLFEWSYPELASIYKKSGNKYPTLNQDGEINEVIK
FT                   KQ"
FT   gene            432512..432715
FT                   /locus_tag="P9515_04841"
FT   CDS_pept        432512..432715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04841"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71693"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV82"
FT                   /protein_id="ABM71693.1"
FT                   /translation="MAYIEWDYTVIKSMVETQGWTLPEPDSKEYKKFSDELGEKMRGVG
FT                   IVFEKYCKFAPEIGEGVHLLDD"
FT   gene            432940..433332
FT                   /locus_tag="P9515_04851"
FT   CDS_pept        432940..433332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04851"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3011 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71694"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV83"
FT                   /protein_id="ABM71694.1"
FT                   /translation="MQNKLTFLFDGGCPLCLRETNFLKKKDALNKISFVDINNQDYNPV
FT                   LFKDISYPEAMSNLHGILENGDIIKGLDVLAYSYELIGLGWVYYPLKIKFVAPVLRVIY
FT                   KYWAKYRLKLTGRSNLENLCTSECEQ"
FT   gene            433335..433571
FT                   /locus_tag="P9515_04861"
FT   CDS_pept        433335..433571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04861"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71695"
FT                   /db_xref="InterPro:IPR019882"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV84"
FT                   /protein_id="ABM71695.1"
FT                   /translation="MEIVDIDRVIEMCWEDRTPFEAIEHQFGLKENDAIKIMRNNLKPK
FT                   SFKIWRKRVSGRRTKHMELKDSTRFKSTHKRKL"
FT   gene            433703..435193
FT                   /locus_tag="P9515_04871"
FT   CDS_pept        433703..435193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04871"
FT                   /product="Uncharacterized deoxyribodipyrimidine
FT                   photolyase-like protein"
FT                   /note="COG3046 Uncharacterized protein related to
FT                   deoxyribodipyrimidine photolyase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71696"
FT                   /db_xref="GOA:A2BV85"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR007357"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV85"
FT                   /protein_id="ABM71696.1"
FT                   /translation="MNQISIIFPNQLFRDSPILKLNCEILMIEDSLFFGNDKFHKLINH
FT                   KNKLIFHKASMLAYKKYLENLGYKVFYIDNKNNFSTVDYLSNYLEKKYQKINIYNPHDF
FT                   LIMKRINSFVKANKLKLQIFQSPMFITKEDLRESFRVNPKKPLMGRFYENQRKSQNILV
FT                   NLDGSPKGGKWSFDELNRKKLPKKITIPEIPRLPKNEFVMQAENLITDLNIEFIGESNH
FT                   FIYPTSFSEADNWLHDFFESRIFLFGDYEDAISKKKVFLWHSLLSPLLNSGLLTPKEVI
FT                   NKALTFAEKNKVPMNSLEGFIRQIVGWREFICLVYEKHGTKMRTTNFWNFENNPMPDVF
FT                   YTGNTGIEPVDIVINNIIKYGYCHHIERLMIVGNFMLLCRIHPDQVYKWFMEMFIDSYD
FT                   WVMVPNVYGMSQFSDGGIFSTKPYISSSNYVKKMSDYKSGSWCSIWDGLFWKFIKDNET
FT                   YFRKQYRLAMLTRNLDKMSDEKLNGHLTTAEVFIKNLY"
FT   gene            435559..436872
FT                   /gene="sun"
FT                   /locus_tag="P9515_04881"
FT   CDS_pept        435559..436872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="P9515_04881"
FT                   /product="Sun protein (Fmu protein)"
FT                   /note="COG144 tRNA and rRNA cytosine-C5-methylases
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71697"
FT                   /db_xref="GOA:A2BV86"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV86"
FT                   /protein_id="ABM71697.1"
FT                   /translation="MATGYLQRKASWEILLKVSSGIYSDHALEKVLKNYEFNSLDIAFI
FT                   TELSFGCIRYRKFLDTWIDHISKLSHQKQPPKLRWLLHIGLYQLLKMDKIPFPAAISST
FT                   VEVAKRTDLKGLAGTVNAILRNTVRNIERDNCPKISTDEMEKLSCLESLPLWLVTEIVN
FT                   WVGIKEAKNIFKAFNKKPTIDLRINSLKTNFNKILKELNECNIQAEPINQLNNGVALNS
FT                   NPRSIKNLPGYKDGLWVVQDRSSQWVAPLLNPKKGEKILDACSAPGSKTTHLAALVNDD
FT                   AEILAVDRSEKRLKILQSNLERLNIKSVKTLEADATTLIDIKPNLASYFDKILIDAPCS
FT                   GIGTFARNPDTRWSLSKDKINQLIILQEGLLDSIFPLLKKNGTLVYSTCTICPDENNLL
FT                   IRRFLSKNKELKLDSERQILPRFDKPGDGFYAATISYK"
FT   gene            complement(436888..438657)
FT                   /gene="mrcB"
FT                   /locus_tag="P9515_04891"
FT   CDS_pept        complement(436888..438657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="P9515_04891"
FT                   /product="putative penicillin binding protein"
FT                   /note="COG744 Membrane carboxypeptidase (penicillin-binding
FT                   protein) [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71698"
FT                   /db_xref="GOA:A2BV87"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV87"
FT                   /protein_id="ABM71698.1"
FT                   /translation="MNEKKYKYLIITPSIFIFFGIFFPVINLIRFTLNSNPLKNNNNSK
FT                   SITYSYEILSSDNKILSKLSRKFDVLDDTNSIPFFLKYSFISGEDKRFFKHNGIDLIGL
FT                   SRALINNIQSRSFKEGGSTITQQVARLIFLNNDLSFQRKIKEMIISLILDFKYSKSQIL
FT                   KLYLNNIYLGSGAYGVNEASQVYFGKFINELTLSEVALIAGLAPAPSIYSPYENIDLAI
FT                   KQRNKILESMYLDGHISLGEKDSALQEKVKLNYQIDNKNLNDKLLVNYILEEANKIIKT
FT                   HKKYKFLKIKSSINKNWQEIGQHISKYIGPNNIEIALVSIESNTGLIRTMITSKNPSIN
FT                   EFNRVTSAVRPLGSTFKIIPYAAALIEGRKLSDKFEDIPTCWKDYCPNNFSENYLGKIS
FT                   LTESFKKSSNIVPLKIANNIGLKKIINLANLFGLGYEQKLEEFLPLAIGSYGDNLLNIT
FT                   NAYAVLNSNGNLYKPSIIEKIESKNQELIWENKFVHKKILAPKVNKNLNNLLEKSVSEG
FT                   TSIGASIKGERIFGKTGTSDENRDLWFIGSIKNLTTGVWIGFDENKKSNLSSGNAAYFW
FT                   KKFISKIFDLKIQ"
FT   gene            complement(438659..439606)
FT                   /gene="chlG"
FT                   /locus_tag="P9515_04901"
FT   CDS_pept        complement(438659..439606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlG"
FT                   /locus_tag="P9515_04901"
FT                   /product="ChlG"
FT                   /EC_number="2.5.1.62"
FT                   /note="chlorophyll synthase 33 kD subunit; COG382
FT                   4-hydroxybenzoate polyprenyltransferase and related
FT                   prenyltransferases [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71699"
FT                   /db_xref="GOA:A2BV88"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="InterPro:IPR011799"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV88"
FT                   /protein_id="ABM71699.1"
FT                   /translation="MNDPKQLLGIKGASETSSIWKLRIQLMKPITWIPLIWGVICGAAA
FT                   SGNFQWTISNVLASLACMLMSGPLLAGYTQTINDYFDRDIDAINEPNRPIPSGKISIKE
FT                   VKTQIWVLLISGLVVSFLLDLYAKHSFPSVLLLALGGSFVSYIYSAPPLKLKQNGWLGN
FT                   YALGASYIALPWWAGQALFGKLTIVTALLTLAYSLSGLGIAVINDFKSVEGDSKLGLNS
FT                   LPVIFGIKNASRISAGLIDIFQLAMVIVLIVIGQHLASVILVLLVIPQITFQDMWLLRD
FT                   PLKFDVKYQASAQPFLITGMLVTALAIGHSFLVA"
FT   gene            complement(439616..439840)
FT                   /locus_tag="P9515_04911"
FT   CDS_pept        complement(439616..439840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04911"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71700"
FT                   /db_xref="InterPro:IPR021291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV89"
FT                   /protein_id="ABM71700.1"
FT                   /translation="MAQTKLLPKIGSKVKININKVKDRLPAKLIDQISSNPRVVTTGYK
FT                   MTDGRSIGITVRLQNGEENWFFPEEIEKG"
FT   gene            439900..440673
FT                   /gene="hisF"
FT                   /locus_tag="P9515_04921"
FT   CDS_pept        439900..440673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="P9515_04921"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   HisF (cyclase)"
FT                   /note="COG107 Imidazoleglycerol-phosphate synthase [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71701"
FT                   /db_xref="GOA:A2BV90"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BV90"
FT                   /protein_id="ABM71701.1"
FT                   /translation="MVALRLIPCLDVANGRVVKGVNFVNLRDSGDPVELACRYSEAGAD
FT                   ELVFLDIRASVENRKTLVDLVSRTAKSVKIPFTVGGGINSIVTINDLLRAGADKVSLNS
FT                   SAVKNPKIISQSSKKFGTQCIVIAIDARKKHNVSNEWEVYVKGGRENTGLDVVNWAKKV
FT                   EELGAGEILLTSMDGDGTQNGYDLLLTKTVAKAVNIPVIASGGAGSLEDIFDVFTEGEA
FT                   SAALLASLLHDKKLTIEEIKSFLINKKLIIRPNEK"
FT   gene            440706..441407
FT                   /gene="ubiE"
FT                   /locus_tag="P9515_04931"
FT   CDS_pept        440706..441407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="P9515_04931"
FT                   /product="Ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="COG2226 Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71702"
FT                   /db_xref="GOA:A2BV91"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV91"
FT                   /protein_id="ABM71702.1"
FT                   /translation="MRHKKINEVKTIFNNISCSYDFLNSLFSLGLHRFWKNKLVYLLKP
FT                   IDGEDWADLCCGTGDLSFLIFKKVSPNGTVTGIDSAKEILNIARKRSKLIGNKYISWEM
FT                   QDIFEIDENLKNYDGICMSYGLRNLMNVEEGLKKVFNLLNNSGRAGFLDFNHSKLNSLA
FT                   DLFQKIYLRSIVVPISKFFQLSKEYSYIEKSIKSFPEGNKLMLIAKKVGFKRVEYRTIF
FT                   FNQMGILIVEK"
FT   gene            complement(441417..441899)
FT                   /locus_tag="P9515_04941"
FT   CDS_pept        complement(441417..441899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04941"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71703"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV92"
FT                   /protein_id="ABM71703.1"
FT                   /translation="MNKKYLPILNKRYPFSMRNCLDNFKKSWEDLDKLSKLNENWEKLI
FT                   GLELSRACKPLKIDQKNLTIAVNHPQWRQALIYNKHRLKESISKFGISLNEIKIIQNYE
FT                   VQTLDKKEINAKIIWENHPSRIKNNNMVICKLCNSPAPKGEISRWGKCTFCWRKNG"
FT   gene            441976..442725
FT                   /gene="birA"
FT                   /locus_tag="P9515_04951"
FT   CDS_pept        441976..442725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="P9515_04951"
FT                   /product="putative Biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71704"
FT                   /db_xref="GOA:A2BV93"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV93"
FT                   /protein_id="ABM71704.1"
FT                   /translation="MKVLGSVARTAFYFKKIQGLCPDWKLQYKFKCRSTEYELTNLLQD
FT                   SPVQRNKPIAIVAKEQLSGIGQNSRSWFSPKGGIWLSAAYPIFSSEFSSETLSLSFAIK
FT                   LCEMFQMESINVDLKWPNDIFYDSKKLIGFLPRVITRGKEIIYMRIGLGMNFSNKTPLE
FT                   GIALSEILKTKNICEHYWTAKILKTIHDSVEFNGKKEYIIENANKYLTKKQLPRGYNSK
FT                   YWKIKDVDNNGNLRIYNQTQEKVLKRF"
FT   gene            complement(442728..443414)
FT                   /gene="salX"
FT                   /locus_tag="P9515_04961"
FT   CDS_pept        complement(442728..443414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="salX"
FT                   /locus_tag="P9515_04961"
FT                   /product="possible ABC transporter, ATP binding protein"
FT                   /EC_number="3.6.3.32"
FT                   /EC_number="3.6.3.27"
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71705"
FT                   /db_xref="GOA:A2BV94"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV94"
FT                   /protein_id="ABM71705.1"
FT                   /translation="MTKKVATLEKVSKTYGKDDLIVKALDNVNLEIYKGDYLAVMGASG
FT                   SGKSTAMNIIGCLDRPSKGVYKLNGTPVENLSDDELAELRNQKLGFVFQQFHLLSDATA
FT                   LENVLLPMIYAGVNPIEREERAKNALDKVGLSKRIDNRPNQLSGGQQQRVAIARAIINN
FT                   PSLLLADEPTGALDSKTTEDVLDLFDKLHESGITIVLVTHEDEVASRAKKVAKFKDGKI
FT                   VELKIK"
FT   gene            complement(443429..444949)
FT                   /gene="ndhB"
FT                   /locus_tag="P9515_04971"
FT   CDS_pept        complement(443429..444949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhB"
FT                   /locus_tag="P9515_04971"
FT                   /product="putative NADH dehydrogenase (complex I) subunit
FT                   (chain 2)"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1007 NADH:ubiquinone oxidoreductase subunit 2
FT                   (chain N) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71706"
FT                   /db_xref="GOA:A2BV95"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BV95"
FT                   /protein_id="ABM71706.1"
FT                   /translation="MPNEIFTINLNAQAIIPEAFILLGIVGTLLVDLAGEKTASRWAPV
FT                   ICYISLGSSLVSLAFQWSNPVNNAFLGSFNSDNLAIAFRSIIALSTLISLLISWRYTEQ
FT                   SGSPIGEFAAIVLSATLGAMLLCGSTDLVSVFISLETLSVASYLLSGYLKRDPRSSEAA
FT                   LKYLLVGSAAAAIYLYGSSFLYGLSGSTNLSTIGVEIINKPSFITSLSLVFVLSTVAFK
FT                   IAAVPFHQWTPDVYEGSPTPVVAFLSVGSKTAGFAFAIRILTTSFSSFDEQWKLLFTIL
FT                   AILSMALGNIVALAQTSMKRMLAYSSIGQAGFVMIGIVSGTQDGLSAAVLYLAAYLFMN
FT                   LGAFSCVILFSLRTGSDRISDYSGLYQKDPLITLGLSLCLLSLGGLPPMLGFFGKIYLF
FT                   FAGWANHQYLLVVVGLVTSVISIYYYISVIKMMVVKEPQEASEIVKSYPEIKWNIIGLP
FT                   PLRIALYTCIAVTALGGILSNPLFKLANSAVSETPFLQDILAVTNNML"
FT   gene            445118..447730
FT                   /gene="topA"
FT                   /locus_tag="P9515_04981"
FT   CDS_pept        445118..447730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="P9515_04981"
FT                   /product="Prokaryotic DNA topoisomerase"
FT                   /EC_number="5.99.1.2"
FT                   /note="COG550 Topoisomerase IA [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71707"
FT                   /db_xref="GOA:A2BV96"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV96"
FT                   /protein_id="ABM71707.1"
FT                   /translation="MDHTLVIVESPTKAKTIRRFLPPNYEVLASMGHVRDLPKGAAEIP
FT                   ASVKKEKWSRIGVNTTEDFEPLYIVPKEKKKVVKDLKNALKDATQLLLATDEDREGESI
FT                   SWHLMQILKPKIPTKRMVFHEITKKAINKALDETREIDMELVQAQETRRILDRLFGYEL
FT                   SPLLWKKVAPRLSAGRVQSVSVRLLVNKERERRAFKKATYWGLKATLLKDNVFFDSKLS
FT                   SLSGQKISNGSDFDEKTGKLKNGNKSLILNEERAKSLLKSLSEEKWRVIKIEKKPTTRK
FT                   PVPPFTTSTLQQEANRKLRLSARETMRCAQGLYERGFITYMRTDSVHLSEQAIRAAREC
FT                   VQSRYGKEYLSSSVRQFNSKERNAQEAHEAIRPAGEVFKTPSDTDLAGRDLSLYELIWK
FT                   RTVASQMAEARLTMVNAEIEVGEGLFKSSGKSIDFAGFFRAYVEGSDDPSASLEQQEVI
FT                   LPNLTLGSTLEVASKEATYHETKSPARYTEAALVKVLEKEGIGRPSTYASIIGTIVDRG
FT                   YANISSNSLSPTFTAFAVTALLEEHFPDLVDTTFTAKMESSLDEISSGNLEWLPYLETF
FT                   YKGKNGLEVKVQKTEGDIDGKAYRQVDFDDLPCVVRIGSNGPWLEGVKIDESGNEIQAK
FT                   GNLPMDITPGDLDKKKVDQILSGPSDLGTDPKTGEQVFLRFGPYGPYVQLGNIEEGKAK
FT                   PRRASLPKDLKTDDLSLSEALELLSLPKLLGEHPEGGIVEADRGRFGPYIKWIKDEDTS
FT                   ENRSLKKEDDVFKVDLKRALEILAMPKLGRGGQEVIKDFGKPKELNDKVQVLNGKYGIY
FT                   VKCGKINVSLPKDTDLEKFTIENALILLEEKMKDKKVSVFKKNKVISKKTKKNKKIKK"
FT   gene            447733..448224
FT                   /locus_tag="P9515_04991"
FT   CDS_pept        447733..448224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_04991"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_04991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71708"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV97"
FT                   /protein_id="ABM71708.1"
FT                   /translation="MGFKIKKVFLLIILFLLQSCSGGRVGDFLESSFKNVEESRIKEDA
FT                   KNNLKNKKVFKLEENIENIQIIKEQIIKDDVKNNLKNKKVIKLEEKQKNTKKINKQKIS
FT                   IPKRKYQPQSYKIIFILKDVDPKDPIEDLSNILRNSDVNFEIEKIERFLDSKNESIKRD
FT                   "
FT   gene            448230..448880
FT                   /locus_tag="P9515_05001"
FT   CDS_pept        448230..448880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05001"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4241 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71709"
FT                   /db_xref="GOA:A2BV98"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV98"
FT                   /protein_id="ABM71709.1"
FT                   /translation="MKNHMKFLRKNDALNIVEPSYLASLSSLLWVALYYLPIGGALLRL
FT                   VLPLPMILLHLRRGTSTALEGLIIQFLLLLILMGPIRGTLFLFPYGILAFWLGWSWFKQ
FT                   KNWWLSWSVGFILGTLGFFIRVFALSTLVGDNLWIIITRASYGLLDKFIELFNLPFSPS
FT                   IRIIQLVALLLIIFQEMVYVLTIHILSYSLFPRLNSNIPDPPKIMNGFVDLGL"
FT   gene            448895..450052
FT                   /gene="cobT"
FT                   /locus_tag="P9515_05011"
FT   CDS_pept        448895..450052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="P9515_05011"
FT                   /product="NaMN:DMB phosphoribosyltransferase"
FT                   /note="COG2038 NaMN:DMB phosphoribosyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71710"
FT                   /db_xref="GOA:A2BV99"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:A2BV99"
FT                   /protein_id="ABM71710.1"
FT                   /translation="MQKTYLGIKLFGSKINQKLCSERVETLKKEIDNFIFYLVIAGTET
FT                   SQIRGISAAGINSKARRKTALADAEFLLFGAFIDHKYKLPFLNAGVTPALISYVCSKLI
FT                   CASPIVVPIGINEKPYFRHLIVENYSVGPSKCLTTGKSMNKNRVLSLYKKGLDIGKSTN
FT                   QPIFISESVPGGTTTAQAVMEAFGLNVNKLIGSSLINAPRALKTKVIKAGLLNSNLNYD
FT                   FDSLDVISSVGDPFQAFSMGLLIGARLANQTVVLSGGSQMLAIVLLALEFIDSKEKQEF
FT                   VDFVFIATTGWLVKDNALNDLLDLITEKHKVNLIGLASPLNFESSKYEELSDYEIGYVK
FT                   EGVGAGGMSIFAFLKGFSNEEIVSMCQINLERMKKLGQISLEENL"
FT   gene            450053..451051
FT                   /locus_tag="P9515_05021"
FT   CDS_pept        450053..451051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71711"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVA0"
FT                   /protein_id="ABM71711.1"
FT                   /translation="MLKNYSTRREFLNYGKLSLLLLLNSCSNSSRKISISLQSSFYPQS
FT                   LKDTLPKSWEKEIINLSKLDLIKNKKLSNSDYMLINDGWINSLNFENFQSLNNLFNNDR
FT                   LDNRSKEFLNDFKEYQSNKLFPIGVVPYAVVIKNNKNLISDASQSWDFLLAEKLKGKII
FT                   FPQSPRIIMSILKKINAKNSFSKLKNQVMLFDDQNSINWLINSQATVAIVPYSQCVKYL
FT                   KFDSRLSIVFPNKGVPLIWYFLLSKSKVNNQILIDWIKSFENRKTIDLLANEGWYLPFN
FT                   DEYSQNKYNINSKYNNSGPSKICWENSWSLPPINKKEKSNLENLWNQSSTP"
FT   gene            complement(451040..452182)
FT                   /locus_tag="P9515_05031"
FT   CDS_pept        complement(451040..452182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05031"
FT                   /product="Aldo/keto reductase family"
FT                   /note="COG1453 Predicted oxidoreductases of the aldo/keto
FT                   reductase family [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71712"
FT                   /db_xref="GOA:A2BVA1"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVA1"
FT                   /protein_id="ABM71712.1"
FT                   /translation="MIIDSQKRLFGKGCNVSLFTLGTMRATENLNKMYSLIKRAHQAGI
FT                   NHLETAASYGKAEILIGEVLNKLENSEKITKKEWIITTKVLPKGDFNYLKKNFKNSLKN
FT                   LKLKKIHNLAIHGINLDEHLDWVLNGEGVKFLQWLIKNDLVDQVGFSSHGSYKLIEKAI
FT                   NCEVFSFCNLHLHFLDQSKISLAQLALKKKMGVLAISPADKGGRLYAPSDTLLKASAPY
FT                   HPLALAYRFLLSKGITTLSLGASKIEDFYIAEKLINSSQKLTSSEINALKNIEKVANEE
FT                   LKSSKCEQCRSCLPCPSEIPIPEILRLRNISLGYGQIEFAKERYNLIGRAGHWWEEKNA
FT                   SFCLECNECVPKCPSELNIPELLKQTHNLLVEKPKKRLWG"
FT   gene            452294..452953
FT                   /gene="ribE"
FT                   /locus_tag="P9515_05041"
FT   CDS_pept        452294..452953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="P9515_05041"
FT                   /product="Putative Riboflavin synthase alpha chain"
FT                   /EC_number="2.5.1.9"
FT                   /note="COG307 Riboflavin synthase alpha chain [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71713"
