(data stored in SCRATCH zone)

EMBL: CP000553

ID   CP000553; SV 1; circular; genomic DNA; STD; PRO; 1864731 BP.
XX
AC   CP000553;
XX
PR   Project:PRJNA15660;
XX
DT   24-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Prochlorococcus marinus str. NATL1A, complete genome.
XX
KW   .
XX
OS   Prochlorococcus marinus str. NATL1A
OC   Bacteria; Cyanobacteria; Synechococcales; Prochloraceae; Prochlorococcus.
XX
RN   [1]
RP   1-1864731
RA   Chisholm S., Huang K., Martiny A., Kettler G., Coleman M., Keller K.,
RA   Arkin A., Coe A., Rodrigue S., Ferriera S., Johnson J., Kravitz S.,
RA   Beeson K., Sutton G., Rogers Y.-H., Friedman R., Frazier M., Venter J.C.;
RT   ;
RL   Submitted (06-NOV-2006) to the INSDC.
RL   J Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; ffc408ea87829f88a82400fa9b7f4fe8.
DR   BioSample; SAMN02603287.
DR   EnsemblGenomes-Gn; EBG00001460966.
DR   EnsemblGenomes-Gn; EBG00001460967.
DR   EnsemblGenomes-Gn; EBG00001460968.
DR   EnsemblGenomes-Gn; EBG00001460969.
DR   EnsemblGenomes-Gn; EBG00001460970.
DR   EnsemblGenomes-Gn; EBG00001460971.
DR   EnsemblGenomes-Gn; EBG00001460972.
DR   EnsemblGenomes-Gn; EBG00001460973.
DR   EnsemblGenomes-Gn; EBG00001460974.
DR   EnsemblGenomes-Gn; EBG00001460975.
DR   EnsemblGenomes-Gn; EBG00001460976.
DR   EnsemblGenomes-Gn; EBG00001460977.
DR   EnsemblGenomes-Gn; EBG00001460978.
DR   EnsemblGenomes-Gn; EBG00001460979.
DR   EnsemblGenomes-Gn; EBG00001460980.
DR   EnsemblGenomes-Gn; EBG00001460981.
DR   EnsemblGenomes-Gn; EBG00001460982.
DR   EnsemblGenomes-Gn; EBG00001460983.
DR   EnsemblGenomes-Gn; EBG00001460984.
DR   EnsemblGenomes-Gn; EBG00001460985.
DR   EnsemblGenomes-Gn; EBG00001460986.
DR   EnsemblGenomes-Gn; EBG00001460987.
DR   EnsemblGenomes-Gn; EBG00001460988.
DR   EnsemblGenomes-Gn; EBG00001460989.
DR   EnsemblGenomes-Gn; EBG00001460990.
DR   EnsemblGenomes-Gn; EBG00001460991.
DR   EnsemblGenomes-Gn; EBG00001460992.
DR   EnsemblGenomes-Gn; EBG00001460993.
DR   EnsemblGenomes-Gn; EBG00001460994.
DR   EnsemblGenomes-Gn; EBG00001460995.
DR   EnsemblGenomes-Gn; EBG00001460996.
DR   EnsemblGenomes-Gn; EBG00001460997.
DR   EnsemblGenomes-Gn; EBG00001460998.
DR   EnsemblGenomes-Gn; EBG00001460999.
DR   EnsemblGenomes-Gn; EBG00001461000.
DR   EnsemblGenomes-Gn; EBG00001461001.
DR   EnsemblGenomes-Gn; EBG00001461002.
DR   EnsemblGenomes-Gn; EBG00001461003.
DR   EnsemblGenomes-Gn; EBG00001461004.
DR   EnsemblGenomes-Gn; EBG00001461005.
DR   EnsemblGenomes-Gn; EBG00001461006.
DR   EnsemblGenomes-Gn; EBG00001461007.
DR   EnsemblGenomes-Gn; EBG00001461008.