FT                   /db_xref="GOA:A2BVA2"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVA2"
FT                   /protein_id="ABM71713.1"
FT                   /translation="MFTGIIQSVGKLKKEKDFLIIEILDEPFDMQIGDSIAVNGICLTV
FT                   KEISNNQFKVDVSEETFKKTTLGDKSSINQIVNLEPAIRLSDRLGGHIVSGHIDGLGKV
FT                   ENIEKLEKSWMLKIKWQNKKFSKYIVDKGSICVNGISLTIAKSENQGEIFTIAIIPHTW
FT                   DNTNLKNLSIGDSVNLEGDALIKYVEKLLLFNKNRESDNFSEEISSNWLKENGWDK"
FT   gene            complement(452957..453310)
FT                   /locus_tag="P9515_05051"
FT   CDS_pept        complement(452957..453310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71714"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVA3"
FT                   /protein_id="ABM71714.1"
FT                   /translation="MLVGKELLEKSKLLSNKSEDEIARGCGYVGPSGRVLRKNFYRALV
FT                   EAKGYKLSSSGNTRPGNRSSRGRQAEFKTKVHCNGNLLIGHAYTKKLGLEPGQEYKIDL
FT                   KKDTKTISLIPIN"
FT   gene            complement(453407..454009)
FT                   /gene="cyoC"
FT                   /locus_tag="P9515_05061"
FT   CDS_pept        complement(453407..454009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="P9515_05061"
FT                   /product="Cytochrome c oxidase, subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /note="COG1845 Heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 3 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71715"
FT                   /db_xref="GOA:A2BVA4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVA4"
FT                   /protein_id="ABM71715.1"
FT                   /translation="MTTLDSSKEIKKNESELREHHEDFRMFGLITFLIADGMTFAGFFA
FT                   AYLTYKAVNPLPDGAIYELELPIPTLNTILLLVSSATFHKAGKALLKNKNSDTQKWLLV
FT                   TALLGIVFLICQLFEYFNLPFGLTDNLFASTFYALTGFHGLHVTLGTLMILIISWQARS
FT                   KGGRITNQNMFPLEAVELYWHFVDGIWVVLFIILYLL"
FT   gene            complement(454025..455644)
FT                   /gene="cyoB"
FT                   /locus_tag="P9515_05071"
FT   CDS_pept        complement(454025..455644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="P9515_05071"
FT                   /product="Cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="COG843 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 1 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71716"
FT                   /db_xref="GOA:A2BVA5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVA5"
FT                   /protein_id="ABM71716.1"
FT                   /translation="MTILIDSQDSNNKSLQPKGWLRYFSFSLDHKVIGIQYLVCGFLFY
FT                   LIGGTLASAIRIELTSPMSDFMPRDIYNQVLTLHGTIMIFLWIVPVVNGAFGNYLIPFY
FT                   VGARDMAFPRLNAVAFWLIPPSGLMLVASYFVEGAAQAGWTAYPPLSITTPQSGQIIWI
FT                   MSVLLLGGSSIFGGINFIATIIKLRRPGLKLMQLPMYCWAMLGTSLLVVLSTPVLAGTL
FT                   ILLSFDIVAHTGFFNPVLGGNVVVYQHLFWFYSHPAVYIMVLPAFGLVSEILPVHSRKP
FT                   LFGYTTMVFSIMGIVVLGLVVWAHHMFTSGTPPWMRLFFTIATAFIAVPTGIKFFNWVA
FT                   TLWGGKISINSAMLFSCGFIINFVFGGITGVALAQVPFDIHVHDTYFVVAHFHYIVYGG
FT                   TVFIIFSSIYHWFPKVTGKLMNEKLGILHFAITFIGFNLCFAPQHWLGLNGMPRRVAEY
FT                   DPQFQFVNQISSLGALLMAISTIPFLINIYASIKNGKDSGDNPWDALTPEWLTTSPPPV
FT                   ENWEGEAPLVEEPYGYGKPISK"
FT   gene            complement(455641..456444)
FT                   /gene="cyoA"
FT                   /locus_tag="P9515_05081"
FT   CDS_pept        complement(455641..456444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="P9515_05081"
FT                   /product="putative cytochrome c oxidase, subunit 2"
FT                   /EC_number="1.9.3.1"
FT                   /note="COG1622 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 2 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71717"
FT                   /db_xref="GOA:A2BVA6"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVA6"
FT                   /protein_id="ABM71717.1"
FT                   /translation="MLNKNFYLILIISAVFGISFWIGFNVNLLPVEASINAPIYDELFK
FT                   ILFIIGLIIFIGMTIAVVYSLFKFRKRKDQFGDGIALEGNLSLEIVWTIIPSIIVLIIG
FT                   LYSYNIYDRMGGMKELNHSHEMMKSNTEKIWAGISQTSNNEVANKNLSVEVSAMQFAFL
FT                   FNYPKGEFISGELHVPVDHKVSMKMESKDVIHAFWVPEFRIKQDIIPGQPTILNFTPTK
FT                   VGKYPIICAELCGPYHGGMRASIIVEEESDYKDWFNKNTKTEVSL"
FT   gene            456775..457632
FT                   /gene="ctaA"
FT                   /locus_tag="P9515_05091"
FT   CDS_pept        456775..457632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="P9515_05091"
FT                   /product="Uncharacterized protein required for cytochrome
FT                   oxidase assembly"
FT                   /note="COG1612 Uncharacterized protein required for
FT                   cytochrome oxidase assembly [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71718"
FT                   /db_xref="GOA:A2BVA7"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVA7"
FT                   /protein_id="ABM71718.1"
FT                   /translation="MALIALIVIGGATRVMEAGLACPDWPLCYGTFLPLNHMNLRVFLE
FT                   WFHRLDAFLVGLLILSQFILSLVWRKDLPNWLPKTYSVLVFLIIVQGSIGALTVINLLN
FT                   SYAVTAHLLTAFLLLITTITINQNLENNEVNKSLRWWRILLFVPLILTLTQSFIGVRLS
FT                   STWSAHLCLSFNKQCFILNTHKLFAIPISVLIVSILLISIYKQNLFLNNWKYLCSLFLL
FT                   LISQIFLGILSLKTNLTEPMLVIGHQLNASLLIAILTALIFRNPKLNKKINQSFNPVIV
FT                   SLNS"
FT   gene            457629..458627
FT                   /gene="cyoE"
FT                   /locus_tag="P9515_05101"
FT   CDS_pept        457629..458627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="P9515_05101"
FT                   /product="putative protoheme IX farnesyltransferase"
FT                   /note="COG109 Polyprenyltransferase (cytochrome oxidase
FT                   assembly factor) [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71719"
FT                   /db_xref="GOA:A2BVA8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVA8"
FT                   /protein_id="ABM71719.1"
FT                   /translation="MKSNLENFNFQTSIREQVVPSRKKVILPAWLEVAKPRLIPLLLAT
FT                   TLGGMALTEEWPLSSPKLICTLGGGALAAAAAGALNCLWEMDLDKRMKRTSNRALPSGK
FT                   LSFNTVFLGAVSCTFAAAMLLISGVNYLAAGLTLLGLCSYVILYTIILKPRTTQNIVFG
FT                   GVAGAIPPLVGASAATGHVGLSGWWLFGLVMLWTPAHFWALAILLKDDYASVGIPMLPS
FT                   VKGSAFTVKAISRYGWATVFMSILGVFALPEGGLLYVIMLLPFNGRLLQLINRLKSSPD
FT                   DLEKAKGLFRWSILYMFGICLLLLISRTQLSVDFEQQSMQIFLSLKAYFNI"
FT   gene            458665..459681
FT                   /gene="ccmA"
FT                   /locus_tag="P9515_05111"
FT   CDS_pept        458665..459681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="P9515_05111"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /note="COG1131 ABC-type multidrug transport system, ATPase
FT                   component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71720"
FT                   /db_xref="GOA:A2BVA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVA9"
FT                   /protein_id="ABM71720.1"
FT                   /translation="MNYIQITDLSKSYSDIEALKKLSMEINAGTLFGILGPNGAGKSTL
FT                   IKILATLVEPDSGEVFINNINLIKNPKKIRELIGYVAQDIALDKILTGRELLDFQSDLY
FT                   HMKKKEKYERIKLLIKQLDMNDWIDRKCGTYSGGMKRRIDLAAGLLHLPKVLILDEPTV
FT                   GLDIESRNIIWNLLKDLKNDGMTIILSSHYLDEIDKLADSLVIIDDGKVIAQGTPIQLK
FT                   NKLGGDRITLKVREFSSDEESKKICEILSSIDGISQIVTNKAQGYSLNFVVDKDKDLLT
FT                   KLKVELAFSKFEIFSLAQSQPSLDDVYLQATGKTLLDAEISMTGKRDLKKESKQSMR"
FT   gene            459735..460559
FT                   /locus_tag="P9515_05121"
FT   CDS_pept        459735..460559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05121"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /note="COG1682 ABC-type polysaccharide/polyol phosphate
FT                   export systems, permease component [Carbohydrate transport
FT                   and metabolism / Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71721"
FT                   /db_xref="GOA:A2BVB0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVB0"
FT                   /protein_id="ABM71721.1"
FT                   /translation="MELNQYSLFFLYQETIALTKRLFIQLKRRPSTLLAGILQPIIWLF
FT                   LFGALFSNAPEGFLPGVDSYGNFLGAGLIVFTAFSGALNSGLPLMFDREFGFLNRLLVA
FT                   PLASRLSIVLSSFFYITILSFVQSIVIMIVSFVLGYGWPDFYGLGIVFTTLILLVLFVT
FT                   SISLCLAFILPGHIELIALIFVINLPLLFASTALAPISFMPKWLGWLASLNPLTFAIEP
FT                   IRIAYTQNMNLGLVALHAPYGDLTCKSCISILFSLTIFSLIIIRPLLNRKLN"
FT   gene            460567..460971
FT                   /locus_tag="P9515_05131"
FT   CDS_pept        460567..460971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05131"
FT                   /product="possible glycoprotein"
FT                   /note="similar to Arenavirus glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71722"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVB1"
FT                   /protein_id="ABM71722.1"
FT                   /translation="MFLKDHLKDSYQKASFDKNNLKIENIINRWVHRFDIESLNELIAS
FT                   NQDQIKLLEEDKLVSNQDQTRSELLEIVQNEIEVKFKSNKENKYKENKINNKDIYGCYK
FT                   NKSEDNKLKELPLPKINNLRKWINNGKKAS"
FT   gene            complement(460973..462736)
FT                   /gene="groL"
FT                   /locus_tag="P9515_05141"
FT   CDS_pept        complement(460973..462736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="P9515_05141"
FT                   /product="GroEL2 protein (Chaperonin cpn60 2)"
FT                   /EC_number="3.6.4.9"
FT                   /note="COG459 Chaperonin GroEL (HSP60 family)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71723"
FT                   /db_xref="GOA:A2BVB2"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVB2"
FT                   /protein_id="ABM71723.1"
FT                   /translation="MPKQLSFSNDSREALENGVNTVANAVKVTIGPKAKNVVIERKFGS
FT                   PDIVRDGSTVAKEINLDNPISNLGAKLIEQVASKTKESAGDGTTTATILTQIMVQEGLK
FT                   NIAAGASPIELKKGMEKGLDIVLEKLKSKSIKINGSDIQKVATVSAGGDEEIGSIISKA
FT                   MDIVTSDGVITVEESQSLETELDITEGMSFDRGYSSPYFVTDQERQICELENPKILITD
FT                   QKISTLTNLVPILEEIQKSSSPFLVLAEDIEGEALTTLVLNKNSGVLNVSAVRAPSFGE
FT                   RRKAALEDIAILTGARLISEDQSMKLEEVTINDLGKAKKITISKDKTTIVAFDDTKDLV
FT                   KARVEKLKREVEITESEYDKDKINERIAKLAGGVALIKVGAATETEMKYKKLRIEDSLN
FT                   ATKAAIEEGVVSGGGQTLIEISEELSNLGKEKSVDLNTGIKIITKALLEPTKQIARNAG
FT                   FNGDVVIADIKRLNKGFNANNGQYENLNQSGILDPTKVIRLALQDSVSIAAMILTTEVA
FT                   VADIPEPEAPAPGGPGADPMGGMGGMGGMGGMGMPGMGGMGMPGMGGMGMPGMGGMGMP
FT                   GMGGMGMPGMM"
FT   gene            462870..463049
FT                   /locus_tag="P9515_05151"
FT   CDS_pept        462870..463049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05151"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71724"
FT                   /db_xref="GOA:A2BVB3"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVB3"
FT                   /protein_id="ABM71724.1"
FT                   /translation="MDKTDNLIFTLTATLAVAMTLIYFPLRFFLTLTARSRRLKLLQKI
FT                   RRLRDELGQPYERN"
FT   gene            complement(463050..463799)
FT                   /locus_tag="P9515_05161"
FT   CDS_pept        complement(463050..463799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05161"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71725"
FT                   /db_xref="GOA:A2BVB4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVB4"
FT                   /protein_id="ABM71725.1"
FT                   /translation="MSNKESLTGKVALITGASRGIGKEIALELSNLGAEVIINYSSSDE
FT                   KAEEVLNLIKGLGGKVHKLKFDVSKEESVSQAFEEIIKINGSIDILINNAGITRDGLLM
FT                   RMKSEQWDDVLNTNLKGVFLCTKYASKFMLKKRSGKIINISSIVGIIGNPGQANYSAAK
FT                   AGVIGFTKTCAKEFASRGINVNAIAPGFIETEMTEKLNNEEIVKAIPLGKLGSCSQIAD
FT                   LVSFLVSSNAGSYITGQTISIDGGMSI"
FT   gene            463893..464564
FT                   /gene="ispD"
FT                   /locus_tag="P9515_05171"
FT   CDS_pept        463893..464564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="P9515_05171"
FT                   /product="putative 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="COG1211 4-diphosphocytidyl-2-methyl-D-erithritol
FT                   synthase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71726"
FT                   /db_xref="GOA:A2BVB5"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVB5"
FT                   /protein_id="ABM71726.1"
FT                   /translation="MHVLIPAAGSGRRMEAGKNKLLIDLEGESLIYWTLKSVFSASLVS
FT                   WVGIIGQPNDKKKLLNSVKKFSNEIEWINGGNTRQESVFNGLNSLPSNAEKVLIHDGAR
FT                   CLINPDLINKCALELEENDAVILATKVTDTIKIVDNEGYIQQTPNRQNLWAAQTPQGFL
FT                   VKKLREAHEMAIEKNWKVTDDASLFEMLNWQVRIIEGNSSNIKITSPLDLQIAKLFLKD
FT                   Y"
FT   gene            complement(464561..465433)
FT                   /locus_tag="P9515_05181"
FT   CDS_pept        complement(464561..465433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05181"
FT                   /product="Putative carboxypeptidase"
FT                   /EC_number="3.4.17.1"
FT                   /EC_number="3.4.17.13"
FT                   /note="COG1619 Uncharacterized proteins, homologs of
FT                   microcin C7 resistance protein MccF [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71727"
FT                   /db_xref="GOA:A2BVB6"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVB6"
FT                   /protein_id="ABM71727.1"
FT                   /translation="MLTKLKKGDEINILAPASFIDKEENFTKGINILKTWDLKIAINGN
FT                   LSKKFGYFAGDDQTRFEELKKAQNSKLIIFAKGGWGSARLLEKNPNWGDGLMMGFSDTC
FT                   SLLLSKYKQGSFGSIHGPMITTLFKEPEWSLRRLRNLLFEGYVEDIKGIPLQKGKATGE
FT                   IIVSNLTIVSFLIGTNHFPELKGKIIIFEDINEDIYKIDRMLTYLRMTKKLNEIAGIGF
FT                   GSFSDDLYTPEWKELLKSLIFERFQEFDIPILFDLPIGHISGNACIPLGCKATLNGNNG
FT                   ILSISIPCY"
FT   gene            complement(465446..466333)
FT                   /gene="ubiA"
FT                   /locus_tag="P9515_05191"
FT   CDS_pept        complement(465446..466333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="P9515_05191"
FT                   /product="probable 4-hydroxybenzoate-octaprenyltransferase"
FT                   /note="COG382 4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71728"
FT                   /db_xref="GOA:A2BVB7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVB7"
FT                   /protein_id="ABM71728.1"
FT                   /translation="MINTDFRYKLNILFELLRWNKPTGRLILLIPAGWSLYLTPESNPS
FT                   FHMLLKIIMGGLLVSGLGCIANDIWDKKIDQKVLRTQNRPLAANKIGNKTAYLILIFLI
FT                   ICSFFLTLSLPENGRLLSISLAFFALPLILIYPSAKRWFKYPQLILSLCWGFAVLIPWA
FT                   ANEGDIKSIVLLFCWLATIFWTFGFDTVYALADMKYDLKIGVNSSAVNLASNTKITIQI
FT                   CYFLTSSFLAICALINQLNLIFWPIWLITAFLMQKDILKIFPESNHSIKKIGNHFKNQT
FT                   IYGGLILLGIIISS"
FT   gene            466456..468051
FT                   /gene="ppx"
FT                   /locus_tag="P9515_05201"
FT   CDS_pept        466456..468051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="P9515_05201"
FT                   /product="putative exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /note="COG248 Exopolyphosphatase [Nucleotide transport and
FT                   metabolism / Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71729"
FT                   /db_xref="GOA:A2BVB8"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVB8"
FT                   /protein_id="ABM71729.1"
FT                   /translation="MIQENELSNLQEKNILVASIDIGTNSTHLLISEVNLDLKSFSIKF
FT                   TDKSTTRLGEKDEEGNLTEESIQRVLYTLKRFKEYCNSNGVNQIVTAATSAVREAPNGR
FT                   DFLNRVQKELGIQIELISGSEEARLIYLGVLSGMAFEDESYVIIDIGGGSTELILADKK
FT                   DAIALTSSRVGAVRLKNDFLNEEPISNERSKFLKTFIRGSLEPSVEKIKRRLHKEKSVA
FT                   MIATSGTAISLGNLILSDLSQPKQKMHGYKFKKDNLEVILEKLIKMPITEIKKIPSLSE
FT                   RRAEIIIPGALILNTSMDMLDFNELTISERALREGLVVDWMLRQGIIKNEFNIQSNIRK
FT                   TTIVHQARKFGVDKNRSEKVTNIAFQIYDQTKNIFHSDTDSKAKKLLWAACHLYSCGKY
FT                   VNINSYHKHSWYLIKHCELLGYSQLETNIIASIARYHRKTLPKKRHESWQSLISKEEKT
FT                   IVLEMSLILRLAASLDQRPENVISSIKIKLQKNALSMEIIPFNSNQDLLLEKWSLESCR
FT                   NAIKELKNLELKVV"
FT   gene            complement(467964..468530)
FT                   /locus_tag="P9515_05211"
FT   CDS_pept        complement(467964..468530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71730"
FT                   /db_xref="GOA:A2BVB9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVB9"
FT                   /protein_id="ABM71730.1"
FT                   /translation="MNEINSNNSDNNSINNSSLKRIGNFIKEARLSRNLSIEELATDLK
FT                   IGTHQLQAIEGGNEEHLPEKVFIKAMVRRISEKLKVDTEFIMNEFKTERPEVKVEEIVQ
FT                   EVLIKTKQNKKIKNNNSILFILISGILGLLASSLIFNVISNSFQNQIPKQELKKKNQTT
FT                   FNSKFLSSLIALRHDSKLHFSRRRS"
FT   gene            468451..468609
FT                   /locus_tag="P9515_05221"
FT   CDS_pept        468451..468609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05221"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71731"
FT                   /db_xref="GOA:A2BVC0"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVC0"
FT                   /protein_id="ABM71731.1"
FT                   /translation="MIKFPILFKEELFIELLSELLEFISFKAIDFFSIIVIYIYLSTLI
FT                   DYLFLKR"
FT   gene            complement(468588..469343)
FT                   /gene="cobM"
FT                   /locus_tag="P9515_05231"
FT   CDS_pept        complement(468588..469343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /locus_tag="P9515_05231"
FT                   /product="putative precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="COG2875 Precorrin-4 methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71732"
FT                   /db_xref="GOA:A2BVC1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVC1"
FT                   /protein_id="ABM71732.1"
FT                   /translation="MDKKISFIGVGPGDPDLLTIKALKKIKSAEVIFWADSLIPEKIIN
FT                   FSLEGSEKIKTSTLTLEKITSIMIKRYNEGKTIIRLHDGDPCLYGAVKEQIEILKLNNI
FT                   KTEVIPGVSAFQVAAAYHQAELTIPDITQTIILTRAGGRTGMPEKESLKELAKHKSSLC
FT                   LYLSARHVKNSQKILLEFYPPETKVIVGYRVSWDDGWTSLIELKDMEKFTREKEIIRTT
FT                   IYIVSPAIKNITNRSNLYNPSYNHLFRNK"
FT   gene            complement(469336..470229)
FT                   /gene="lgt"
FT                   /locus_tag="P9515_05241"
FT   CDS_pept        complement(469336..470229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="P9515_05241"
FT                   /product="putative prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /note="COG682 Prolipoprotein diacylglyceryltransferase
FT                   [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71733"
FT                   /db_xref="GOA:A2BVC2"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVC2"
FT                   /protein_id="ABM71733.1"
FT                   /translation="MLTHQAFIQSPGDTFLNLGFLTIRWYGLLISLSVLIGIFISKKLA
FT                   KSRNINPQYISDILPSLIISSIIGARFYYVIFEWKQYSGNNFFTSFNLFDNVIQIPSFL
FT                   AIWEGGIAIHGGLIGGFLSILFFCKSKNIHLKTFMDILIPSIILGQSIGRWGNFFNNEA
FT                   FGIPTELPWKLFIPLQNRPIEFINYQFFHPTFIYESLWNFLIFILLISIFYKQNTNSSL
FT                   RPGFISCLYLIGYSFGRFWIEGLRIDPLCLGGLPPFCDGGLRMAQFISIVLFSSGLIGI
FT                   FFLRLKTYNKKTRKNG"
FT   gene            complement(470241..471194)
FT                   /gene="petA"
FT                   /locus_tag="P9515_05251"
FT   CDS_pept        complement(470241..471194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="P9515_05251"
FT                   /product="Cytochrome f"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71734"
FT                   /db_xref="GOA:A2BVC3"
FT                   /db_xref="InterPro:IPR002325"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR024058"
FT                   /db_xref="InterPro:IPR024094"
FT                   /db_xref="InterPro:IPR036826"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVC3"
FT                   /protein_id="ABM71734.1"
FT                   /translation="MINFKKQIMKKTTFFLCAMLLVSSILIAPRSSLAYPFWAQQNYES
FT                   PREATGKIVCANCHLAQMPTIAEVPQAVGADSVFKAVVKIPYKDDIKEIGADGSEVPLQ
FT                   VGAVVMLPDGFKLAPQERWTDEIKEETEGVYFTNYSEEKENIIIVGPLPGDTNKEIIFP
FT                   VLSPNPATNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVIFTSSSAGTINSIETIEDG
FT                   SYQINIENENGEITTEAVPVGPKLIVKEQDQITVGAPLTSDPNVGGFGQLDAEVVLQSP
FT                   YRIIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI"
FT   gene            complement(471199..471735)
FT                   /gene="petC"
FT                   /locus_tag="P9515_05261"
FT   CDS_pept        complement(471199..471735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="P9515_05261"
FT                   /product="Rieske iron-sulfur protein"
FT                   /EC_number="1.10.9.1"
FT                   /note="COG723 Rieske Fe-S protein [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71735"
FT                   /db_xref="GOA:A2BVC4"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023960"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVC4"
FT                   /protein_id="ABM71735.1"
FT                   /translation="MTQLSSNDVPSMGRRQFMNLLTFGTATGVALGALYPVANYFMPLR
FT                   AGGGGGGTSAKDELGNPVTKTGWLANHQAGDRSLVQGLKGDPTYLIVNSEGDIGEFGLN
FT                   AICTHLGCVVPWDSGANKFICPCHGSQYDTNGKVVRGPAPLSLALAHVDVDDDAVLVKQ
FT                   WSETDFRTNENPWWA"
FT   gene            471860..472177
FT                   /locus_tag="P9515_05271"
FT   CDS_pept        471860..472177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71736"
FT                   /db_xref="InterPro:IPR021420"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVC5"
FT                   /protein_id="ABM71736.1"
FT                   /translation="MKPLVVDEIIHYLIHRWGKKYDFRLFKRGKYLYFQMMWGFLGQES
FT                   FPLNEVEYKKSIADKIEILNRCGYSDEVREWLKKVNSRPRLGRAVSLQLNINERMKEFL
FT                   I"
FT   gene            complement(472146..472904)
FT                   /gene="tatC"
FT                   /locus_tag="P9515_05281"
FT   CDS_pept        complement(472146..472904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="P9515_05281"
FT                   /product="protein secretion component, Tat family"
FT                   /note="COG805 Sec-independent protein secretion pathway
FT                   component TatC [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71737"
FT                   /db_xref="GOA:A2BVC6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVC6"
FT                   /protein_id="ABM71737.1"
FT                   /translation="MKRKEDIKNNKYDSMSFTDHLDELRQRLLNSIYSILISIFFSFLI
FT                   IKPLISFLEIPASDIHLLQLAPGEFLFVAIKVAGYSGIIVSIPYIFYQVILFISPGLSK
FT                   KEKNLILPAVFGSGLLFFLGLLFSWWILVPAAINFFINFGADIVEPTWSIERYFDFVLL
FT                   LMSSTAIAFQLPVLQFILGSLGIITTAKMLSNWKIVVISSAILSAVITPSTDPLTMSLL
FT                   SISIIFLFFVGAGLTYISENLKSKTLSSSH"
FT   gene            complement(472985..473245)
FT                   /locus_tag="P9515_05291"
FT   CDS_pept        complement(472985..473245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71738"
FT                   /db_xref="GOA:A2BVC7"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVC7"
FT                   /protein_id="ABM71738.1"
FT                   /translation="MLDFLLGTHEFLGNHSFPEFIVGYLFGAALIIGAPTVFLLLAFVS
FT                   ALMKTNGKMGGYREYETYGESSLNDAPPFLLPDPTNPKLSK"
FT   gene            complement(473274..474974)
FT                   /locus_tag="P9515_05301"
FT   CDS_pept        complement(473274..474974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05301"
FT                   /product="possible secreted protein MPB70 precursor"
FT                   /note="COG1293 Predicted RNA-binding protein homologous to
FT                   eukaryotic snRNP [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71739"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVC8"
FT                   /protein_id="ABM71739.1"
FT                   /translation="MDITSIKSVLHELSEEILPSRFETAQQPEPNIIQFCLRGINSQTW
FT                   IEVSWSSDSARILKINRPEKLGAESTLSKQLRFGLKYMALVTIKQDKFERVIKFGFAKK
FT                   PGDEINKYLIFELMGKHSNIFYLDNNQKIIAVGKQINSNQSSFRTVSTGSIYSEPPKNM
FT                   KKEPSPDESYENWKESISSVPETLKYCLINTYQGVSPILTKQLEAFSNLGSSEIMNKNI
FT                   DFISEVNLKKIYQSWKIWIDRFNNNNFNFSIFDSFFYSVWFLKSEINNINNIDEINGLE
FT                   NYYDFYLKQRKIDALIKKIDGIIFKQTNLEKKNFNLQSDLLINSENYQIYKEKADKIFM
FT                   THEIQKKDIIKGQKLYKKSKKLKRAQNLIKERIDIYKNKLDRLEEFSALVDNLNSLKNE
FT                   NLTIRINLLEEIKDEICREFNVRTRNTRSQKKDLSRLESAPIEINTPKGLKIQIGRNMR
FT                   QNDLISFKFSKKGDLWFHAQESPGSHVVLKSSSQKPSDEDIQISADLAALFSKAKMNIK
FT                   VPISLVNIKDLQKITKGGPGCVSFHNVEIIWGNPTRGKDYIKKNLKRLI"
FT   gene            475049..475603
FT                   /gene="gmk"
FT                   /locus_tag="P9515_05311"
FT   CDS_pept        475049..475603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="P9515_05311"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /EC_number="2.7.4.12"
FT                   /note="COG194 Guanylate kinase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71740"
FT                   /db_xref="GOA:A2BVC9"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVC9"
FT                   /protein_id="ABM71740.1"
FT                   /translation="MKNLKKLIIITGPSGVGKGTVVKQLLDSKKDIWLSISATTRNPRM
FT                   GEKDGVNYYFISDEKFKDMVDKKEFLEWAQFAGNYYGTPLSTVNEKIESGFIVLLEIEV
FT                   EGAKQIKEKFPEALSIFLLPPSDEELEKRIRNRGTEKEEAIKMRLRRAKYEIASSDRFD
FT                   FVLTNYHVDETVKRIFEIIKS"
FT   gene            complement(475620..475754)
FT                   /gene="psaJ"
FT                   /locus_tag="P9515_05321"
FT   CDS_pept        complement(475620..475754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaJ"
FT                   /locus_tag="P9515_05321"
FT                   /product="Photosystem I PsaJ protein (subunit IX)"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71741"
FT                   /db_xref="GOA:A2BVD0"
FT                   /db_xref="InterPro:IPR002615"
FT                   /db_xref="InterPro:IPR036062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVD0"
FT                   /protein_id="ABM71741.1"
FT                   /translation="MFKIFNTKFMRSAPIVAAIWISLTAGIIIEFNRFFPDLLFHPMS"
FT   gene            complement(475784..476338)
FT                   /gene="psaF"
FT                   /locus_tag="P9515_05331"
FT   CDS_pept        complement(475784..476338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaF"
FT                   /locus_tag="P9515_05331"
FT                   /product="Photosystem I PsaF protein (subunit III)"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71742"
FT                   /db_xref="GOA:A2BVD1"
FT                   /db_xref="InterPro:IPR003666"
FT                   /db_xref="InterPro:IPR036577"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVD1"
FT                   /protein_id="ABM71742.1"
FT                   /translation="MKFFFSIILSFFLFLGITPIALAAKGQVLNPDRASTEFTASALTT
FT                   CSENPKFIERASSAKTQKDITRFERYGKAACGDDGLPHLIIGPPLEPFGALLNRGHEGD
FT                   LLIPGVLFIYIAGIIGWSGREYLIESKKTKNPADLEIIIDLDLARKCLIKGAQWPLLAN
FT                   KQGRNGDLREKDKNITLNGPR"
FT   gene            476414..477484
FT                   /gene="qri7"
FT                   /locus_tag="P9515_05341"
FT   CDS_pept        476414..477484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qri7"
FT                   /locus_tag="P9515_05341"
FT                   /product="probable o-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="COG533 Metal-dependent proteases with possible
FT                   chaperone activity [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71743"
FT                   /db_xref="GOA:A2BVD2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVD2"
FT                   /protein_id="ABM71743.1"
FT                   /translation="MLKVLAIETSCDETSVSVVSNSNDIYKIHSNIVASQIEDHSKWGG
FT                   VVPELAARKHLELIPFVLEEALEESKISIEEIDAIASTVTPGLVGCLRVGSITARSLCT
FT                   LYSKPFLGIHHLEGHLSSILFSKNYPKPPFLTLLVSGGHTELIKIGERRIMQRLGRSYD
FT                   DAAGEAFDKVGRLLGLSYPGGPAIAEIAKKGNSLKFNLPKCKISDKKGGFLKYDFSFSG
FT                   LKTAVLRLVEKIRLNGDEIPIPDIAASFERVVSEVLVERTIKCAVDYDLDNVVVVGGVA
FT                   ANDTLRKMMISEAGKKSIKVHLAPLNLCTDNAAMIGAAALFRLKFKAHESSLELGISGR
FT                   LPIDQANTLYANKPPF"
FT   gene            477491..477673
FT                   /locus_tag="P9515_05351"
FT   CDS_pept        477491..477673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05351"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71744"
FT                   /db_xref="GOA:A2BVD3"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVD3"
FT                   /protein_id="ABM71744.1"
FT                   /translation="MKKQTKIELKETKKFVDKQELNLWKRGFTPQAEIWNGRMATIGIG
FT                   IIFIVIFFISKFSSI"
FT   gene            477832..479031
FT                   /gene="nhaP"
FT                   /locus_tag="P9515_05361"
FT   CDS_pept        477832..479031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaP"
FT                   /locus_tag="P9515_05361"
FT                   /product="putative Na+/H+ antiporter, CPA1 family"
FT                   /note="COG25 NhaP-type Na+/H+ and K+/H+ antiporters
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71745"
FT                   /db_xref="GOA:A2BVD4"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVD4"
FT                   /protein_id="ABM71745.1"
FT                   /translation="MTPEKLGLLWGITVFAGACARLISSVFGFPSVVILLLSGLFIGRS
FT                   GLGLVEPLDLGQGLEAIVGLLVCLVLFEGGLNLKLPEGNIRNTVLKISLIRLFISLSAG
FT                   IFVAHWLAGLSWPVAGVYSAIVLATGPTVVSPLVDQIKLVSPLPEVLKAEGLVLEPIGA
FT                   VLALLLLELILGDLHGIKEVFIALMQRLGGGVLIGLSSGWLLSEILKKIKNEASFGIEL
FT                   QVTLGFIFLVYGICEYILPESGLPASVASGFIVGKREIIDKERLDNLIGELAQLAITVL
FT                   FPLLASDVSWGELSPLGWGGIVCVLMLMLIVRPISISLATMGRELDIKQRVFLAWLAPR
FT                   GIVTAAVASLFSIRLEQAGVLGAGRLQGLVFLTILMTVGIQGLTARPLANFLDLIEKKI
FT                   "
FT   gene            complement(479032..480513)
FT                   /gene="gltX"
FT                   /locus_tag="P9515_05371"
FT   CDS_pept        complement(479032..480513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="P9515_05371"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="COG8 Glutamyl- and glutaminyl-tRNA synthetases
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71746"
FT                   /db_xref="GOA:A2BVD5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVD5"
FT                   /protein_id="ABM71746.1"
FT                   /translation="MRVRIPSVPFFSKKKLEKRLRLAPSPTGLLHIGTARTALFNWLYA
FT                   KKTNGKFFIRIEDTDIVRSKSEYTTNILDGLNWLGLSWDEEPIKQSKRISIYKKNIKKL
FT                   LEIGAAYRCFTSESEISELREKQKSSGLPPRHDNRHRNLTSNEIKAFLSQGRSSVIRFK
FT                   IDDETEIKWEDQIRGEIKWKGRDLGGDLVLSRRALGDEIGDPLYNLAVVVDDNFMNITH
FT                   VVRGEDHISNTAKQILIYKALNFKLPIFSHTPLILNSEGKKLSKRDCVTSIDEFREMGY
FT                   LPEALANYMAFLGWSIKDSESEILSLKEISRVFNLSDINKAGAKFNWEKLNWINSQYIK
FT                   QMELTKLRQLIKNYWDDMGWESPSAEWDLKLINLIRDSMLLLKDAIDQSKPFFTLSQMQ
FT                   KEGEEFLNNKDETRESLKYILCYLKEENISTIDSNKAKEIIHKISVENSIKKGILMKSL
FT                   RVAFFGCLSGPDLIQSWELFSENKSDITLIERCLI"
FT   gene            complement(480487..480560)
FT                   /locus_tag="P9515_tRNAAspVIMSS1309111"
FT                   /note="tRNA-Asp"
FT   tRNA            complement(480487..480560)
FT                   /locus_tag="P9515_tRNAAspVIMSS1309111"
FT                   /product="tRNA-Asp"
FT   gene            complement(480709..480897)
FT                   /locus_tag="P9515_05381"
FT   CDS_pept        complement(480709..480897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05381"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71747"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVD6"
FT                   /protein_id="ABM71747.1"
FT                   /translation="MELDLQPGDVVKVLESAALGWVRARVIRVKSGGRVVVQSDQGREF
FT                   TARGNQVRLIEPAGFRP"
FT   gene            complement(480936..481008)
FT                   /locus_tag="P9515_tRNATrpVIMSS1309110"
FT                   /note="tRNA-Trp"
FT   tRNA            complement(480936..481008)
FT                   /locus_tag="P9515_tRNATrpVIMSS1309110"
FT                   /product="tRNA-Trp"
FT   gene            complement(481065..481535)
FT                   /gene="rplS"
FT                   /locus_tag="P9515_05391"
FT   CDS_pept        complement(481065..481535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="P9515_05391"
FT                   /product="Ribosomal protein L19"
FT                   /note="COG335 Ribosomal protein L19 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71748"
FT                   /db_xref="GOA:A2BVD7"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVD7"
FT                   /protein_id="ABM71748.1"
FT                   /translation="MAKEKQENESEIINQTDKSTVITVENEKKASISQTEKIHSSSNLI
FT                   KEFESEQLKKQLPEIYVGDTVKVGVKITEGNKERVQPYEGVVIAKRHGGLNQTITVRRI
FT                   FQGIGVERVFMLHSPQVASLKVERRGKVRRAKLFYLRDRVGKATRVKQRFDR"
FT   gene            complement(481567..481768)
FT                   /pseudo
FT                   /locus_tag="P9515_pseudoVIMSS1362536"
FT                   /note="frameshift; Pseudogene derived from PMED4_05241"
FT   gene            481963..482802
FT                   /gene="map"
FT                   /locus_tag="P9515_05401"
FT   CDS_pept        481963..482802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="P9515_05401"
FT                   /product="putative methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="COG24 Methionine aminopeptidase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71749"
FT                   /db_xref="GOA:A2BVD8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVD8"
FT                   /protein_id="ABM71749.1"
FT                   /translation="MKHFADLLLNKNNSRSNDQVPFIQRRRGIEIKSSREIKLMKKSSR
FT                   IVATVLREINDLIEPGMSTKDLDDFAEKRIREMGAAPSFKGYHGFPSSICASINNEVVH
FT                   GIPNKNVTIKDGDLVKIDTGAYLDGFHGDSCITICVGQVSDQAKKLSEVALEALFSGLS
FT                   KIKSGNTLLDVAGAIEDVVRLNGFSVVEDYTGHGVGRNLHEEPSVFNFRTNDLPNIILR
FT                   EGMTLAVEPIVNQGSKFCKTLNDKWTVITKDGKLSAQWEHTIVVMKDGIEILTDREF"
FT   gene            complement(482799..483515)
FT                   /locus_tag="P9515_05411"
FT   CDS_pept        complement(482799..483515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05411"
FT                   /product="Dehydrogenases with different specificities"
FT                   /note="related to short-chain alcohol dehydrogenases;
FT                   COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71750"
FT                   /db_xref="GOA:A2BVD9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVD9"
FT                   /protein_id="ABM71750.1"
FT                   /translation="MSERKTIGITGASGALGKELTKIFRNKGYKVIGFTHSKNNNEINN
FT                   HSPNEWIKWEVGKEFLLQEHLKKIDILILNHGIYDVRKKHNSSYENSIEINALSKFKFL
FT                   NLFETIASENKSPIVKEIWINTSEAEILPALNPSYEVSKSLIGQLVSFKKNLLDKNTKK
FT                   KLKIKKIILGPFKSELNPIGIMNPKFVSNRIYDFANLNIFLIIVSPNPLSYILFPLKEL
FT                   YIFLYCKLLIISKVSS"
FT   gene            483683..484792
FT                   /gene="pta"
FT                   /locus_tag="P9515_05421"
FT   CDS_pept        483683..484792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="P9515_05421"
FT                   /product="BioD-like N-terminal domain of
FT                   phosphotransacetylase"
FT                   /note="COG857 BioD-like N-terminal domain of
FT                   phosphotransacetylase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71751"
FT                   /db_xref="GOA:A2BVE0"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVE0"
FT                   /protein_id="ABM71751.1"
FT                   /translation="MSQILLIGSCEPFSGKSALVLGISKKLIEEGKKIRIGKPLATCTE
FT                   LTNLPAMTYEGLIDDDVKFIGSTLNIVEENLIPSVGLLDNISAEKRIANQDLSPGKGFK
FT                   QIEALVNDNFDGLNILEAAGSLNEGMIYGLSLPQLAKQLNAKVLIVNLWEDSKSVDALL
FT                   DAKQQLGDHFVGAVLNAVVPEEVEKIKNIIIPSLQEMNMKIFGVMPKSPLLRSVTVGEL
FT                   INRLDAQVICCPEKEQLLVETLSIGAMGVNSAMEFFRRRRNMAVVTGADRTDIQLAALE
FT                   ASTQCLILTGLGEPLSQIIHRAEELEVPILKVELDTLASVEIIEQAFGHVRIHESIKAS
FT                   YAVQLVQQHVNLQNIFETIDFPCNISDQC"
FT   gene            484818..485330
FT                   /locus_tag="P9515_05431"
FT   CDS_pept        484818..485330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71752"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVE1"
FT                   /protein_id="ABM71752.1"
FT                   /translation="MSRSLDLPSTQGVDTLAQELAKLQDNGKRRIAFLGSRHVPVVDIH
FT                   LIELIARSLAEEGHTIITSGSQGVNAAVIRAVLEINPSLLTVILPQSLDKQLPEIKDQL
FT                   KSVMHLVEKSENNELPLPMASSLCNQEIINRCDQLICFAFHDSETILNSCRCAEEMGKV
FT                   VSLLFFD"
FT   gene            485397..485894
FT                   /locus_tag="P9515_05441"
FT   CDS_pept        485397..485894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05441"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG1666 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71753"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVE2"
FT                   /protein_id="ABM71753.1"
FT                   /translation="MAENFSFDVVSDFDRQELVNALDQVKREISQRYDLKGTETILELE
FT                   KENIFITTNSELTLNSVIDIIRQKAIKRKLSLKIFEYKSIEAVSGNKVKQTITLKKGLN
FT                   QEIAKKISKNLRDEIKKINVSINGETLRVMSKSKNDLQLAIKLLENLEETYKIPLQANN
FT                   YR"
FT   gene            485919..486128
FT                   /locus_tag="P9515_05451"
FT   CDS_pept        485919..486128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05451"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71754"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVE3"
FT                   /protein_id="ABM71754.1"
FT                   /translation="MSDYTKSLIESLSLKIKDYPRFSLTEIEKFCWMAAHEHKHGVLPS
FT                   EYDIREIDEDLYLLLLQKFKVNNL"
FT   gene            486239..487045
FT                   /gene="hflC"
FT                   /locus_tag="P9515_05461"
FT   CDS_pept        486239..487045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="P9515_05461"
FT                   /product="Band 7 protein"
FT                   /note="COG330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71755"
FT                   /db_xref="GOA:A2BVE4"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVE4"
FT                   /protein_id="ABM71755.1"
FT                   /translation="MSTSFKNVTPTGPGGTATLLIVLSFTGFLLLTQSLFVVPSGQVAV
FT                   VTTLGKVSGGSRRAGLNFKVPFVQSVFPFDIKTQVQPEKFETLTKDLQVIRATATVKYS
FT                   VKPNEAGRIFATIASRNSDVYQKIVQPSLLKALKSVFSQYELETIATEFNVISERVADT
FT                   VAEELNSFDYVDVKSLDLTGLEIAEEYRAAIEQKQIAGQLLLRAKTEVEIAEQEALRYE
FT                   TLNKGLNDQVLFKLFLDKWDGSTQVVPGLPGTNGGTPPVIVGGNNR"
FT   gene            complement(487048..488289)
FT                   /gene="hemL"
FT                   /locus_tag="P9515_05471"