DR   EnsemblGenomes-Gn; EBG00001461009.
DR   EnsemblGenomes-Gn; EBG00001461010.
DR   EnsemblGenomes-Gn; EBG00001461011.
DR   EnsemblGenomes-Gn; EBG00001461012.
DR   EnsemblGenomes-Gn; EBG00001461013.
DR   EnsemblGenomes-Gn; EBG00001461014.
DR   EnsemblGenomes-Gn; EBG00001461015.
DR   EnsemblGenomes-Gn; EBG00001461016.
DR   EnsemblGenomes-Gn; EBG00001461017.
DR   EnsemblGenomes-Gn; EBG00001461018.
DR   EnsemblGenomes-Gn; EBG00001461019.
DR   EnsemblGenomes-Gn; EBG00001461020.
DR   EnsemblGenomes-Gn; NATL1_rrfVIMSS1309405.
DR   EnsemblGenomes-Gn; NATL1_rrlVIMSS1365723.
DR   EnsemblGenomes-Gn; NATL1_rrsVIMSS1309404.
DR   EnsemblGenomes-Gn; NATL1_tRNAAlaVIMSS1309191.
DR   EnsemblGenomes-Gn; NATL1_tRNAAlaVIMSS1309204.
DR   EnsemblGenomes-Gn; NATL1_tRNAArgVIMSS1309183.
DR   EnsemblGenomes-Gn; NATL1_tRNAArgVIMSS1309188.
DR   EnsemblGenomes-Gn; NATL1_tRNAArgVIMSS1309209.
DR   EnsemblGenomes-Gn; NATL1_tRNAArgVIMSS1309215.
DR   EnsemblGenomes-Gn; NATL1_tRNAAsnVIMSS1309217.
DR   EnsemblGenomes-Gn; NATL1_tRNAAspVIMSS1309200.
DR   EnsemblGenomes-Gn; NATL1_tRNACysVIMSS1309216.
DR   EnsemblGenomes-Gn; NATL1_tRNAGlnVIMSS1309214.
DR   EnsemblGenomes-Gn; NATL1_tRNAGluVIMSS1309208.
DR   EnsemblGenomes-Gn; NATL1_tRNAGlyVIMSS1309187.
DR   EnsemblGenomes-Gn; NATL1_tRNAGlyVIMSS1309190.
DR   EnsemblGenomes-Gn; NATL1_tRNAGlyVIMSS1309207.
DR   EnsemblGenomes-Gn; NATL1_tRNAHisVIMSS1309211.
DR   EnsemblGenomes-Gn; NATL1_tRNAIleVIMSS1309203.
DR   EnsemblGenomes-Gn; NATL1_tRNALeuVIMSS1309184.
DR   EnsemblGenomes-Gn; NATL1_tRNALeuVIMSS1309185.
DR   EnsemblGenomes-Gn; NATL1_tRNALeuVIMSS1309198.
DR   EnsemblGenomes-Gn; NATL1_tRNALeuVIMSS1309210.
DR   EnsemblGenomes-Gn; NATL1_tRNALysVIMSS1309193.
DR   EnsemblGenomes-Gn; NATL1_tRNAMetVIMSS1309182.
DR   EnsemblGenomes-Gn; NATL1_tRNAMetVIMSS1309196.
DR   EnsemblGenomes-Gn; NATL1_tRNAMetVIMSS1309206.
DR   EnsemblGenomes-Gn; NATL1_tRNAPheVIMSS1309181.
DR   EnsemblGenomes-Gn; NATL1_tRNAProVIMSS1309194.
DR   EnsemblGenomes-Gn; NATL1_tRNAProVIMSS1309195.
DR   EnsemblGenomes-Gn; NATL1_tRNASerVIMSS1309189.
DR   EnsemblGenomes-Gn; NATL1_tRNASerVIMSS1309192.
DR   EnsemblGenomes-Gn; NATL1_tRNASerVIMSS1309197.