FT   CDS_pept        complement(487048..488289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="P9515_05471"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="COG1 Glutamate-1-semialdehyde aminotransferase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71756"
FT                   /db_xref="GOA:A2BVE5"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVE5"
FT                   /protein_id="ABM71756.1"
FT                   /translation="MPGGVSSPVRAFKSVGGQPIVFDRVKGPFAWDVDGNRYIDYIGSW
FT                   GPAICGHAHPEVITALQEAIEKGTSFGAPCVQENKLAEMVIDAVPSVEMVRFVNSGTEA
FT                   CMAVLRLMRAFTGRDKVIKFDGCYHGHADMFLVKAGSGVATLGLPDSPGVPRTTTANTL
FT                   TAPYNDLEAVKKLFSENPDAISGVILEPIVGNAGFITPEPGFLEGLRELTTENGSLLVF
FT                   DEVMTGFRISYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRKEIMSMVAPSGPVYQA
FT                   GTLSGNPLAMTAGIKTLELLKQEGTYEKMGLATSRLIEGIMQSAENNGIAINGGSVSAM
FT                   FGFFLCEGPVRNFEEAKTNNSELFGKLHREMIKRGVYLAPSPFEAGFTSLAHSEEEIDR
FT                   TIEAFDQSFSVIKN"
FT   gene            complement(488576..489421)
FT                   /gene="xthA"
FT                   /locus_tag="P9515_05481"
FT   CDS_pept        complement(488576..489421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="P9515_05481"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="COG708 Exonuclease III [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71757"
FT                   /db_xref="GOA:A2BVE6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVE6"
FT                   /protein_id="ABM71757.1"
FT                   /translation="MLIATWNVNSVRTRLSQIINWIKNVNPDILCLQETKVIDNSFPLT
FT                   PFEELGYEVTVHGQKSYNGVAIISKFKIENIIKGFTNENEEKSNFLNFNEQKRLISADI
FT                   NGLKIINVYVPNGSSLDSDKFDYKIKWLNHLSSFLDKQVREDDLVCFVGDFNIAPFDID
FT                   IHCPQKYEGGIMASKIEREALKKVIKGRFIDSFRIFEKNTGHWSWWDYRNNAYELNKGW
FT                   RIDHIYISNNLSSQLKSCVIERSQRENSQPSDHAPVLINLEIDNQSEVYFDDDDDLFEI
FT                   "
FT   gene            489493..489789
FT                   /locus_tag="P9515_05491"
FT   CDS_pept        489493..489789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71758"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVE7"
FT                   /protein_id="ABM71758.1"
FT                   /translation="MKFNLNKYIYISAKFFIFFIAIISMRSTILNAEDSYLNELEIDSS
FT                   TKFDKSSSELPSNPFEIVEMLRRANSMNEATKPSIAIDDALELFNKIEEKENL"
FT   gene            489838..490437
FT                   /locus_tag="P9515_05501"
FT   CDS_pept        489838..490437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71759"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVE8"
FT                   /protein_id="ABM71759.1"
FT                   /translation="MIKNPIQEVTNKLQYRAIGIVKGVYKPNDAEKLNRGTLTDKEGKI
FT                   IDTVVLGKALSLLKKYINLERNYFWIVYPRNKSTNNLHLQVAGIWDPYQLNQVDISDSE
FT                   KDPNDLLDELNLNNNYFSIRGELVYVNTQKKEIVIKICSSPRSKRSKNTTFKIIIEGEI
FT                   PLQFLNNFISLDVTRDGNTLRMVKYEVIEKIKSKKV"
FT   gene            490501..491724
FT                   /locus_tag="P9515_05511"
FT   CDS_pept        490501..491724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05511"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG1641 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71760"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVE9"
FT                   /protein_id="ABM71760.1"
FT                   /translation="MEEIFIECSPGVSGDMLLGAFIDLGVPKNIIEKTLTCFGLEKLYY
FT                   LNFRESKSCSIRGVKVEIEKIDQSTKRDWSSIKNLILKAQLEKKLKKRIYEVFESLAFA
FT                   EGIVHGIDPEKVHFHEIGAIDSLVDIIGVCASIEYLKPKKVFCNEPTLGRGFVQTDHGK
FT                   LSIPSPAVIELLRKKDIKVISRIDVIEGELSTPTGIALLCNLVESFNIPNKYSINSYGV
FT                   GIGNLELSCPNLVRVLKINTDNENLIHKKISPRYEEISIQEALIDDQTSEEIANLLEIF
FT                   RKQGAHDVSCQTINMKKNRTGFSIQVILPIEKQEYFRKLWFQYSNTIGLRERKEFRWVL
FT                   LRRRGECLTTFGNIKFKQSMKPDGTISMKPENDEILRLQIEHNKTAQEVRRIIKESCNE
FT                   FKAFEDWK"
FT   gene            491715..492677
FT                   /locus_tag="P9515_05521"
FT   CDS_pept        491715..492677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71761"
FT                   /db_xref="GOA:A2BVF0"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVF0"
FT                   /protein_id="ABM71761.1"
FT                   /translation="MEIRFKMQKDFLIKVLKNINFEMLKNLFFLLSLSYFCIYFFKNFD
FT                   QISFNVDFARNANYILLSFLLCILSIFFNALAWKNIVIWFGKTKTKNNLISFYAITNIL
FT                   KYVPGGIWHFFERYSFLKDISNPQLAFYTSLIEPYFMLCSSFLLASVGIIFSPFYFLLL
FT                   LPLLFLNKKLIYLILRRLETLKTKTISVLKIKNAKYQFNERIKIISFFPSKAFFFETLF
FT                   VLSKFIGFIICLYIVNFEQQYNIFYLLVIFCMSWAIGLVVPTAPGGIGVFESCFLFFVG
FT                   KNIPQNPIFVSLIYFRLISTSADLLLGLPFLFRKLLKRI"
FT   gene            complement(492674..494212)
FT                   /gene="thiP"
FT                   /locus_tag="P9515_05531"
FT   CDS_pept        complement(492674..494212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="P9515_05531"
FT                   /product="putative iron ABC transporter"
FT                   /note="COG1178 ABC-type Fe3+ transport system, permease
FT                   component [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71762"
FT                   /db_xref="GOA:A2BVF1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVF1"
FT                   /protein_id="ABM71762.1"
FT                   /translation="MKIIIKHTKKLLTYLKPLDIASLIVAVVVIIPIFNFLIEGIGYVL
FT                   GGNFSLGFSGRKEIFGTLKLLILTSFFGGGLGTLNGWLLSNCEFRLRKNLRIFQLIPLA
FT                   TPAYLITAVLQDLGSILGYQITGLWWGVLILSITTYPYVFILANESFNKFGVNQINASR
FT                   GLGIGPWGSFFKIALPMALPALTTGISLMCMEVMNELGTVELLNIPSISKGITENWIIE
FT                   GNPKSDIGLSLVALLIVFALILFEKFSRKKTKRWSENPASLDSLGWELRGYRSYLAVLV
FT                   TLFPPLFSIGLPFSWFLLNIDQLKKGFTTELLSLTLRTVSLGIIAALLTLFFSLIFTLA
FT                   NRQSKSLLTKFITFPAGIGYAIPGTVLAISLITISNTKFHFIALCLLIWGYIVRFLTIS
FT                   KGTLDSGFERISPSLDEAAKGLGSNWLDVIKKIHLPLLKGPIFVGSLLVFVDTIKELPI
FT                   TFILRPFDFDTLSVRIYQYAGDERMAEALLPALFITIVGLIASSTLIPSLEKKN"
FT   gene            complement(494232..495305)
FT                   /locus_tag="P9515_05541"
FT   CDS_pept        complement(494232..495305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05541"
FT                   /product="Putative GTPases (G3E family)"
FT                   /note="COG523 Putative GTPases (G3E family) [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71763"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVF2"
FT                   /protein_id="ABM71763.1"
FT                   /translation="MIEKLIPVTIISGFLGSGKTTLLNHILKNQVGIKTAVLVNEFGEI
FT                   GIDNELIIKTAEDMIELNNGCICCTINGELLNTVSKILERPEKIDYLIVETTGLADPLP
FT                   VAMTFAGGDLREKVRLDSIITLIDADNFDFDIKNSSVAYSQILYGDILLLNKCDLVTDA
FT                   QLNKIEKYINGIKKEPRILRAINSEVGLQTIISVGLFETDTFQFNEKMKKNIDLNDHSS
FT                   HSHDHSSHSHDHSSHSHDHSSHSHDHSSHSHDLINNIEGFTSVSFKTIEPFSLRKFQNF
FT                   LDNQISQNVFRAKGILWFVESERKHIFHLSGKRFSLDDYEWENEKLNKIVLIGKNLDHQ
FT                   TIKNQLDSCRFNSRDEA"
FT   gene            complement(495350..495640)
FT                   /locus_tag="P9515_05551"
FT   CDS_pept        complement(495350..495640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05551"
FT                   /product="4a-hydroxytetrahydrobiopterin dehydratase (PCD)"
FT                   /EC_number="4.2.1.96"
FT                   /note="COG2154 Pterin-4a-carbinolamine dehydratase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71764"
FT                   /db_xref="GOA:A2BVF3"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVF3"
FT                   /protein_id="ABM71764.1"
FT                   /translation="MKPHLLQNEELKELIAKIPGWEIISNHLEREFNFGDFIEAFSFMT
FT                   KIALICEKYNHHPNWENVYSKVIIKLSTHDLGGITNLDQKIASEINEIFEK"
FT   gene            complement(495677..496132)
FT                   /locus_tag="P9515_05561"
FT   CDS_pept        complement(495677..496132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05561"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG432 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71765"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVF4"
FT                   /protein_id="ABM71765.1"
FT                   /translation="MEQIFSKLIFKTNGEGLTDITHNLNLFIQKSNFQSGILNLTSLHT
FT                   SCSLTINENADPNVLKDLKKFMKSIVPNNCYTSLSKERKEIYYEHFQEGEDDMPAHIKT
FT                   ALTNTNLSLSFQEGEIILGTWQAIYLWEHRFSKKERIISVHIIGSKS"
FT   gene            496243..497748
FT                   /locus_tag="P9515_05571"
FT   CDS_pept        496243..497748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05571"
FT                   /product="Carboxypeptidase Taq (M32) metallopeptidase"
FT                   /EC_number="3.4.17.19"
FT                   /note="COG2317 Zn-dependent carboxypeptidase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71766"
FT                   /db_xref="GOA:A2BVF5"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVF5"
FT                   /protein_id="ABM71766.1"
FT                   /translation="MAETEWNKLGAYLKETQILGSIQSTLYWDQNTGMPKKGASWRSEQ
FT                   LTYIAKKLHKRNSSEEFSDLIKSAEDEFVSSLETLSSQEIIQSKKKNLELLTKEFNRQN
FT                   NLDPKLVESLAKAKSKGYESWQEAKYKSDFKIFLPYFDDLIKLRIEEANQISEKYTNWE
FT                   TLAQPFEPEITLEWLNNIFMPLKEIIPSLLSDLKKGEKYHWDLSPKSQQNLCSKLLDEF
FT                   GRDKDIVVVAKSPHPFSITLGPNDYRITTRIVEGEPFSSFLATAHEWGHSIYEQGLPSQ
FT                   SHQWFAWPLGQATSMGVHESQSLFWENRIVKSKSFSKRFFRHFVSEGCSLNNHSELWKS
FT                   INHLQAGLNRVEADELSYGLHILIRTELEIDLIEGDLNAKDIPSEWNKRYEELLGIKPS
FT                   NDAEGCLQDVHWSEGAFGYFPSYLLGHIISAQISSKMEKEIGLIDNLVEDGEYEKIIFW
FT                   LKNNIHKYGRSLNSMELVRNVTGEELTSSYFVNHLKSKLKDFC"
FT   gene            497811..498398
FT                   /locus_tag="P9515_05581"
FT   CDS_pept        497811..498398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05581"
FT                   /product="putative inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="COG221 Inorganic pyrophosphatase [Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71767"
FT                   /db_xref="GOA:A2BVF6"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVF6"
FT                   /protein_id="ABM71767.1"
FT                   /translation="MANLNQPPSRVTPNLLHILDAFTDSKKSVVNTIVELNSNTINKYE
FT                   LITETGHLKLDRVGYSSLAYPFAYGCIPRTWDEDGDPLDIEIVGVTEPLVPGSIVESRI
FT                   IGVMKFDDGGEVDDKVIAVLADDKRMDHINTFKDLGEHWLKETKYYWEHYKDLKKPGTC
FT                   RVNGFYGIEEAVKVIQDCESRYHKEIEPKLVD"
FT   gene            complement(498406..499356)
FT                   /gene="hemC"
FT                   /locus_tag="P9515_05591"
FT   CDS_pept        complement(498406..499356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="P9515_05591"
FT                   /product="Porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="COG181 Porphobilinogen deaminase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71768"
FT                   /db_xref="GOA:A2BVF7"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVF7"
FT                   /protein_id="ABM71768.1"
FT                   /translation="MTKLKLKIASRRSKLAMVQTLWVKEQLEKNIPNLEVSIESMATQG
FT                   DKILDVALAKIGDKGLFTKELEAQMLIGKADIAVHSLKDLPTNLPDGLKLGCITKREDP
FT                   SDALVVNKKNEIYQLESLPAGSIVGTSSLRRLAQLRYKFPYLNFKDIRGNVITRIEKLD
FT                   SGEFDCIILAAAGLKRLGFESRIHQIIPNEISLHAVGQGALGIECKSEDKEVLKIISVL
FT                   EDKASSQKCLAERSFLRELEGGCQVPIGVNSSIQNDEICLKGMVASIDGKKLIKDESSG
FT                   NVKYPEEVGKKLAEKLKLQGADKILSEIFEQFRDK"
FT   gene            complement(499452..500645)
FT                   /locus_tag="P9515_05601"
FT   CDS_pept        complement(499452..500645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05601"
FT                   /product="Putative principal RNA polymerase sigma factor"
FT                   /note="COG568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32) [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71769"
FT                   /db_xref="GOA:A2BVF8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVF8"
FT                   /protein_id="ABM71769.1"
FT                   /translation="MCPVAAKSKNSSPSSKKKTNKKINSNLKTGQEEEKITTNLDPVKN
FT                   SQQNSLKDKEIIENNEEFSGSDEEAKALGNIKLGPKGIYTEDSIRVYLQEIGRIRLLRP
FT                   DEEIELARKIADLLQLEELATQFESEKGHFPSVREWAELIDMPLSKFRRRLLLGRRAKE
FT                   KMVQSNLRLVVSIAKKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIR
FT                   QAITRAIADQSRTIRLPVHLYETISRIKKTTKVLSQEFGRKPSEEEIAESMEMTIEKLR
FT                   FIAKSAQLPISLETPIGKEEDSRLGDFIEADIENPEQDVSKTLLREDLEGVLATLSPRE
FT                   RDVLRLRYGIDDGRMKTLEEIGQIFDVTRERIRQIEAKALRKLRHPNRNGVLKEYIK"
FT   gene            500978..503251
FT                   /gene="priA"
FT                   /locus_tag="P9515_05611"
FT   CDS_pept        500978..503251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="P9515_05611"
FT                   /product="primosomal protein N' (replication factor Y)"
FT                   /note="COG1198 Primosomal protein N' (replication factor Y)
FT                   - superfamily II helicase [DNA replication, recombination,
FT                   and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71770"
FT                   /db_xref="GOA:A2BVF9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVF9"
FT                   /protein_id="ABM71770.1"
FT                   /translation="MTASNNLSNTSFKFEVLLDIGSHSNSFSYLDGNNLGVEVGDIVSV
FT                   KLKGRLLNGLTIARNPFLKRDKNGKDFDEESRFRYLSIEGIVQKKVIQDWWREWLETLA
FT                   LSYRVSNLKMFKTAFPPGWIGKHKKISQKYRYQIWIKLQPNFHFRNYELNKRELSLINF
FT                   LGLKGKWQSELIKFGFNSKLINLMISKKLLIKTKRKKIFNTKLSSFKNDCISIKKPNLT
FT                   QEQKKVYVEMQEMQPGEVCLLWGETGSGKTEVYMRMAEDQLLNKKSCLILAPEIGLIPQ
FT                   LIDRFSKRFQSEVIEYHSNCSSRHRTLVWEKIIDEDEPVIVVGTRSAVFLPIRNLGLIV
FT                   MDEEHDVSYKQDSPMPCYDARDVALERVKRNPTKLIFGSATPSMRTWKRVVYEKKIRLI
FT                   RMKERISTTEIPEIKVVDMRSEFKKGNTKIFCSELLELISKLKENQEQAIILIPRRGYN
FT                   GFLSCRNCGFIINCPNCDVPLSVHMGSKGKQWLSCHWCDHKAKLIYSCPDCKSNAFKPF
FT                   GIGTQRVIEFLNNEFPELRVLRFDRDTTSGKDGHRNILSMFSNGNADILVGTQMLAKGI
FT                   DIPNVTLSVVIAADGLLHRPDISSEEKSLQLFLQLAGRAGRADKTGKVVFQTYKPSHPV
FT                   LCYLKNRNYEGFLAESSILRKDAKLFPFCNVCLFKVSGKNYECTENTAAELAKYLMSFC
FT                   QGDKWTVIGPAPSLIAKVGNKFRWQILMHGPENSEVPLPDRAKLWQLIPKNVFLSLDLN
FT                   PVEL"
FT   gene            complement(503252..504358)
FT                   /locus_tag="P9515_05621"
FT   CDS_pept        complement(503252..504358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71771"
FT                   /db_xref="GOA:A2BVG0"
FT                   /db_xref="InterPro:IPR021499"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVG0"
FT                   /protein_id="ABM71771.1"
FT                   /translation="MDSYKQVVETAEFALIKGEYSFCIEYLYPIIESYPPSSKEGVNLR
FT                   TIMITALSGINKKEEAKIFCKELLKSHDFKVRDNAKYLMEIIDSPEIKKPDNWNITIES
FT                   NSNLNKTSLTSIKPNKNKKEKKFINISNIPTGETKPFQKGFLFIISFLLLLLIPLLSGC
FT                   VKIDDTLDLSEIDSINNSFEIESKYIKKFPWQINFEQKVKEIFPDAEISEGNLDFSFTN
FT                   KNLNIETAQETLYKIEKTASTLLGESTDLKINSVENNFFFFKKYIYSIDFDLHNLLYVD
FT                   DLELTLNIINPNRVRVRDLDENKVELSKNFIKWQLIPGELNSLEFTFWIWNKLFLGFLL
FT                   ILVSILLTYLIRFYRYQIGSNFPELPSN"
FT   gene            complement(504361..505212)
FT                   /gene="argB"
FT                   /locus_tag="P9515_05631"
FT   CDS_pept        complement(504361..505212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="P9515_05631"
FT                   /product="Aspartokinase superfamily:Acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="COG548 Acetylglutamate kinase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71772"
FT                   /db_xref="GOA:A2BVG1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVG1"
FT                   /protein_id="ABM71772.1"
FT                   /translation="MDDSLRVSILSEALPYIQSFSGRKIVVKYGGSIMEDEKLKKAFFR
FT                   DIALLSSVGVCPVVIHGGGPEINRWLSKLEISPKFEKGLRVTDDKTMEIVEMVLMGRVN
FT                   KQIVRGINKTGSLAVGISGLDGNLIQSRELGDGSHGLVGEVTQINPELLEPLIAKGYIP
FT                   VISSIGSTTDGISHNINADFVAGELAAAINAEKLILLTDTPGILKERNNPNSLAKQINL
FT                   KEARKFIEKNIVSNGMLPKTECCIRALAQGVRAAHIIDGRIEHSLLLEIFTNSGIGTMI
FT                   NA"
FT   gene            complement(505278..505808)
FT                   /locus_tag="P9515_05641"
FT   CDS_pept        complement(505278..505808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71773"
FT                   /db_xref="GOA:A2BVG2"
FT                   /db_xref="InterPro:IPR021275"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVG2"
FT                   /protein_id="ABM71773.1"
FT                   /translation="MKKYLSPANIITVAGGVLAFIGMTAYFTDSVNLSVPTFFYGVPIL
FT                   LIGLGLKTSEIPPVKLINRNDFKANRFNRPKELTELVRDVTRWRYGIKAHLESSLEALN
FT                   LWNEDNPPQLKEIEEISKEEKNGFKMRFEINDVPFEKWIEKQERLNRFFVKGLESEFII
FT                   NDNKKEFDLIFFY"
FT   gene            505839..506021
FT                   /locus_tag="P9515_05651"
FT   CDS_pept        505839..506021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71774"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVG3"
FT                   /protein_id="ABM71774.1"
FT                   /translation="MQDHNSTNQEDLILKLDQERSWLLENLDKGKWSEIRSELADLERK
FT                   ISKLIIRVQESNIDT"
FT   gene            complement(506024..506473)
FT                   /locus_tag="P9515_05661"
FT   CDS_pept        complement(506024..506473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05661"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /note="COG629 Single-stranded DNA-binding protein [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71775"
FT                   /db_xref="GOA:A2BVG4"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVG4"
FT                   /protein_id="ABM71775.1"
FT                   /translation="MNHCLIQAVINSSPQMRYTKDNKTPIAEMTVIFKGLRNEDPSREL
FT                   KVLGWGNIAQEMVSELKEGQNIVIEGRLRMNSITRQDGTKEKQPELTASRIHNISPAGQ
FT                   ITSEGKETNISRTKDSNSSEEKSGNTENTQWNSSPLVPEVDEIPF"
FT   gene            506503..507297
FT                   /gene="cobK"
FT                   /locus_tag="P9515_05671"
FT   CDS_pept        506503..507297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobK"
FT                   /locus_tag="P9515_05671"
FT                   /product="possible precorrin-6X reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="COG2099 Precorrin-6x reductase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71776"
FT                   /db_xref="GOA:A2BVG5"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVG5"
FT                   /protein_id="ABM71776.1"
FT                   /translation="MHNSENCHENVWILSGTSDGPAIVNKLLKLDYVVFVSVVTHKASM
FT                   SYSENSKLHIITGKLNDSREIIDFIEKNKINYVIDATHPFALIISKNLNEACKKIKKPL
FT                   LAFERKSEIKHSKNFNYINGLKDIKRQGLVNKNILLAIGSRLLNDTASYYLECGANVFT
FT                   RVIPTYESISKAFASCIKNSNIAILEPSKKKGNILEKKLCDHWDIDYILCRDSGSYAQM
FT                   NWEAIVYGSDINLFLVKRPKLKFKNPLLFFDYDELINQITKN"
FT   gene            507307..507621
FT                   /gene="cutA"
FT                   /locus_tag="P9515_05681"
FT   CDS_pept        507307..507621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="P9515_05681"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="COG1324 Uncharacterized protein involved in
FT                   tolerance to divalent cations [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71777"
FT                   /db_xref="GOA:A2BVG6"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVG6"
FT                   /protein_id="ABM71777.1"
FT                   /translation="MKPVLLVISTELNKKSAKKIAKLLIKKKLAACVSLKDINSIYEWE
FT                   GKVVEVNEVEITIKSKLELKNDLIVFLRKMLSYDLPQIVYKKFKSEKNYMNWINKSCLK
FT                   "
FT   gene            complement(507613..508629)
FT                   /locus_tag="P9515_05691"
FT   CDS_pept        complement(507613..508629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05691"
FT                   /product="Possible carbohydrate kinase"
FT                   /note="COG524 Sugar kinases, ribokinase family
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71778"
FT                   /db_xref="GOA:A2BVG7"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVG7"
FT                   /protein_id="ABM71778.1"
FT                   /translation="MKEKNKNFDQKKGIDLIGLGNAIVDIIVNVNDNFLEINDLKKGSM
FT                   NLINSNESETLLKNCTVIKKISGGSSANTVVCLAELGNNVQFIGRVKNDNFGNFFSIDI
FT                   KKSNTIFNTPPIEKGPSSAHSIIFITPDAQRTMCTYLGASIEFEPKDVDYNLIKESKYL
FT                   YLEGYLWDSDLAKKAFLKASKLAKESDTKIILSLSDSFCVDRHRESFLELIDNYVDIVF
FT                   CNESEVLSLFEENNLQSCQKSISSICELVIITLGSKGSLIINNGKLEEINPKILGKIID
FT                   TTGAGDLYAGGFIHGLINNYPTKKCGELGSICAGHIITQLGSRSNINLKNLLQEHSF"
FT   gene            complement(508650..509960)
FT                   /gene="purA"
FT                   /locus_tag="P9515_05701"
FT   CDS_pept        complement(508650..509960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="P9515_05701"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="COG104 Adenylosuccinate synthase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71779"
FT                   /db_xref="GOA:A2BVG8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVG8"
FT                   /protein_id="ABM71779.1"
FT                   /translation="MANVVVIGAQWGDEGKGKITDLLSRSADVVVRYQGGVNAGHTIVV
FT                   DDKVLKLHLIPSGILYEDTTCLIGSGTVVDPKILLKEIDMLIENGIDISGLKISSTSHV
FT                   TMPYHRLLDEAMEADRGSNKIGTTGRGIGPTYADKSQRNGIRIRDLLNEDRLKDVLEIP
FT                   LKEKNGVLEKIYGIRPLCKDEIIKEYLDYGKRLSKHVVDCTRTIHSAAKNKQNILFEGA
FT                   QGTLLDLDHGTYPFVTSSNPISGGACIGAGVGPTLIDRVIGVAKAYTTRVGEGPFVTEL
FT                   QGSINDQLCDRGSEFGTTTGRRRRCGWFDGVIGKYAVYVNGLDCLAVTKLDVLDELDEI
FT                   QVCIAYELDGKEIDYFPTNSDDLKKCKPIFKKLKGWQCSTANCRKLSDLPENAMNYLRF
FT                   LAELMEVPIAIVSLGANRDQTIVIEDPIHGPKRALLR"
FT   gene            complement(510042..510479)
FT                   /gene="psb27"
FT                   /locus_tag="P9515_05711"
FT   CDS_pept        complement(510042..510479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psb27"
FT                   /locus_tag="P9515_05711"
FT                   /product="possible Photosystem II reaction center Psb27
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71780"
FT                   /db_xref="GOA:A2BVG9"
FT                   /db_xref="InterPro:IPR017488"
FT                   /db_xref="InterPro:IPR025585"
FT                   /db_xref="InterPro:IPR038450"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVG9"
FT                   /protein_id="ABM71780.1"
FT                   /translation="MLVKEKPLLFPDFFAKVISFTICLSIFFTLFNSPSYAAKTSMTGD
FT                   YTQDTISVVKTLQIAVDTPKDSPNKNEVRDESLALITDYISRYRNRGMVNKTQSFTTMQ
FT                   TALNAMAGHYKNFATRPLPDKLKERLTKEFSLAEKMVLRES"
FT   gene            complement(510506..512308)
FT                   /gene="proS"
FT                   /locus_tag="P9515_05721"
FT   CDS_pept        complement(510506..512308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="P9515_05721"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71781"
FT                   /db_xref="GOA:A2BVH0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVH0"
FT                   /protein_id="ABM71781.1"
FT                   /translation="MRVTTSFPLGTLRDTPSEAEIISHQLLLKGGYIRRVNSGIYAYMP
FT                   IMLKVIEKISNIIEKELNNNGCSKLLLPQLHPAELWKRSERWEGYTAGEGIMFNLKDRQ
FT                   GKEFGLAPTHEEVITNIASEIINSYKQLPLCFYQIQTKFRDEIRPRFGLMRSREFIMKD
FT                   GYSFHSSKEDLSSFYEKMERSYENIFKNCGLDTVGVDADSGAIGGAASKEFMVTADAGE
FT                   DYILFTESGSYAANIEKAISLPSKEIPLKSFETEWLETPNQKSIVDICKENDLDASQIV
FT                   KVVIFVAKFENKSQLPILTCIRGDQHINEIKLFNLISKKYSSNLISLEIIEDNATIEKN
FT                   LTNFPLGYIGPDINDEVIKNSSSWDKSWIRIADHSANNLSSFVSGSNKVNFHKVFQTFS
FT                   FIDNQFLISDIRNAKKGDRISLESNEELKEKRGIEIGHIFQLGQKYSEKLNAKFSDKDG
FT                   KLKNLWMGCYGIGVTRIAQAAIEQNHDENGISWPIQISPFEILIIPTNLKDPYQTKLTE
FT                   EIYKEFESKKIDVLLDDRDVRAGVKFKDADLIGIPFQIIIGRDSINKEVEFICRSSKRK
FT                   IKISSQNLLEKFISESKILYNENS"
FT   gene            512486..512836
FT                   /locus_tag="P9515_05731"
FT   CDS_pept        512486..512836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05731"
FT                   /product="possible Helix-turn-helix domain of resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71782"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVH1"
FT                   /protein_id="ABM71782.1"
FT                   /translation="MDNIDSNISSSEELVGIDEVQKFLNRSRASVYRYTNTDLRNLNPS
FT                   FNPRKLNPEYRTDQKDPLRFHPNEIARFAKDILRIKEVTVEVFNSPSSAAQNILSQILE
FT                   ELKSIRSLLEKN"
FT   gene            512938..513195
FT                   /locus_tag="P9515_05741"
FT   CDS_pept        512938..513195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05741"
FT                   /product="possible Reverse transcriptase (RNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71783"
FT                   /db_xref="GOA:A2BVH2"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVH2"
FT                   /protein_id="ABM71783.1"
FT                   /translation="MKYSNSKKFVEGKLSENSSLINTPSELIRDDDDDPLSMRSLSISF
FT                   LGIMIAFLTILLPSISILLGRPLSQGNEITSFHLIKKDGS"
FT   gene            513185..513733
FT                   /locus_tag="P9515_05751"
FT   CDS_pept        513185..513733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05751"
FT                   /product="Inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="COG221 Inorganic pyrophosphatase [Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71784"
FT                   /db_xref="GOA:A2BVH3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVH3"
FT                   /protein_id="ABM71784.1"
FT                   /translation="MDLSLIPPSPTKGIVNLVVEIPAGSRNKYEYCSQAGIMALDRILH
FT                   SSVRYPFDYGFIPNTLADDGAPLDAMVIMDEPTFAGCLIKARPIGVLDMHDCGHYDGKL
FT                   LCVPVANPRQDNITSINQIAPNQLEDVAEFFRTSKGLDGRTVQIDGWRDFEVIEELLRK
FT                   CTSSKKKTFKVLKKSSIVK"
FT   gene            513735..514091
FT                   /gene="arsC"
FT                   /locus_tag="P9515_05761"
FT   CDS_pept        513735..514091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="P9515_05761"
FT                   /product="putative arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="COG1393 Arsenate reductase and related proteins,
FT                   glutaredoxin family [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71785"
FT                   /db_xref="GOA:A2BVH4"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVH4"
FT                   /protein_id="ABM71785.1"
FT                   /translation="MKKVIFYSYPKCSTCRKASKWLDQNNINYKFIDIVKEPPSKKFLE
FT                   IALIQFSFDIKKIFNTRGKSFKLIDFDIFDLTKKKIIELLSNDGKLIKRPFLIINESEL
FT                   ILGFNESEYAANFK"
FT   gene            514172..514807
FT                   /locus_tag="P9515_05771"
FT   CDS_pept        514172..514807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05771"
FT                   /product="Signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="COG681 Signal peptidase I [Intracellular trafficking
FT                   and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71786"
FT                   /db_xref="GOA:A2BVH5"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVH5"
FT                   /protein_id="ABM71786.1"
FT                   /translation="MTFLVSSCRSFIAEPRYIPSGSMLPELQINDRLIIEKISLKKKLP
FT                   QRGDIVVFKSPFSFDEKLVMSRSNPLPNKRYCFFMSFPPMSFIPGFRDQACDAYIKRVV
FT                   ALPGELVSVNVKGEVTINNKKIFEPYVTNFCSESYFNNCGGFKSLRVPKDHFLVLGDNR
FT                   SNSWDGRYWPGGKFLHKKEIIGKAYFRFWPLNNFGFFRNQDQPRSLSL"
FT   gene            complement(514770..516023)
FT                   /locus_tag="P9515_05781"
FT   CDS_pept        complement(514770..516023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05781"
FT                   /product="putative dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="COG44 Dihydroorotase and related cyclic
FT                   amidohydrolases [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71787"
FT                   /db_xref="GOA:A2BVH6"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVH6"
FT                   /protein_id="ABM71787.1"
FT                   /translation="MEKTFFFENINILMGPNTKAYKDSLLIIDGKIEAFGDEAKKRALK
FT                   KNIESSKSGNKLVAPLLVDIHSFLKDPLTGSNDNLEILKSRAKKSGFGAIAFLPNSDNW
FT                   RDKPEKIPFQNNNSFDLNIYFWGSFSLGDEGINLSPHDELLKSGSIGLCTRNFFDSPII
FT                   FKGLSLDTVNSSPIIFSLTKKNSVQKGIVNKDLKSLQSGFYVIDNNNELSEVKNILELK
FT                   NLFQSKNIIIKNISDSNSLKEIEKQKIPISTTISWWSLIADTNNLELDDLGWKVDPPLG
FT                   SQENREFLIKGLEKDLIQAIAVNSIGFNDENTFIPINDRSVGISSFELVLPLLWKEFII
FT                   KRDWPISKLWNYLSFNSSNLLNINQEKLSLGSKRWLIFDPDTKWVNSQKNLGYDSPSNF
FT                   PKKNELIKGKVIEVGLDF"
FT   gene            complement(516026..517354)
FT                   /gene="gpmB"
FT                   /locus_tag="P9515_05791"
FT   CDS_pept        complement(516026..517354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="P9515_05791"
FT                   /product="possible alpha-ribazole-5'-P phosphatase"
FT                   /EC_number="5.4.2.-"
FT                   /note="COG406 Fructose-2,6-bisphosphatase [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71788"
FT                   /db_xref="GOA:A2BVH7"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVH7"
FT                   /protein_id="ABM71788.1"
FT                   /translation="MSVRLVLVRHGLSSFNEKGLIQGRTDESYLTDKGYEQALKSGEAL
FT                   SDINFNKIYSSPLSRAAETAKTIKKNLKGENNIIYDENLLEVDLSKWSGLTINEIKNKY
FT                   PEKYLLWKTDPENLKLDGNDNLPYQPIQELYSQANEFIKNILNIYLEKNEVNILVVGHN
FT                   AILRCLILSLIGRPQKGFRKLKLDNASFSILNILKFRNSFKTQIECLNQTSHLNKKIPD
FT                   QIGDSRIFLVRHGETNWNKEGRFQGQINIPLNDNGKDQAKKASTYLKEVNFNKAFSSSM
FT                   DRPYETAQIILQNKSDIEIKKIKKLVEISHGLWEGKLENEIKEQWPELLKSWHEKPEEV
FT                   TMPKGESIREVSERSIKAWEEICLNQKKYDLTLLVAHDAVNKTLICNLLGIDYSNIWMI
FT                   KQGNGGITIIDLFNDPQKDHVISALNITTHLGGILDSTASGAL"
FT   gene            517473..518831
FT                   /locus_tag="P9515_05801"
FT   CDS_pept        517473..518831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05801"
FT                   /product="Possible membrane associated protease"
FT                   /note="COG1266 Predicted metal-dependent membrane protease
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71789"
FT                   /db_xref="GOA:A2BVH8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVH8"
FT                   /protein_id="ABM71789.1"
FT                   /translation="MNKNTSKTKIFLVFISLIITFLVWQQGLRDSLSRPSVGFDIGQKE
FT                   KEITELALPAIPDEFRKILVVNDPIEEIKTSLSEISFSELTERNKLIWIISLSDNEIKD
FT                   NDEYLNSFDNKKYKLVVKDLRKSNIDSSYKPDDDLLDLFKEDRFLYHLLSKRFDFNESQ
FT                   LITNALSKKMFLKIIVIRLVPILTIVLGSILVLRTSWSLLVSRKIEWGEFKPLDLDLLD
FT                   MILLISGGFVVLGEVISPLFSITLVELFSSNLSIELIQSLKIFFGYLFMAIPPLLIIYY
FT                   QIKSFDNKFIFKKDYFQFKFLPIKESIFQGFKGFLMIIPFVLLVSLIMNLLIENQNGSN
FT                   PLLEIVLNNNNYFSFFLLFLTTTFLAPLFEEVIFRGVLLPILSREFGIILGITISAFIF
FT                   ALAHLSIGEMPPLFTLGLGLGITRMISGRLSSSIVMHSLWNGMTFLNLLLLRT"
FT   gene            518917..519339
FT                   /locus_tag="P9515_05811"
FT   CDS_pept        518917..519339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71790"
FT                   /db_xref="GOA:A2BVH9"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVH9"
FT                   /protein_id="ABM71790.1"
FT                   /translation="MNIFENENSLSKNLYNTNQENSKNISLFNLKLIHKILNSINISLL
FT                   ILIFMLSFISFKSQRNWTIIYKNLAKTRSNNNNLIDYISKTEEFFINEVESLNTFKKTT
FT                   PKDLIYLDKQIPKQKKNELINNIRDGLKDSQYQRGY"
FT   gene            519339..521090
FT                   /locus_tag="P9515_05821"
FT   CDS_pept        519339..521090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05821"
FT                   /product="putative peptidoglycan synthetase (pbp
FT                   transpeptidase domain)"
FT                   /EC_number="2.4.1.129"
FT                   /note="COG768 Cell division protein FtsI/penicillin-binding
FT                   protein 2 [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71791"
FT                   /db_xref="GOA:A2BVI0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVI0"
FT                   /protein_id="ABM71791.1"
FT                   /translation="MKRNKKIVKLAPLKARRFKVTYIFCLTLIFGLFGRLVNLQVFSAS
FT                   DLQKKARLIQFTKTISLRSRRSIVDRNNRLIAYDKPLYKLWAHPKYFNFPGDPTQRLRS
FT                   IEEVINILSPILNVKEEILLSKFDNKITGIELLDEITENQAKKIKSLHISGLDLVKYSQ
FT                   RYYPQSNLYSNLIGFVNHDNKGSAGLELHLDNQIKVFNKSNLLKKGGDGTPLPDNSGPR
FT                   DFINDYQSLGLTIDSRLQKASFQALNKHVMKWKAKKGFAIVMNVNNGEILSLASIPSYD
FT                   PNKYWEYNSEIFKGWYSQDLFEPGSTFKPINLALALEEKVIQKDGLVEDSGKVNVGGWT
FT                   LSNWDKKGNGYIDYPKVLQVSSNVGMVKIMQNLPPKTYWDWLNKLGISKNIKTDLFEST
FT                   AGHLKSKDIFVNQSIEPAVASFGKGFSISPLKLAQLHAVLANGGVEVIPHVTLNFKDNL
FT                   KNKSQEEIFSNEVSRTVLEWMESVVDKGSGIGAKIEGYRIGGKTGTSQKAINGRYTSKK
FT                   VCSFVATFPINNPRYVVLVVIDEPSKAYAYGSTVAVPVAKEIIESLIVIEKIPPQIEKN
FT                   RLIVKKP"
FT   gene            521181..522182
FT                   /gene="tal"
FT                   /locus_tag="P9515_05831"
FT   CDS_pept        521181..522182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="P9515_05831"
FT                   /product="Transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="COG176 Transaldolase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71792"
FT                   /db_xref="GOA:A2BVI1"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVI1"
FT                   /protein_id="ABM71792.1"
FT                   /translation="MKSILEQLSSITTVVADTGDLDAIKKFQPRDATTNPSLILAAAKN
FT                   PDYVKLIDQSLESSRKSLPNGVSESELIKEAIDQVSVFFGKEILNLISGRVSTEVDARL
FT                   SFDTDATVKKARKLINHYKSFGIDKERILIKIASTWEGIKAAEILEKEGIRCNLTLLFN
FT                   FCQAVACANAKITLISPFVGRILDWHKVKTGKDNFSGKEDPGVISVTKIYNYFKEKGFK
FT                   TEVMGASFRNVDEIKELAGCDLLTIAPKFLDELSKEEGELIKKLDENIQSKSSIDYEFD
FT                   EKDFRLSMLEDQMASEKLSEGITGFSKAIEELEELLLKRFSEINNQKLISAT"
FT   gene            complement(522207..523340)
FT                   /gene="fixC"
FT                   /locus_tag="P9515_05841"
FT   CDS_pept        complement(522207..523340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="P9515_05841"
FT                   /product="NAD binding site"
FT                   /note="COG644 Dehydrogenases (flavoproteins) [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71793"
FT                   /db_xref="GOA:A2BVI2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVI2"
FT                   /protein_id="ABM71793.1"
FT                   /translation="MKEFDAIIIGGGLSGSSTALNLSKKGYSVLIIEKEATGIIKPCAG
FT                   GMASSMKQYLPLDIDQAIESKIRNVEFRWESSDNVNADLSGESPFWIIRREKLDQLLLD
FT                   EALKNGIEILRPAQVEEIISQNKTWRIKCSHKDIYKSKYLVIADGSQSQWAGYFNLGPR
FT                   KPKFANTIALRLKGLGNIPKDSVRFEFGFIKYGFAWAFPLKDSVNIGLGTFINNKLLED
FT                   EALNNKVLKSFGFEDLSFEKVHKKLRIWNGTHKLNGDRVVAVGDAASLCDPFLAEGIRP
FT                   SLISSYFAAESIHQCLSSNKSDLNTYSIKINNEWGKSMAWGKRIAQIFYRFPKTGYQLG
FT                   VKRKTAPKRIAQILSGQMSYEDIAKRVIKRLLTNSQG"
FT   gene            complement(523337..523885)
FT                   /gene="frr"
FT                   /locus_tag="P9515_05851"
FT   CDS_pept        complement(523337..523885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="P9515_05851"
FT                   /product="Ribosome recycling factor"
FT                   /note="COG233 Ribosome recycling factor [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71794"
FT                   /db_xref="GOA:A2BVI3"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVI3"
FT                   /protein_id="ABM71794.1"
FT                   /translation="MKEQEIQSSMNKSVEATQRNFNTIRTGRANASLLDRISVEYYGAE
FT                   TPIKSLASIATVDSQTISIQPFDISCLQAIEKAISMSDLGITPNNDGKVIRINVPPLTE
FT                   ERRKEFCKLASKYAEEGKVALRNIRRDAVDKEKKDEKEGLISIDESRDNQLEIQKFTDK
FT                   YISLIETKLSEKEKEILKV"
FT   gene            complement(523912..524616)
FT                   /gene="pyrH"
FT                   /locus_tag="P9515_05861"
FT   CDS_pept        complement(523912..524616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="P9515_05861"
FT                   /product="uridylate kinase"
FT                   /note="COG528 Uridylate kinase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71795"
FT                   /db_xref="GOA:A2BVI4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVI4"
FT                   /protein_id="ABM71795.1"
FT                   /translation="MTYKRVLLKLSGEALMGDKPYGIDPAIVQSIAEDVEKVIANNVQL
FT                   AIVVGGGNIFRGLKGSADGMDRATADYVGMLATVMNAISLQDGLERVGVETRVQTAIEM
FT                   QEIAEPYIRRRAMRHLEKGRVVVFGGGCGNPFFTTDTTAALRAAEINAEVVMKATKVDG
FT                   VYDRDPNKFNEAKKYSSLSYQQVLSDEIAVMDSTAIALCKDNNIPIMVFDIFKKGNISR
FT                   AVAGESIGSLIS"
FT   gene            complement(524748..525443)
FT                   /gene="cobO"
FT                   /locus_tag="P9515_05871"
FT   CDS_pept        complement(524748..525443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /locus_tag="P9515_05871"
FT                   /product="possible cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="COG2109 ATP:corrinoid adenosyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71796"
FT                   /db_xref="GOA:A2BVI5"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVI5"
FT                   /protein_id="ABM71796.1"
FT                   /translation="MPSEEQTSSRKTTSLDLQAKKLGIGGKLSPENDESLYKKRMQQRK
FT                   EVQSKRLKERKTKKGLLVVFTGNGKGKTTASLGMALRTIGHGHKVAIIQFIKGGWTTGE
FT                   EKALKMLSPDISWHALGEGFTWETQDRIRDEELVKGAWQVAKTFIKDESYKLIILDEIN
FT                   IATKLGYLSPKEIITFIQSVNKRKNHIVLTGRGASESIINQADLVTEMKLIKHPFKEQG
FT                   IKAQKCIEF"
FT   gene            complement(525463..526641)
FT                   /locus_tag="P9515_05881"
FT   CDS_pept        complement(525463..526641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05881"
FT                   /product="Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71797"
FT                   /db_xref="GOA:A2BVI6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVI6"
FT                   /protein_id="ABM71797.1"
FT                   /translation="MNIIHEINNVNDKFATQGSKLKIEKRGEKLNIRGSLPSKKNEHDF
FT                   SVQRIALGLNADFNGLEEAKKKLQLITLQLELNQFNWINWVKKTDKKEIKNEFKLLVKL
FT                   KEFEEFFFKENKNEYLSSTRKTTWRSSYKPYLKRIISIQSDSNTEDLNDIFIATLKTYK
FT                   EGTRSRKQCATSLSVLAKFLGHKLPEDWKLMAKGYGLNKASFRDLPSDEVIEDLWDKIP
FT                   NKSWQYVFGLMATYGLRNHEVFFCDLSSLNIYGDKIIRVLPTTKTGEHQVWPFHPKWID
FT                   KFELCKLGKDPGLLPNINRDLKDTTLQKIGKKITDQFKRYSLNIKPYDLRHAWAVRTIF
FT                   YDLPDTVAARMMGHSVSLHTQTYHHWITKRDQQQAVNNALSKYKKREIFKSL"
FT   gene            526707..527882
FT                   /gene="hemH"
FT                   /locus_tag="P9515_05891"
FT   CDS_pept        526707..527882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="P9515_05891"
FT                   /product="Ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="COG276 Protoheme ferro-lyase (ferrochelatase)
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71798"
FT                   /db_xref="GOA:A2BVI7"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVI7"
FT                   /protein_id="ABM71798.1"
FT                   /translation="MEKIGVLLMNLGGPERITDVGPFLYNLFSDPEIIRLPVPAFQKPL
FT                   AWLISTLRSTTSQQAYLSIGGGSPIRRITEQQARELQSKLRDKGLNVTTYIAMRYWHPF
FT                   TESAIADMKADGIDQIVVLPLYPHFSISTSGSSFRELKKLRDSDSDFKKIPMRCVRSWF
FT                   SQSGYLKSMVELISEQISLCESPADAHIFFTAHGVPKSYVEEAGDPYKEQIEDCSLLII
FT                   NELEKYLGHSNSYTLSYQSRVGPVEWLKPYTEEVLTDLGKAKVNDLIVVPISFVGEHIE
FT                   TLQEIDIEYKEIAEKAGIVNFRRVKALNTHPTFIEGLSDLVVSSLNGPVVNIEKASELP
FT                   EKVKLYPQEKWQWGWNNSSEVWNGRVAMIVFLILFIELISGSGPLHKLGIL"
FT   gene            528016..529779
FT                   /gene="ilvB"
FT                   /locus_tag="P9515_05901"
FT   CDS_pept        528016..529779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="P9515_05901"
FT                   /product="Acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="COG28 Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase] [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71799"
FT                   /db_xref="GOA:A2BVI8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVI8"
FT                   /protein_id="ABM71799.1"
FT                   /translation="MTLTSPPLSKGDSEKKYPKWITGAEALMDSLRIHGVRVIFGYPGG
FT                   AILPIYDAVYKAESDGWLKHYMVRHEQGGSHAADGYARATGEVGVCFGTSGPGATNLVT
FT                   GIATAQMDSVPLVVVTGQVPRPAIGTDAFQETDIFGITLPIVKHSWVIRDPSDIAKVVS
FT                   EAFFIASSGRPGPVLIDIPKDVGQEFFNYERILPGEIIPKGFKRNGEINDNDIDKAIEL
FT                   IKQSAKPLLYVGGGAISSGAHKEVEILAKNFQIPVTTTLMGKGAFDERDDLSVGMLGMH
FT                   GTAYANFAVTECDLLITVGARFDDRVTGKLDTFAPSAKVIHIDIDPAEVNKNRRVDVAI
FT                   VSDVAVALSKINEKSLSKNTSCNTRNWLEKINSWKNKHPLFIPPEEGEIYPQEVLLKVR
FT                   DLSPEAFITTDVGQHQMWAAQYLRNAPRRWISSAGLGTMGFGLPAAMGVKAALPTSEVI
FT                   CIAGDASVLMNIQELGTLSQYGLKIKLVIINNRWQGMVRQWQESFYHERYSSSDMSCGE
FT                   PDFVKLAESFGVKGFLISERKQLHNEFKSALDFDGPALINVRVRRGENCYPMVPPGKSN
FT                   AQMVGYVNCKN"
FT   gene            529841..530194
FT                   /locus_tag="P9515_05911"
FT   CDS_pept        529841..530194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05911"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71800"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVI9"
FT                   /protein_id="ABM71800.1"
FT                   /translation="MKKVISILIIFVLVIFFPIRTYSAEILQINSSSNILVGDQNRDLP
FT                   IKLFCVEINDKDNEQIAINLLKKEFPRGSKVKIKPLGFKENILLARVFDINETKEMSEL
FT                   LFAKDLLKENCQN"
FT   gene            complement(530201..530983)
FT                   /locus_tag="P9515_05921"
FT   CDS_pept        complement(530201..530983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05921"
FT                   /product="DUF152"
FT                   /note="COG1496 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71801"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVJ0"
FT                   /protein_id="ABM71801.1"
FT                   /translation="MDDNQQKFQEKDLKIKDKSFKYFLSPIFVENNFKHGFFTKTSSET
FT                   NLSVLSKQLNENNKDCILNQIHSNQIVFGSETQGSEIEEADGIFSDKHNQTLWIYTADC
FT                   MPILFADKSKRQVGAIHCGRKGLENKIIKNIIDKFYNNGCSNEDLIVAIGPSISKKYYL
FT                   VDNKTLENFYRYVPHNESISLIDNLPTLFKLKKLVNNKNKVLNALDLKKYAHLQLINEK
FT                   IPKKNIDISDLCTYESNYDFHSWRRSKTYSRQWSFISP"
FT   gene            complement(530994..531899)
FT                   /locus_tag="P9515_05931"
FT   CDS_pept        complement(530994..531899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05931"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71802"
FT                   /db_xref="GOA:A2BVJ1"
FT                   /db_xref="InterPro:IPR009472"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVJ1"
FT                   /protein_id="ABM71802.1"
FT                   /translation="MTPNKKIDSIQNFKKSDWELDFYSRPIIEKNGKKRWELIISSSKT
FT                   FKTEDIFLWNKICPANEVNSIWLTKSLNEALNDAERKGWEKPSKIRFWRASMKSIIKKS
FT                   IENIGIEALVSRRTYELFDRIEFLEKEVYPLENGYVRGVLAPTFTSRIANDPTPLPEAV
FT                   RGDALTISEISIEELKSAENWPIEFGDIFPIKKSLKNENLVPGLRLFSKERSLALAAWF
FT                   SSLEPVKLHIEKNQLILEASEDNKWLVTDLSEKVAKELNNKFTQNKNDSFGYQFISIQS
FT                   TPFIEKFAGFWILRDIELIS"
FT   gene            complement(531886..533112)
FT                   /gene="rps1b"
FT                   /gene_synonym="rpsA2"
FT                   /gene_synonym="nbp1"
FT                   /locus_tag="P9515_05941"
FT   CDS_pept        complement(531886..533112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps1b"
FT                   /gene_synonym="rpsA2"
FT                   /gene_synonym="nbp1"
FT                   /locus_tag="P9515_05941"
FT                   /product="30S ribosomal protein S1 protein B, putative
FT                   Nbp1"
FT                   /note="COG1098 Predicted RNA binding protein (contains
FT                   ribosomal protein S1 domain) [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71803"
FT                   /db_xref="GOA:A2BVJ2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVJ2"
FT                   /protein_id="ABM71803.1"
FT                   /translation="MKGVNDKGAQNDKKIKGQKNDVKKPLQVLHISKKDSEKEKEANFD
FT                   DNQKLSNGITKDINATKPQIIEAPLNEDKENHSANINLENKSYQELAKPVNFKDEDQEF
FT                   IIERKVDEFDFDENAFLEALNENEPIGTTGETIKGKIIALESDGLYVDIGGKAPGFMPK
FT                   KECGLGVITNFKEKFPIGLEMEVLVIKEQNADGMVTISSRALILRQSWEKVENSAKNGE
FT                   LIQVSINGFNRGGLTCDVDGLRGFIPRSQLEDGQDYQSLVNKTLKVAFLEVNPESRKLV
FT                   LSEKKALLVSKFSGLKLGQLIEGEVLGIKPYGFFVDLGGASGLLHQSSITNGSIRNLRE
FT                   IFEEGELIKALITEIDLERGRIGLNTALLENSPGELIVDKGKVMLEASERALKAKALFD
FT                   KKNLQNDSQ"
FT   gene            533176..533964
FT                   /locus_tag="P9515_05951"
FT   CDS_pept        533176..533964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05951"
FT                   /product="Creatininase"
FT                   /EC_number="3.5.2.10"
FT                   /note="COG1402 Uncharacterized protein, putative amidase
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71804"
FT                   /db_xref="GOA:A2BVJ3"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVJ3"
FT                   /protein_id="ABM71804.1"
FT                   /translation="MNFKSIPSEFEYLSWPEVKNISKEKRSTIIWPFGAVEQHGPHLPL
FT                   ATDSIFVDEIICEVLKLIPSETPIKKLPTQYIGFSPEHKGFDGTISLSSNLITLMIKEV
FT                   GSQLADMGFKRLVLINAHGGQISLLNTAARELRSIAPKLSVFPCFLWSGVDGLSELLTK
FT                   KEIENGLHASLAETSLMMALKSDLVGEERPFEEIEKQIPEGWSLEGNAPTAWFTDDLSK
FT                   SGVIGDSRGSNKELGITLKTLLTNHWYNMINNLMQSDWPK"
FT   gene            534083..534814
FT                   /locus_tag="P9515_05961"
FT   CDS_pept        534083..534814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05961"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71805"
FT                   /db_xref="GOA:A2BVJ4"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR022612"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVJ4"
FT                   /protein_id="ABM71805.1"
FT                   /translation="MQTLESNKNIQIGSSPESDSANLPDFTTDAYKDAYSRINAIVIEG
FT                   EQEAYDNYISIATLLPNDSEELTKLAKMELKHKRGFTACGKNLGVEADMSFAKEFFSKL
FT                   HGNFQAALKNESLTTCLLIQAILIEAFAISAYHVYIRVADPFAKKITQGVVNDEYLHLN
FT                   YGEKWLKENLSTCKDELIAANKVNLPIIKKMLDQVADDAATLAMDKEELMEEFMIAYQD
FT                   ALLEMGLDNREIARMAMAAIV"
FT   gene            534924..535964
FT                   /locus_tag="P9515_05971"
FT   CDS_pept        534924..535964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05971"
FT                   /product="Predicted dehydrogenase"
FT                   /note="COG5322 Predicted dehydrogenase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71806"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR016836"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVJ5"
FT                   /protein_id="ABM71806.1"
FT                   /translation="MFGLIGHSTSFEDAKRKASLLGFDHIADGDLDVWCTAPPQLVENV
FT                   EVKSATGISIEGSYIDSCFVPEMLSRFKTARRKVLNAMELAQKKGINITALGGFTSIIF
FT                   ENFNLLQHKQIRNTSLEWERFTTGNTHTAWVICRQLEINAPKVGIELKKATVAVVGATG
FT                   DIGSAVCRWLINKTGIGELLLVARQKEPLDNLQKELDGGTIKSLDEALPEADIVVWVAS
FT                   MPKTMEINTNNLKQPCLMIDGGYPKNLDEKFQGNNIHVVKGGIVKFFNDIGWNMMELAE
FT                   MQNPQREMFACFAEAMILEFEKCHTNFSWGRNNISLEKMEFIGAASVKHGFSAIGLDKH
FT                   PKVLAV"
FT   gene            535968..536975
FT                   /gene="accA"
FT                   /locus_tag="P9515_05981"
FT   CDS_pept        535968..536975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="P9515_05981"
FT                   /product="acetyl-CoA carboxylase, alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG825 Acetyl-CoA carboxylase alpha subunit [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71807"
FT                   /db_xref="GOA:A2BVJ6"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVJ6"
FT                   /protein_id="ABM71807.1"
FT                   /translation="MPRRYLLDFEKPLVELEKQIEQIRELARDSEVDVSQQLLQLETLA
FT                   TRRREEIFRSLTPAQKIQVARHPQRPSTLDFIQMFCDDWIELHGDRNGGDDMALIGGLG
FT                   SVNNQPVLLLGHQKGRDTKENVVRNFGMAKPGGYRKALRLMQHADRFSLPILSFIDTPG
FT                   AYAGLSAEEQGQGEAIARNLREMFGFKVPIIATIIGEGGSGGALGIGVADRLLMFEHSV
FT                   YTVASPEACASILWRDAAKAPEAATALKITGKDLLELGVIDEVLSEPAGGNNWAPIEAG
FT                   NTLKASIERHLSELLKMSKEELLEQRYSKFRVLGKFIESSSVEEIKEEFTQKKE"
FT   gene            536920..537684
FT                   /locus_tag="P9515_05991"
FT   CDS_pept        536920..537684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_05991"
FT                   /product="putative short-chain dehydrogenase"
FT                   /note="COG4221 Short-chain alcohol dehydrogenase of unknown
FT                   specificity [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_05991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71808"
FT                   /db_xref="GOA:A2BVJ7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVJ7"
FT                   /protein_id="ABM71808.1"
FT                   /translation="MNQVVLKKLRKNSLKKKNKLKLAFITGASKGIGRSTAITFANAGW
FT                   DLILLSRDLEMMETLRDELSETKSRINLVKCDLSNSNEIESSVKESIKKYGCPSVLINN
FT                   AGAAFNGNLIETSLQKWQEIIQINLTSIFQLCSLIVPKMRKNGGLIINVSSHASYNPFP
FT                   QWGPYCVSKSALAMFTKCLREEERSNSIRACTITLGSVNTPLWDSESINSDFDRTAMLS
FT                   STKVSDTILYIAEQPESQLIEDLTLMPAGGAF"
FT   gene            537838..538584
FT                   /gene="folE"
FT                   /locus_tag="P9515_06001"
FT   CDS_pept        537838..538584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="P9515_06001"
FT                   /product="putative GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="COG302 GTP cyclohydrolase I [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71809"
FT                   /db_xref="GOA:A2BVJ8"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVJ8"
FT                   /protein_id="ABM71809.1"
FT                   /translation="MTSTVPNDNLKENLGDQISNKLVSEIIRNRIKVNKKRFHANDNIS
FT                   DFINPGELDILQKEVASKVKDLLKSLVIDIDNDHNSQETAERVAKMYLKEVFKGRYQKR
FT                   PDVTDFPNAKKLDEIYTLGPISVRSACSHHMVPIIGDCWIGIKPGDKVIGISKFSRVAD
FT                   WVFSRPHIQEEAVMILADEIERLCEPKGLAILVKAKHYCMCWRGVKEPNTSMINSIVRG
FT                   DFRHDISLKQEFFELVKQQPNALSCY"
FT   gene            complement(538640..539293)
FT                   /gene="trpF"
FT                   /locus_tag="P9515_06011"
FT   CDS_pept        complement(538640..539293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="P9515_06011"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="COG135 Phosphoribosylanthranilate isomerase [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71810"
FT                   /db_xref="GOA:A2BVJ9"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVJ9"
FT                   /protein_id="ABM71810.1"
FT                   /translation="MPKTKTLVKICGITSIDQAVQIAELGTNAIGIISVNESPRYISPE
FT                   KKKEIFKTLKILYPNIERVSVVKNSPIESIIKNFLGEPNETIIQLHGDEDVDYCQQLRQ
FT                   KIPNIGIWKAFRIKNKKDIEKIKIYEKFVDAILLDSWNKETYGGSGKRIEKSYLEELSF
FT                   SKPWWLAGGVSKEWIYEILKKIKPNGIDISSSVEISPGIKDLEKTKNIIREINK"
FT   gene            539349..540572
FT                   /locus_tag="P9515_06021"
FT   CDS_pept        539349..540572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06021"
FT                   /product="Zn-dependent protease"
FT                   /note="COG1994 Zn-dependent proteases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71811"
FT                   /db_xref="GOA:A2BVK0"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVK0"
FT                   /protein_id="ABM71811.1"
FT                   /translation="MRSLQIFKIWGIPFKIHPYWFAILFLFSWSITNQVNLTSSEIYNI
FT                   KEAWLIGFLTSFFLLTTIIFHEVFHTFVSLNHGVKIKKITFYFLGAILQIDKECQTALG
FT                   NIKIAIVRPFLCLFTALILLLISYLSKSNEHIFTNIVNRLAILNLFLAFLNLIPVGSLD
FT                   GGNLLKSIIWYFSGSKNKGRNFLNKFTLVLSTLFFLSGIAILFGLNFYYGLLISFLGLF
FT                   GINSSKSESQFFRIENILKFSKVSDLKFKPLRKIEFDSNFVELNNVVKNKKDNQDKYLF
FT                   LTNSGRWDGFVEEKILKDVSVKKWKHTLVGEFKKPIKNFISIRGSTELWRAIEKLESTN
FT                   EGFLLVLNSAELPLGIIDRNKIGYFVFSKLGVELPYNLISKFNNKNQYPLGIEFPKIIN
FT                   LMKQKGDI"
FT   gene            complement(540583..541230)
FT                   /gene="lplA"
FT                   /locus_tag="P9515_06031"
FT   CDS_pept        complement(540583..541230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /locus_tag="P9515_06031"
FT                   /product="Biotin/lipoate A/B protein ligase family"
FT                   /note="COG95 Lipoate-protein ligase A [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71812"
FT                   /db_xref="GOA:A2BVK1"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVK1"
FT                   /protein_id="ABM71812.1"
FT                   /translation="MALDLHFLEKTISKVEILFTLRFYYWEGDWISLGYHQKIIPPHWE
FT                   KLFKDGIIKIVRRPSGGGAVLHSGGITYALTFKKSSYKSFSYELVNNWLIKSFNELGLG
FT                   LERGNLRKSTIKENCFGSSYISDLVDQYGFKRIGSAQYRKKGAFLQHGEIQLNPPRELW
FT                   FKIFGEEPPTKIDLNLTNEEIIKYLMKSFLESKTNLKIEKILLKKSDIKKLL"
FT   gene            541388..541492
FT                   /locus_tag="P9515_06041"
FT   CDS_pept        541388..541492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06041"
FT                   /product="possible photosystem I reaction centre subunit
FT                   XII (PsaM)"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71813"
FT                   /db_xref="GOA:A2BVK2"
FT                   /db_xref="InterPro:IPR010010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVK2"
FT                   /protein_id="ABM71813.1"
FT                   /translation="MEPSQSINLIILGLIVVMHAGVLALRLGISLARI"
FT   gene            541576..541923
FT                   /locus_tag="P9515_06051"
FT   CDS_pept        541576..541923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71814"
FT                   /db_xref="GOA:A2BVK3"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVK3"
FT                   /protein_id="ABM71814.1"
FT                   /translation="MSRNYYKSIATDKRSLASAIEKNYKDQEDFVSSVFLGLKVCFTLL
FT                   AMVSLIKIGYSSKIRLTRLREIKDSYLYEKSRFDVLSRRFDDLISFEGEQRFMKDQEQM
FT                   ISRDIIRVIWR"
FT   gene            541980..542984
FT                   /locus_tag="P9515_06061"
FT   CDS_pept        541980..542984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06061"
FT                   /product="Light dependent protochlorophyllide
FT                   oxido-reductase"
FT                   /EC_number="1.3.1.33"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71815"
FT                   /db_xref="GOA:A2BVK4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR005979"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVK4"
FT                   /protein_id="ABM71815.1"
FT                   /translation="MGNSTKGLVLITGTTSGVGLNTLKPLLRFGWEVIAVNRSNKRAIE
FT                   IAHQSLTDSEMKNMHFIEIDLSDLDDVRNGCDEILKKFKKPINSMICNAAVYKPRLRKP
FT                   ERSAQGFENSMAVNHFGHFLMINLLIDKILSSENEIYLNGKVTKFKPRITVLGTVTANY
FT                   SELGGRIPIPAPANLGNLSGFKNGFLAPISMANGKKFKPGKAYKDSKLCNMITVQELSK
FT                   KYSNERIIINSLYPGCVADTKLFRNTPWIFRFLFPIFQKFITKGYVSQRLAGERVAQVA
FT                   TFKKYAKPAVHWSWGNRQKSGRKAFSQKLSKRIIDSDISKQTYELTRKLVGLN"
FT   gene            complement(542990..543877)
FT                   /gene="chlL"
FT                   /locus_tag="P9515_06071"
FT   CDS_pept        complement(542990..543877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlL"
FT                   /locus_tag="P9515_06071"
FT                   /product="Protochlorophyllide reductase iron-sulfur
FT                   ATP-binding protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="COG1348 Nitrogenase subunit NifH (ATPase) [Inorganic
FT                   ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71816"
FT                   /db_xref="GOA:A2BVK5"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005971"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVK5"
FT                   /protein_id="ABM71816.1"
FT                   /translation="MTSTINKHLDGEGSVQVKQDPKVNIEEGALVIAVYGKGGIGKSTT
FT                   SSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPTDFMF
FT                   EGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAA
FT                   PLQHANYCLIVTANDFDSIFAMNRIVSAIKAKAKNYKVRLGGVVANRSKDTDQIDKFND
FT                   RTGLKTMAHFKDVDAIRRSRLKKCTIFEMEPTEDVIEVQNEYLSLAKNMLENVEPLEGT
FT                   PLKDREIFDLLGFD"
FT   gene            complement(544069..545649)
FT                   /gene="chlB"
FT                   /locus_tag="P9515_06081"
FT   CDS_pept        complement(544069..545649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlB"
FT                   /locus_tag="P9515_06081"
FT                   /product="Light-independent protochlorophyllide reductase
FT                   subunit B"
FT                   /note="COG2710 Nitrogenase molybdenum-iron protein, alpha
FT                   and beta chains [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71817"
FT                   /db_xref="GOA:A2BVK6"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005969"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVK6"
FT                   /protein_id="ABM71817.1"
FT                   /translation="MELTLWTYEGPPHVGAMRVASSMKEIHYVLHAPQGDTYADLLFTM
FT                   IERRGKRPPVTYTTFQARDLGGDTAELVKRNISEAVERFKPKTLLIGESCTAELIQDQP
FT                   GALAKGMGFNIPIVNLELPAYSKKENWGASETFYQIIRTLLNDKTNEINNINPQRWKSL
FT                   GRRPKVNILGPTLLGFRCRDDVIEIQRILSEQGIDTNVVAPLGSSPDDIKRLIDADINI
FT                   CLYQEIAETSCEWLKRKCGMEFTTTIPIGIKNTINFINEVHDKLGLPLTNKEELEHKSK
FT                   LPWYSKSIDSNYLTGKRVFIFGDGTHAIAAAKIAKDELGFEVVGLGTYSREMARQVRAA
FT                   AKDLNIEALITNSYLEVEDAMKKASPELVLGTQMERHSAKRLGIPCSVISTPMHVQDVP
FT                   ARYSPQMGWEGANVIFDDWVHPLMMGLEEHLIDMFKHDFEFVDGHQSHLGHTATKGLDN
FT                   IEDEHGLKNDTLKKNGGVLWTESGRAELTKVPFFVRGKVKSNTEKYALSKGLPEISDET
FT                   LYDAKAYFS"
FT   gene            complement(545653..546909)
FT                   /gene="chlN"
FT                   /locus_tag="P9515_06091"
FT   CDS_pept        complement(545653..546909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlN"
FT                   /locus_tag="P9515_06091"
FT                   /product="Light-independent protochlorophyllide reductase
FT                   subunit N"
FT                   /note="COG2710 Nitrogenase molybdenum-iron protein, alpha
FT                   and beta chains [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71818"
FT                   /db_xref="GOA:A2BVK7"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005970"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVK7"
FT                   /protein_id="ABM71818.1"
FT                   /translation="MSKVDFNKETGPREVFCGLTSIVWLHRRMPDAFFLVVGSRTCAHL
FT                   IQSAAGVMIFAEPRFGTAILEEKDLAGLADAHEELDRVVNDLISRRPEIKTLFLVGSCP
FT                   SEVIKLDLATVAEKLNLRFSGQVRFVNYSGSGIETTFTQGEDGALKALIPLMNSTDDEK
FT                   LLLVGTIANNVEDRFKKIFNSIGINNVESFPPRQSTELPKIGKNTKVILTQPYLSDTVR
FT                   DLKHRGCEIIYAPFPLGVEGSTKWVLAAAAAFKIPELKVHEVIAPLANRARQALQKHTE
FT                   ILRGKKLFLLPESQLEISLARFLHNECEMELIEVGTPYLNKDLMEEELNLLPDDTKIVE
FT                   GQHVEKQLDRVRASCPDLVVCGMGLANPLEAEGISTKWSIEMVFSPIHGIDQAADLAEL
FT                   FSRPLTRNQILTSKTLATY"
FT   gene            complement(547066..547434)
FT                   /locus_tag="P9515_06101"
FT   CDS_pept        complement(547066..547434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71819"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVK8"
FT                   /protein_id="ABM71819.1"
FT                   /translation="MVTSQKKEPDSSSSKNELSPDQTLGLVSLSLMQKLSQKDPSFSWL
FT                   VDTKPDQINVKKLRDRLELTELAINTGAPLSTTEVSILMGAKPGKSKIERGGLLATKIA
FT                   RNVWKLSKIGQGSSYYRN"
FT   gene            547532..548302
FT                   /locus_tag="P9515_06111"
FT   CDS_pept        547532..548302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71820"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVK9"
FT                   /protein_id="ABM71820.1"
FT                   /translation="MEPTSSLNRGESKKGSSLVTGSEVQSQANGASCFITTDSEKSLVS
FT                   RQASQVEQIELRTYVFLDSLQPQLSAYMGTVSRGFLPIPGDSCLWMEVSPGMAVHRVTD
FT                   IALKASNVRLGQMIVERAFGSLALYHKDQSTVLHSGDVVLDAIGSEVRKRTKPSTSWTE
FT                   VIRAITPDHAVLINRQNRSGSMIQSGMSMFILETEPAGYVLKAANEAEKSSNITIVDVK
FT                   AVGAFGRLTLAGKEGDVEEAAAAAIRAIEQISNN"
FT   gene            complement(548312..548896)
FT                   /locus_tag="P9515_06121"
FT   CDS_pept        complement(548312..548896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06121"
FT                   /product="HAM1 family protein"
FT                   /EC_number="3.6.1.15"
FT                   /note="COG127 Xanthosine triphosphate pyrophosphatase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71821"
FT                   /db_xref="GOA:A2BVL0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVL0"
FT                   /protein_id="ABM71821.1"
FT                   /translation="MNFPALTIASGNPKKVSEIFEMLDVLSLEVKKQPEYLNVEETGKT
FT                   YFENAFLKAKAAALETKTWALADDSGLEVDYLDGRPGIYSARYAKSKNEKISKLLRELS
FT                   DIPYRSAKFISCMVLCDPKGNLVKDTTGICWGEILKEPKYPNGEFESIFWIKEANCVYG
FT                   ELSHSQLIKLGSRGKAAKNISPFLKKEFGII"
FT   gene            549224..549535
FT                   /gene="ccmK"
FT                   /locus_tag="P9515_06131"
FT   CDS_pept        549224..549535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmK"
FT                   /locus_tag="P9515_06131"
FT                   /product="carboxysome shell protein CsoS1"
FT                   /note="COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein [Secondary metabolites
FT                   biosynthesis, transport, and catabolism / Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71822"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVL1"
FT                   /protein_id="ABM71822.1"
FT                   /translation="MATETMGIALGMIETRGLVPAIEAADAMTKAAEVRLIGREFVGGG
FT                   YVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARPHREVEPALGNGDFLGQKD"
FT   gene            549602..551017
FT                   /gene="rbcL"
FT                   /locus_tag="P9515_06141"
FT   CDS_pept        549602..551017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcL"
FT                   /locus_tag="P9515_06141"
FT                   /product="Ribulose bisphosphate carboxylase, large chain"
FT                   /EC_number="4.1.1.39"
FT                   /note="COG1850 Ribulose 1,5-bisphosphate carboxylase, large
FT                   subunit [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71823"
FT                   /db_xref="GOA:A2BVL2"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVL2"
FT                   /protein_id="ABM71823.1"
FT                   /translation="MSKKYDAGVKEYRDTYWTPEYVPLDTDLLACFKCTGQEGVPREEV
FT                   AAAVAAESSTGTWSTVWSELLTDLEFYKGRCYRIEDVPGDPEAFYAFIAYPLDLFEEGS
FT                   ITNVLTSLVGNVFGFKALRHLRLEDIRFPIAFIKTCGGPPNGIVVERDRLNKYGRPLLG
FT                   CTIKPKLGLSGKNYGRVVYECLRGGLDLTKDDENINSQPFQRWRERFEFVAEAVKLAQQ
FT                   ETGEVKGHYLNCTANTPEELYERAEFAKELDMPIIMHDYITGGFTANTGLANWCRKNGM
FT                   LLHIHRAMHAVIDRHPKHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDN
FT                   LRESFVPEDRSRGNFFDQDWGSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQFGGGTH
FT                   GHPWGSAAGAAANRVALEACVKARNAGREIEKESRDILMEAAKHSPELAIALETWKEIK
FT                   FEFDTVDKLDVQG"
FT   gene            551111..551452
FT                   /gene="rbcS"
FT                   /locus_tag="P9515_06151"
FT   CDS_pept        551111..551452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcS"
FT                   /locus_tag="P9515_06151"
FT                   /product="Ribulose bisphosphate carboxylase, small chain"
FT                   /EC_number="4.1.1.39"
FT                   /note="COG4451 Ribulose bisphosphate carboxylase small
FT                   subunit [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71824"
FT                   /db_xref="GOA:A2BVL3"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVL3"
FT                   /protein_id="ABM71824.1"
FT                   /translation="MPFQSTVGDYQTVATLETFGFLPPMTQEEIYDQIAYIIAQGWSPV
FT                   IEHVHPSGSMQTYWSYWKLPFFGEKDLNLVVSELEACHRAYPDHHVRIIGYDAYTQSQG
FT                   TAFVVFQGR"
FT   gene            551545..553842
FT                   /gene="csoS2"
FT                   /locus_tag="P9515_06161"
FT   CDS_pept        551545..553842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csoS2"
FT                   /locus_tag="P9515_06161"
FT                   /product="carboxysome shell protein CsoS2"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71825"
FT                   /db_xref="InterPro:IPR020990"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVL4"
FT                   /protein_id="ABM71825.1"
FT                   /translation="MSKKTSREIALERRKAMSDSGKKAAAYSSTTKERVRSSQDIKISG
FT                   TQSSPNNQNISKPATKHIPKTQVSRKSSSTTLSSKELVINRRKAMSTHGKSAINSSDRT
FT                   RTDVKKEIPINTVKSTINKNQEVENSYNTEIKTSKPNVKRRIKQKRKPITNTSRDIVLA
FT                   RREAQSKHGKSASKQNTSAASLARRGDPDLSSREISQRVRELRSKTGATGKKGNGKCRP
FT                   CGPNKNGAKQNIADASWKVGTSETDSGQIVTGTQANRSVKTTGNEASTCRTVTGTQYMG
FT                   AEVADQFCQDRPIYKQPLRSTVTATTSGNKVTGNEVGRSERVTGDEPGTCKNLTGTEYI
FT                   SANQSQKYCGDIPKNPSKVKHSTTTDGLKVSGSLPGRSTLVTGDESGSGHQLTGDQYLG
FT                   SEPNPQGKAFEKVGSYNTLNGNSVTGTGVGRSDHMTGNEHGSCKNITGDEYIGSQQYEK
FT                   FCGSKPKPEARKVGLSLSSKSNLISGTMTGRSKIVTGDEPGSCKVLTGTPYAGLDQINE
FT                   NCSTEISEDMKSRATINSGNNSNARLTGQQPGIGGVMTGAKKGACKNLTGTPYVGGDQF
FT                   SKTCDNPSHDTAYANPEKSAGNSWNEFSVKSPSRDKYSEKNTQGVTGNEYENGSKITGP
FT                   FDMAVDKVTGTEKFRFEPNKNITYKQKMEIEETDRAANTPEKRVTSRITGEGQSVGNVT
FT                   GDDWDRGDKVTGTEGASSRKRNPSRAGFTSAMPPLEVKRNEEVEKPDFLITGSSGNTRE
FT                   GQLVTFSGGARG"
FT   gene            553907..555379
FT                   /gene="csoS3"
FT                   /locus_tag="P9515_06171"
FT   CDS_pept        553907..555379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csoS3"
FT                   /locus_tag="P9515_06171"
FT                   /product="carboxysome shell protein CsoS3"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71826"
FT                   /db_xref="InterPro:IPR014074"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVL5"
FT                   /protein_id="ABM71826.1"
FT                   /translation="MKTFTENIHIQTKESNNLLNPVNLHKLTNNIQNENLFKYESKIKS
FT                   DFDEIVPTLKEIARIQHHEDFINKAQTISRKNLGIDLPLHILDKSWVKPLDMRALYAWC
FT                   AFKQHEKLSDNFFNNDPLEGAAGSRGAEDFEKFLLDCGIHLLDITPCSDGRLAHSVAYV
FT                   MRIPFSSVRRRSHAGALFDIENTVNRWVKTEHKRYRENIPNEAHKDTRYLKVVTYHFSS
FT                   VDPLHQGCAAHGSNDELAAGEGRNKLYAFKEAVENSFCCGASVDLMLIGLDTDTDSLKI
FT                   HLSNSDGSIDLEKTISTLDIYNSTINFSGDDAEREICQTISNHSSKDKLQGLEKFMYKL
FT                   IVNNISQIDYVKKFHKGSYEDIGHAERFIGVGIGFKEVHLRNLTYFAHLDTVEEGAPDL
FT                   DVGVKIFTGLNVSQDLPIPVVIRFDYSGKVPGAKDRAAKDCNRVNNAISIRYKSLVDKG
FT                   LLHTCLTIRDRDNIHSAQIIGMSLDKKTEEAH"
FT   gene            555382..555648
FT                   /locus_tag="P9515_06181"
FT   CDS_pept        555382..555648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06181"
FT                   /product="putative carboxysome peptide A"
FT                   /note="COG4576 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein [Secondary metabolites
FT                   biosynthesis, transport, and catabolism / Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71827"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR014076"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVL6"
FT                   /protein_id="ABM71827.1"
FT                   /translation="MLICKVVKPLVSTNRIPGFEHKHLQVVLDGSSNKVAVDAVGCKPG
FT                   DWVICVGSSAAREAAGSKSYPSDLTIVGIIDHWDPNSPKQIEV"
FT   gene            555654..555902
FT                   /locus_tag="P9515_06191"
FT   CDS_pept        555654..555902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06191"
FT                   /product="putative carboxysome peptide B"
FT                   /note="COG4576 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein [Secondary metabolites
FT                   biosynthesis, transport, and catabolism / Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71828"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR014077"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVL7"
FT                   /protein_id="ABM71828.1"
FT                   /translation="MEIMKVCGRMVCTQRVPGLGHMNLRILENNKGKKVVAVDPVGARE
FT                   GNWVFTSSGSAARFACPNPEVQTDLTIGGIIDFWEPN"
FT   gene            556003..556242
FT                   /locus_tag="P9515_06201"
FT   CDS_pept        556003..556242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71829"
FT                   /db_xref="GOA:A2BVL8"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVL8"
FT                   /protein_id="ABM71829.1"
FT                   /translation="MWNHRDSPSRIEKRFEFEEYQKISIFLKKIDELCKEKNIYPNISF
FT                   GKNFVSVSIFLDSTEILSNEKEFSTRLDNYFLEK"
FT   gene            complement(556248..556475)
FT                   /locus_tag="P9515_06211"
FT   CDS_pept        complement(556248..556475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71830"
FT                   /db_xref="InterPro:IPR021483"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVL9"
FT                   /protein_id="ABM71830.1"
FT                   /translation="MTAAKLNIDELEAGYPLFCKALRLLILKGNSIKEIERTVCWGHLE
FT                   TLNRCLPGRYKAPTYLMALIKRDINKPNNY"
FT   gene            complement(556560..556952)
FT                   /gene="tdcF"
FT                   /locus_tag="P9515_06221"
FT   CDS_pept        complement(556560..556952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdcF"
FT                   /locus_tag="P9515_06221"
FT                   /product="Putative translation initiation inhibitor, yjgF
FT                   family"
FT                   /note="COG251 Putative translation initiation inhibitor,
FT                   yjgF family [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71831"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVM0"
FT                   /protein_id="ABM71831.1"
FT                   /translation="MSSSKVIKTSNAPDPVGPYNQAIKAGNFIYCSGQIAIDPVSNEIN
FT                   CLGNIEKETTQVLKNLLAVLNSGGATAEDVIKTTIYLTDLKNFKTVNEIYSDFFKVKNP
FT                   PARACVEVSSLPKGVLIEIDCVAYLD"
FT   gene            complement(556977..557717)
FT                   /locus_tag="P9515_06231"
FT   CDS_pept        complement(556977..557717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06231"
FT                   /product="Putative hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="COG491 Zn-dependent hydrolases, including
FT                   glyoxylases [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71832"
FT                   /db_xref="GOA:A2BVM1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVM1"
FT                   /protein_id="ABM71832.1"
FT                   /translation="MEFNKEQTIIGIRVLSDNVIWLWRKNNSAVVIDPALSQPVIEYLK
FT                   THNLYLKAILQTHHHHDHIGGTRELIKEWPKVKVIASAKEKDRIPFQNLSVKDGDKLKL
FT                   LDEEVHVIEVIGHTRSHLAFYIHNKVPILFIGDTLFSAGCGRIFEGTYKQMYNSLKKIK
FT                   SLPKNTTIYCAHEYTKSNLLWALDLEPENENIKNKLIEVEKKIALKELTIPFLLEEELI
FT                   INLFLRADNLKRFSYLRANKDTWV"
FT   gene            557757..558395
FT                   /gene="hisG"
FT                   /locus_tag="P9515_06241"
FT   CDS_pept        557757..558395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="P9515_06241"
FT                   /product="possible ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="COG40 ATP phosphoribosyltransferase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71833"
FT                   /db_xref="GOA:A2BVM2"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVM2"
FT                   /protein_id="ABM71833.1"
FT                   /translation="MITIALPKGALLEDSISIFKKAGLNFSDALLENNRSLTIESECKR
FT                   AKALLVRNGDVPVYVSYGQADLGIVGYDVLQESELKVAKLLDLEFGGCHMSLAVKNTSN
FT                   YSKPTDLPANCKVASKFTKTARAYFDDLNIPVEIVHLTGSVELGPITGMAEAIVDLVAT
FT                   GKTLKENGLSKIDDLFYSTARLIANPLSIRLDSNPLRDVILSIESFKGT"
FT   gene            558409..560205
FT                   /locus_tag="P9515_06251"
FT   CDS_pept        558409..560205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06251"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71834"
FT                   /db_xref="GOA:A2BVM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVM3"
FT                   /protein_id="ABM71834.1"
FT                   /translation="MFLNDFNRIKKLGRYLTKDKKTIYLILIVLLPVSFAGAIQPLLVG
FT                   QAITILKNESTDVWLGKTFFGQSINLIIITLFITVLFRLVLQGYQSYNIQSVGQRLTAR
FT                   IRRELFEHSISLSLKYHDKMPVGKLLTRLTNDVDALAEVFGSGAVGVIADFVSLIVISL
FT                   TMLSIDKGLAMLLLLTQIPVSYFIIWLQKRYRKANYQVREELSQLNSDFQENLQGLEVV
FT                   QMFRRGFFNSRKFSNTGIAYQKAVNGTIFYDSSISAFIEWISLAAVSLVLAVGGYLVTS
FT                   GNIGLGTLTTFILYSQRLFEPLRQLAERFTQIQGGLTAVERINELLDEEIEIKDTFSSK
FT                   QISKGILNKNYKFKGKIEFRNVNFFYKEGEHVIKDLSFLVNPGEHVAFVGPTGSGKSTI
FT                   IRLLCRLYEPQDGEILIDDVNIKDIPIARLRNMLGVVLQDTFIFSGDVADNIKLNNEIN
FT                   NQDLENICKELGLDTLLKKLPNGLNTYLRERGGNLSSGERQLLSVARVAIRNPIILIMD
FT                   EATAFMDPSTEATLQKDLERILNKRTALVIAHRLATIEKSDKILVLKGGALVEEGNHRE
FT                   LRLKKGLYFQLSELQEKGFASF"
FT   gene            560205..560735
FT                   /locus_tag="P9515_06261"
FT   CDS_pept        560205..560735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06261"
FT                   /product="possible acetyltransferase"
FT                   /note="COG456 Acetyltransferases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71835"
FT                   /db_xref="GOA:A2BVM4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVM4"
FT                   /protein_id="ABM71835.1"
FT                   /translation="MIFRNKGSSIKKTNNLSQEELLKYYGLNSFEFTHKLKDEIFVCSK
FT                   NKEFDLIELDQLLQTVGWSRRPIRRVKRALEFSILVVGLWRHDEKFPRLVGFARCTGDG
FT                   VIEATIWDVAVNPVYQGLGLGKELMKYILKELKKTGISKVTLFADAEVVSFYKRQGWIL
FT                   EPKGSKCAFWYAN"
FT   gene            complement(560732..561421)
FT                   /locus_tag="P9515_06271"
FT   CDS_pept        complement(560732..561421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06271"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /note="COG463 Glycosyltransferases involved in cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71836"
FT                   /db_xref="GOA:A2BVM5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVM5"
FT                   /protein_id="ABM71836.1"
FT                   /translation="MPKISIIIPTYNESQHLSLLLSDLSIFNEGIEIIIVDCNSEDKTR
FT                   DIAKFYRTNIFKSKEKNRGLQLNLGAKKAKGEWFIFIHADSRLSKGWLKKVKSVIRNKE
FT                   NFIYFFKFKINNEKLIYRFLEIVVNLRSFFLKDPYGDQGLIIHRRTYFKNNGYRKIPLM
FT                   EDLDFIKRLKNNEHLKMLTIPIYTSSRKWEKTNIISQAFKNWNFRKRWLRGESIKSLYN
FT                   DYYKKLN"
FT   gene            complement(561427..562080)
FT                   /locus_tag="P9515_06281"
FT   CDS_pept        complement(561427..562080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06281"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3222 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71837"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVM6"
FT                   /protein_id="ABM71837.1"
FT                   /translation="MKTYGVLLDKALLIVMAKWHAYGRCKTRLSKDIGKFCSANVQRKM
FT                   TEHTVSVAKAIENKGLIDISLAISGLGFKKSKRWSNELGVRNFNLQGKGCLGEKMRRQI
FT                   LINKKFNLTKTRNIIFIGTDLPDFCHLDLLNALTKLKKNDLILGPSNDGGYWLIAFSER
FT                   LLSTDLYLPFINIKWSSEDVLKQTIDNFNQVAITHDFLHRKIDIDTIIDIKKRE"
FT   gene            562236..563627
FT                   /gene="dnaA"
FT                   /locus_tag="P9515_06291"
FT   CDS_pept        562236..563627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="P9515_06291"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COG593 ATPase involved in DNA replication initiation
FT                   [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71838"
FT                   /db_xref="GOA:A2BVM7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVM7"
FT                   /protein_id="ABM71838.1"
FT                   /translation="MQATNPIWAEVQQLLQKNLSKPSFETWIRPAKFNCFENGLLTLIT
FT                   PNNFTSDWLRKNYSETIEKAAEEICGHNVKVIFKSENNVNNNSNIPDTVSQQSIKSQTR
FT                   SISTSQGNNTNNRTKKSHSLNIRYVFKRFVVGPNSRMAHAAALAVAESPGREFNPLFIC
FT                   GGVGLGKTHLMQAIGHYRVEIDPEAKVLYVSTETFSSDLIQSIRKDGMHVFKNKYRSVD
FT                   LLLIDDIQFLEGKEYTQEEFFNTFNALYEAGKQIVIASDRPPSQIPKLQERLISRFSMG
FT                   LIADIQPPDIETRMAILQKKAEQERMNLPRDLVQFIAGRFSSNIRELEGAFTRAVAFAS
FT                   ITGLPMTVQSIAPMLDPNSVGVVVTPKQVIKKVSDFFSVTAEELVSSSRRKPVSQARQI
FT                   GMYLMRQGTNLSLPKIGDEFGGKDHTTVMYAIEQVEKKLSSDPNVASQVQKIKDLLQID
FT                   SRKNL"
FT   gene            complement(563622..564860)
FT                   /locus_tag="P9515_06301"
FT   CDS_pept        complement(563622..564860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06301"
FT                   /product="Glutathione S-transferase"
FT                   /note="COG625 Glutathione S-transferase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71839"
FT                   /db_xref="GOA:A2BVM8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVM8"
FT                   /protein_id="ABM71839.1"
FT                   /translation="MNKVLSWADLSKFEIDDIDRVNGINNSYSNLRLFGHSEKEVDLTL
FT                   FRDRHSWCPYCQKIWLWLEFKRIPYKVKKINMYCYGQKEKWYLNKVSSGKLPAIDLNGE
FT                   IITESDNIISLLENEYGTLGSSLLSNDIREARILEREIFRSWCNWLCRKSFSYLDESFS
FT                   KNKFKESIQKFEKILSSSKTGFIDSQINDSDKIEPGTGDIIFIPYIERMNASLSYYKGF
FT                   NLRNNYPHIDRWLSLLENLSPYRGTQGDFHTHSHDLPPQMGGCFKDVNDQQILLSNLID
FT                   VGEGLGKSEFNQAVDLDYYAKFALKRVLKHKDNIINANPYEKDLFDQSLRSALTYMITS
FT                   EINKVPDKAVMSINYLKNRISVPRDMPVISARLLRQSLNKIGSPNVNSKTDKIPVTHRY
FT                   DQDPSKFKLNQRS"
FT   gene            564913..566277
FT                   /gene="gor"
FT                   /locus_tag="P9515_06311"
FT   CDS_pept        564913..566277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="P9515_06311"
FT                   /product="probable glutathione reductase (NADPH)"
FT                   /EC_number="1.8.1.7"
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71840"
FT                   /db_xref="GOA:A2BVM9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVM9"
FT                   /protein_id="ABM71840.1"
FT                   /translation="MEFEFDLIVVGAGSGGLAAAKRAASYGAKVAIIEVNKIGGTCVLR
FT                   GCVPKKLMVYAANNRRNMVSAEGYGLINKEITFNSSVLLKNVREEVSRLSHIHSNSLKK
FT                   LNVTVFEGLGRFKNQNTVEVVCPKTRNILRKVSANKVLISVGGKPKKLEIPGVDLAWSS
FT                   DDIFELQDFPKTLLIVGGGYIACEFASIFKNLGTEVIQIIRGQNLLSGFDKDLSECLKK
FT                   SMTSLGIDLKFNNQLKSIKKIKGKLQSTLVSGSKFLTNNILIATGREPALKELHLDTLN
FT                   LKMDGIYLDVNEVNQTSNSNIFAIGDIIKRPNLTPVAIEQGRVFADNYFADRRRKVNYQ
FT                   NIPKAVFTIPEISTVGLSEEEATEIYSELNIKIFKCSFTPMSNTFKKNKSKCMLKLVVN
FT                   KKNDKILGCHMFGEAASEIIQMVSVSLNAGITKKDFDNTMALHPTISEEFVTMYG"
FT   gene            complement(566283..567362)
FT                   /gene="ecm27"
FT                   /locus_tag="P9515_06321"
FT   CDS_pept        complement(566283..567362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecm27"
FT                   /locus_tag="P9515_06321"
FT                   /product="putative CaCA family sodium/calcium exchanger"
FT                   /note="COG530 Ca2+/Na+ antiporter [Inorganic ion transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71841"
FT                   /db_xref="GOA:A2BVN0"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVN0"
FT                   /protein_id="ABM71841.1"
FT                   /translation="MSEFILPIMEILIGIILLFAGGELFIQGAISLSLILGIPQIVIGL
FT                   TVVSLGTSSPELLVSLNSIFKGSDSLAASNVIGSNIFNVLVVLGISSLITPLKVKSRIV
FT                   RRDVPLLIAISCAVWAMSSTGLLTWQAGIFLIFCLTLNTIWEINTIQENEEETKKAEPE
FT                   IEESQGRERSKFNIIFKLISGILLLSFGSNTLVNGSQSLATLLGVNEIIIGLTIVATGT
FT                   SLPELVTSIIAALKGKTDLAIGNVIGSNLLNQLLILGSCSIFSGLKGLTIDQSLIKVDL
FT                   PFMVLTTFACLPIFWTKGKISRIEGFILLNLYIFYIMDKLLFLKEFNNLYQLRVCIFIY
FT                   FSLFTVYLFTQEKLKTSRR"
FT   gene            567470..568519
FT                   /locus_tag="P9515_06331"
FT   CDS_pept        567470..568519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06331"
FT                   /product="Dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="COG418 Dihydroorotase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71842"
FT                   /db_xref="GOA:A2BVN1"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVN1"
FT                   /protein_id="ABM71842.1"
FT                   /translation="MKDLTILKPDDWHLHLREGIVLKNIIKFSSEFFGRAIVMPNTKNP
FT                   ITSINKCISYKKSISEGLPENSKFEPLMTIYLTDETIKDELIEGFKNDVFFAAKLYPAN
FT                   ATTNSSQGVKKIENLYEIFEVMEELGMPLLIHGEVTDPKVDIFDREVVFIDKELLPLIQ
FT                   RFPKLKIVLEHITTSYAVSFVQENNLGATITPHHLHINRNAMFFGGLNSDFYCLPVAKR
FT                   ENNRIALRKAATSGKKCFFLGTDSAPHLRQWKAFCGCAGIFNSPVAIESYIQVFDEEDS
FT                   LDQFEKFASLNGPNFYNLPVNKEKIRLVSKSNEIPKFIEVIDNNKVVGQIKPFHAGEIL
FT                   NWQVEGIVN"
FT   gene            complement(568863..569054)
FT                   /locus_tag="P9515_06341"
FT   CDS_pept        complement(568863..569054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06341"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71843"
FT                   /db_xref="GOA:A2BVN2"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVN2"
FT                   /protein_id="ABM71843.1"
FT                   /translation="MSSIIRAKKGSWFLGVCKGLEKSNRGNVFFWRLVFFISACFTFGI
FT                   PILIYLGLAVIFPIEKAE"
FT   gene            569251..569336
FT                   /locus_tag="P9515_tRNALeuVIMSS1309141"
FT                   /note="tRNA-Leu"
FT   tRNA            569251..569336
FT                   /locus_tag="P9515_tRNALeuVIMSS1309141"
FT                   /product="tRNA-Leu"
FT   gene            569412..569645
FT                   /gene="ndhL"
FT                   /locus_tag="P9515_06351"
FT   CDS_pept        569412..569645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhL"
FT                   /locus_tag="P9515_06351"
FT                   /product="NADH dehydrogenase subunit NdhL (ndhL)"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71844"
FT                   /db_xref="GOA:A2BVN3"
FT                   /db_xref="InterPro:IPR019654"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVN3"
FT                   /protein_id="ABM71844.1"
FT                   /translation="MESILNNSVITFVAYVGIISIYLFVIPLILFYWMNNRWNVMGKLE
FT                   RLGVYGLVFLFFPGLILFSPFLNLRLRGNNEG"
FT   gene            569650..569970
FT                   /locus_tag="P9515_06361"
FT   CDS_pept        569650..569970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71845"
FT                   /db_xref="GOA:A2BVN4"
FT                   /db_xref="InterPro:IPR021562"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVN4"
FT                   /protein_id="ABM71845.1"
FT                   /translation="MTKGKVVQIGLLISLLGILIFKLLPQFGIDNLTSSTISNFILILI
FT                   VITWVTSYILRVVNGKMTFMEQRKRYRKEYEKIVNDKLENKFNSLPKEEQEKLMEDLEK
FT                   NL"
FT   gene            570010..570849
FT                   /gene="trpA"
FT                   /locus_tag="P9515_06371"
FT   CDS_pept        570010..570849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="P9515_06371"
FT                   /product="Tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="COG159 Tryptophan synthase alpha chain [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71846"
FT                   /db_xref="GOA:A2BVN5"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVN5"
FT                   /protein_id="ABM71846.1"
FT                   /translation="MKENKKPQFTKNETLSKINEKFLELKKSKKLALMPFIMAGDPNIE
FT                   KTSEILLKLQEKGADLIELGIPYSDPLADGPIIQFSASRALKSGTTSIKVIQLLESLKD
FT                   KLRIPVILFTYFNPILNFGLENFCDLASKAGVAGLIIPDLPLEEASKFSEIISSYFIDL
FT                   ILLVAPTTPFERMKMISNKTKGFTYLVSVTGVTGERSKMGNRVESLITKLKEISINPVA
FT                   VGFGISAPEHVNRVSKWGADGVIIGSAFVKRISNSNEREVVNEVGNFCEEMRKAADQ"
FT   gene            complement(570956..571306)
FT                   /locus_tag="P9515_06381"
FT   CDS_pept        complement(570956..571306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06381"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71847"
FT                   /db_xref="GOA:A2BVN6"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVN6"
FT                   /protein_id="ABM71847.1"
FT                   /translation="MLTGSDLLAKVKELGDVSKSDLVRACGYVSTKKNGTERLNFTAFY
FT                   EALLEAKGINLGDAGVAGIGKGGRKLSYIATVQGNGNLLIGKAYTALLDLKAGDEFEIK
FT                   LGRKQIRLLPAD"
FT   gene            571406..571675
FT                   /locus_tag="P9515_06391"
FT   CDS_pept        571406..571675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06391"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG2350 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71848"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVN7"
FT                   /protein_id="ABM71848.1"
FT                   /translation="MEKFIVFGKYCEDAINKREPFRKQHLKRLGNLKDRNILVTLGPTK
FT                   CTKYLFGIFNANDKNELRELIEKDIYWQKGIWISIDIYPWIQAF"
FT   gene            complement(571888..572205)
FT                   /locus_tag="P9515_06401"
FT   CDS_pept        complement(571888..572205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71849"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVN8"
FT                   /protein_id="ABM71849.1"
FT                   /translation="MNKLSPQEEKELLDFIKVWLKSHGYTQKDLANELNLKSSRTSEIT
FT                   KKIKEFHKKGGVYHIAKNLIKIEQNWLNNIPTDSEKEKENHSYNQLDIDSLVNQIKKDS
FT                   L"
FT   gene            complement(572202..572576)
FT                   /locus_tag="P9515_06411"
FT   CDS_pept        complement(572202..572576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71850"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVN9"
FT                   /protein_id="ABM71850.1"
FT                   /translation="MNESNTKEKEKIYDAEVIESSSLDENIIIKILIKAGRTIAKPALE
FT                   VLEMALDPFTPTQVRVSLMAALAYLIMPFDLFPDFMPLVGFSDDFVALTAVLSIWSKYM
FT                   TPSIRIRAERKLNKLFPFLK"
FT   gene            complement(572604..573527)
FT                   /locus_tag="P9515_06421"
FT   CDS_pept        complement(572604..573527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06421"
FT                   /product="Putative type II alternative sigma factor,
FT                   sigma70 family"
FT                   /note="COG568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32) [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71851"
FT                   /db_xref="GOA:A2BVP0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVP0"
FT                   /protein_id="ABM71851.1"
FT                   /translation="MSSLSDFLGEIGRHQLLTPEKELTMGRKVQEMVVLINRCQTAGGK
FT                   GSACEYSEVEKKKIKIGEKAKNAMITANLRLVVNLAKRYQGKGLELLDLIQEGTLGLTR
FT                   AVEKYDPSRGHRFSTYAYWWIRQGLNRALSTQSRTIRIPVNINEKLTKLRAAKSKLMQL
FT                   KGFPPTSFELAEEMKITKEEIDELLSCELRSITVSLQGTVKSKSDPSELVDILPSDQTP
FT                   PMELAELAERTASAWTLLDKANLTEKERKIVSLRFGLDGSNEWKTLAEVARHMSCSREY
FT                   CRQVVQRALRKLRKAGIQNGLVDSVS"
FT   gene            complement(573676..574338)
FT                   /gene="hisI"
FT                   /locus_tag="P9515_06431"
FT   CDS_pept        complement(573676..574338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="P9515_06431"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /EC_number="3.6.1.31"
FT                   /note="COG139 Phosphoribosyl-AMP cyclohydrolase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71852"
FT                   /db_xref="GOA:A2BVP1"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVP1"
FT                   /protein_id="ABM71852.1"
FT                   /translation="MAYSTNFSIEDLHFDNNGLIPAIAQDWLDGSILMFAWMNKESLNK
FT                   TLQTKNVHYWSRSRSEIWRKGATSGSTQILKEIRFDCDNDALLLSIEQNGSGACHTGEK
FT                   SCFFNKIDNNFINKKEKRKKPLSNVCSELFNTLNERSINPSEKSYTNLLLTKGSNTILK
FT                   KIGEETAEFIMACKDNDKNSISNEAADIIYHLQVALLYKGVEWRDVLNILESRRKKR"
FT   gene            574401..574865
FT                   /locus_tag="P9515_06441"
FT   CDS_pept        574401..574865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06441"
FT                   /product="6-pyruvoyl-tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71853"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVP2"
FT                   /protein_id="ABM71853.1"
FT                   /translation="MNIHSSKFSCSKSYEDFPCSHRQWRHEGHCRFVHGYSRSFTFWFV
FT                   AKELDVNGFVVDFSGLKPLEIKLKEQFDHTFLVNKDDPLLNYWKKLHDLEALNLRIMDN
FT                   VGMEFSSKIVWQWANEFLKEKDKGRTCCWKAESKENKSNSANYEELPEWF"
FT   gene            complement(574894..577425)
FT                   /gene="clpB"
FT                   /locus_tag="P9515_06451"
FT   CDS_pept        complement(574894..577425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="P9515_06451"
FT                   /product="ATP-dependent Clp protease, Hsp 100, ATP-binding
FT                   subunit ClpB"
FT                   /EC_number="3.4.21.92"
FT                   /note="COG542 ATPases with chaperone activity, ATP-binding
FT                   subunit [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71854"
FT                   /db_xref="GOA:A2BVP3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVP3"
FT                   /protein_id="ABM71854.1"
FT                   /translation="MSKKIAANNFQQTVDSENLLLTIIKEDSLAKEILKKNEVDIEKIE
FT                   KDLISLLNSKAKMKNKQKILYIGESLNNIFLKSNDLRVSLNDVVISTEHLLYGLSYDEV
FT                   CGKLILNKKKIPDFLETIIEMKSNPKIQNNFESPNESLDKFGIDLTKSASEGNLDPVIG
FT                   RDEEIRRTIQILSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGDVPSSLHNRRLISLD
FT                   MGSLIAGAKYRGEFEERIKNVLKKVKSSAGKIILFIDEIHTVVGAGASGGSLDASNLLK
FT                   PMLARGELRCIGATTINEHKQNIEKDPALERRFQKIKINAPSVDDTVSILRGLKEKYEV
FT                   HHSVRISDNALVAAASLSERYINDRFLPDKAIDLIDEAASRLNMVITSKPEEIDEIDRK
FT                   VLQLEMENLSLKRESDNFSLERIKKINNELKDLKSKQSELNIKWRKEKEEIDEISNLKE
FT                   EIESTQLKIEQAKRSFDLNKAAELEFGTLISLQKKLKSKNEILVDSFKNGENNLLRQEV
FT                   TFDDIAEVVSKWTSIPVNNLNQSEKDKLLKLELTLKEKIIGQSNAIFAVANSIKRSRTG
FT                   LNDPNRPLASFLFLGPTGVGKTELSKVTAETIFDSSDSITRLDMSEYMEKHSVSKIIGA
FT                   PPGYLGFESGGQLTEAVRKNPYSLILLDEIEKAHKDILDILLQVLDDGIITDGQGRTIS
FT                   FKNSIIVLTSNLGSQSINDLSIRNEDKNEIKTIVDLELKKFFKPEFLNRLDEIVIFQNL
FT                   EINELKEIANIQLKNLENRLIKKDLKLKISDEAVEYLVKNSFDNNYGARPLKRIIQNQI
FT                   TTNIANNILNNIYLNKKEVDIFIKNGKLFVE"
FT   gene            complement(577555..577905)
FT                   /gene="petE"
FT                   /locus_tag="P9515_06461"
FT   CDS_pept        complement(577555..577905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petE"
FT                   /locus_tag="P9515_06461"
FT                   /product="plastocyanin"
FT                   /note="COG3794 Plastocyanin [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71855"
FT                   /db_xref="GOA:A2BVP4"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR001235"
FT                   /db_xref="InterPro:IPR002387"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVP4"
FT                   /protein_id="ABM71855.1"
FT                   /translation="MLRSFFTGLFAIVLTLGLGISSVSAKTVEVKLGTDAGMLAFEPSS
FT                   VTISPGDTVKFINNKLAPHNAVFDGHEELSHADLAFAPGESWEETFDTAGTYDYYCEPH
FT                   IGAGMVGKVIVE"
FT   gene            complement(577964..578848)
FT                   /locus_tag="P9515_06471"
FT   CDS_pept        complement(577964..578848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06471"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71856"
FT                   /db_xref="GOA:A2BVP5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVP5"
FT                   /protein_id="ABM71856.1"
FT                   /translation="MVRNKNKLSLSIQKNKRIKLLICDIRECNKFSKEISQINFLIHTA
FT                   TAWGDPKRAYEVNIKAFEELLGMLEKNKLEKIIYFSTASILNQETELMRESLTYGTEYI
FT                   QTKYECFQRLRESSFAEKTFAVFPTLVFGGTLNKRSKYPTSYLTSGLLEINKWLWLARF
FT                   LKLNSKFHFIHANDIAQICGFLIKNHKEDAYKGFKKFVLGQNYISIDDAINILLKRNRM
FT                   NRYFSITLTKKIMKILLRILPIQATPWDSFSIKKYDFNHHPVTNPETFKLKSHAKSLND
FT                   ILRLAKLPSCNIN"
FT   gene            complement(578956..579996)
FT                   /gene="hemE"
FT                   /locus_tag="P9515_06481"
FT   CDS_pept        complement(578956..579996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="P9515_06481"
FT                   /product="Uroporphyrinogen decarboxylase (URO-D)"
FT                   /EC_number="4.1.1.37"
FT                   /note="COG407 Uroporphyrinogen-III decarboxylase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71857"
FT                   /db_xref="GOA:A2BVP6"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVP6"
FT                   /protein_id="ABM71857.1"
FT                   /translation="MGENLPLLLSAALGKKVNRPPVWMMRQAGRYMKIYRDLRERYPSF
FT                   RERSENPELSYQISMQPFKAFKPDGVILFSDILTPLPGMGINFEIIESKGPIIENPIKN
FT                   IHQIENLKELVPSESLSFVGEVLSSLKKDVNNEATVLGFVGAPWTLAAYVVEGKSSKNY
FT                   SLIKSMAFKEPDLLHKLLDHFAKSIGEYLKYQIKSGAQVVQIFDSWAGQLSPQDYDIFA
FT                   GPYQKKVVDIVKEKYPETPIILYISGSAGLLERMARTGVDIISLDWTVDIEEACKRIPE
FT                   GIGIQGNVDPGLLFGNKESIKERIDITFNKSKGRKYILNLGHGILPGTPEENAQTFFEH
FT                   GKKLTY"
FT   gene            complement(580124..582388)
FT                   /gene="glgB"
FT                   /locus_tag="P9515_06491"
FT   CDS_pept        complement(580124..582388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="P9515_06491"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="COG296 1,4-alpha-glucan branching enzyme
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71858"
FT                   /db_xref="GOA:A2BVP7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BVP7"
FT                   /protein_id="ABM71858.1"
FT                   /translation="MKETIQTDWIKSEAFNLENCCNDNPLNILGPHFFKGKWVTRVWMP
FT                   EADEVNITFKDKTYKTTTPNHKWMFEAILHEDPKNNYQINVLRGGVSHSQQDPWAFKDE
FT                   WMGEVDRHLFAEGNHHHIWKKMGAHISEDINQKGVMFCIWAPNAKSISIIGDINSWDGR
FT                   HHPMQKRLGGVWELFMPILKEGDVYKYEIRTQQGHIYEKADPYGFLHEVRPQNGSIISK
FT                   LNNFNWEDSSWITSRDSSSQINKPISVYEMHLGSWMHDSTDNKYIEKNGNPRHPVPAAD
FT                   LKPGTRFLTYPELTEKLIPYVKERGFTHIELMPISEHPFDGSWGYQVTGWYAPTSRYGT
FT                   PNEFKEFINKCHAEGIGVILDWVPGHFPKDKHGLAFFDGCHLYEHGDPRIGEHKEWGTL
FT                   IFNYSRNEVRNFLVANLIYWFEEFHIDGIRVDAVASMLYRDYLRPEGEWIPNENGGNEN
FT                   LEAVKFLQQANHVLFQHFPGALSIAEESTTWPMVTEPTNVGGLGFNLKWNMGWMHDMLD
FT                   YFEIDPWFRQFHQNSVTFSITYNYTENFMLALSHDEVVHGKSHLLHKMPGDDWKKFANT
FT                   RALLTYMWTHPGKKTIFMGMEFGQRQEWNVWDDLQWELLEYEPHKGIRNLIDDLNKLYK
FT                   NEPSLWKNDFDPYGFQWIDCDDTSNSVISFMRRENESNEWLVVIANFTPNFHESYKIGV
FT                   PLEGYYKEIFNSDGSKYGGSNKGNMGGKDTLKYNIHNYENALEIALPPLSVSIFKHQLK
FT                   K"
FT   gene            complement(582440..584017)
FT                   /locus_tag="P9515_06501"
FT   CDS_pept        complement(582440..584017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06501"
FT                   /product="Predicted acyl esterase"
FT                   /note="COG2936 Predicted acyl esterases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71859"
FT                   /db_xref="GOA:A2BVP8"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVP8"
FT                   /protein_id="ABM71859.1"
FT                   /translation="MREVNWVDKSLRLNDGIELASRIWTPKGNGSWPALLMRQPYGREI
FT                   ASTITYSHPEWWASKGYMVVIQDVRGQGSSSGIFKGFSQEPKDTSETHQWVRSLKECNG
FT                   KLGLYGFSYQGLTQLTGTKDSKPPDCLSPAMTGIDLKNHWSSDGGAFWWNNNIAWGLQI
FT                   AALKMKRENNSLGWEEIISALENKSYLRKGLALLKKYDPNNFVLEWHKNINHDNDFLEI
FT                   KLISSWLKKPMLIIGGLWDPHLRGAFDLYQKSKAAGGNPDIIIGDATHLNWWEGSQKTL
FT                   LNFFDTHLKSDKEVKEKNFSKHKKIWNLSLKKWEPIEEGKVQKYKFGLESNGTANTEVT
FT                   DGSLLLNSKGSGWFSIVNDPWRPSQGEGGHLGPTPGMFDRYIFDTRLDVGVFQTNSLQK
FT                   DLQISGIPTLETSVKCDQKSFDICLALSMVNEKEKTVNQFSTGFLRVKNSKKNEKCECK
FT                   IEMHPTNILLLKGSKLRLSISAAAYPAIGINSGSSDNNNGAPTINHKIITLSFELSKTF
FT                   MKMNPFFN"
FT   gene            complement(584026..584292)
FT                   /locus_tag="P9515_06511"
FT   CDS_pept        complement(584026..584292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9515_06511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9515_06511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM71860"
FT                   /db_xref="UniProtKB/TrEMBL:A2BVP9"
FT                   /protein_id="ABM71860.1"
FT                   /translation="MNNFLLLVFLSLSYINPILSQSNLLESVKK