DR   EnsemblGenomes-Gn; NATL1_tRNASerVIMSS1309205.
DR   EnsemblGenomes-Gn; NATL1_tRNAThrVIMSS1309180.
DR   EnsemblGenomes-Gn; NATL1_tRNAThrVIMSS1309202.
DR   EnsemblGenomes-Gn; NATL1_tRNAThrVIMSS1309213.
DR   EnsemblGenomes-Gn; NATL1_tRNATrpVIMSS1309199.
DR   EnsemblGenomes-Gn; NATL1_tRNATyrVIMSS1309201.
DR   EnsemblGenomes-Gn; NATL1_tRNAValVIMSS1309186.
DR   EnsemblGenomes-Gn; NATL1_tRNAValVIMSS1309212.
DR   EnsemblGenomes-Tr; EBT00001614763.
DR   EnsemblGenomes-Tr; EBT00001614764.
DR   EnsemblGenomes-Tr; EBT00001614765.
DR   EnsemblGenomes-Tr; EBT00001614766.
DR   EnsemblGenomes-Tr; EBT00001614767.
DR   EnsemblGenomes-Tr; EBT00001614768.
DR   EnsemblGenomes-Tr; EBT00001614769.
DR   EnsemblGenomes-Tr; EBT00001614770.
DR   EnsemblGenomes-Tr; EBT00001614771.
DR   EnsemblGenomes-Tr; EBT00001614772.
DR   EnsemblGenomes-Tr; EBT00001614773.
DR   EnsemblGenomes-Tr; EBT00001614774.
DR   EnsemblGenomes-Tr; EBT00001614775.
DR   EnsemblGenomes-Tr; EBT00001614776.
DR   EnsemblGenomes-Tr; EBT00001614777.
DR   EnsemblGenomes-Tr; EBT00001614778.
DR   EnsemblGenomes-Tr; EBT00001614779.
DR   EnsemblGenomes-Tr; EBT00001614780.
DR   EnsemblGenomes-Tr; EBT00001614781.
DR   EnsemblGenomes-Tr; EBT00001614782.
DR   EnsemblGenomes-Tr; EBT00001614783.
DR   EnsemblGenomes-Tr; EBT00001614784.
DR   EnsemblGenomes-Tr; EBT00001614785.
DR   EnsemblGenomes-Tr; EBT00001614786.
DR   EnsemblGenomes-Tr; EBT00001614787.
DR   EnsemblGenomes-Tr; EBT00001614788.
DR   EnsemblGenomes-Tr; EBT00001614789.
DR   EnsemblGenomes-Tr; EBT00001614790.
DR   EnsemblGenomes-Tr; EBT00001614791.
DR   EnsemblGenomes-Tr; EBT00001614792.
DR   EnsemblGenomes-Tr; EBT00001614793.
DR   EnsemblGenomes-Tr; EBT00001614794.
DR   EnsemblGenomes-Tr; EBT00001614795.
DR   EnsemblGenomes-Tr; EBT00001614796.
DR   EnsemblGenomes-Tr; EBT00001614797.
DR   EnsemblGenomes-Tr; EBT00001614798.
DR   EnsemblGenomes-Tr; EBT00001614799.
DR   EnsemblGenomes-Tr; EBT00001614800.
DR   EnsemblGenomes-Tr; EBT00001614801.
DR   EnsemblGenomes-Tr; EBT00001614802.
DR   EnsemblGenomes-Tr; EBT00001614803.
DR   EnsemblGenomes-Tr; EBT00001614804.
DR   EnsemblGenomes-Tr; EBT00001614805.
DR   EnsemblGenomes-Tr; EBT00001614806.
DR   EnsemblGenomes-Tr; EBT00001614807.
DR   EnsemblGenomes-Tr; EBT00001614808.
DR   EnsemblGenomes-Tr; EBT00001614809.
DR   EnsemblGenomes-Tr; EBT00001614810.
DR   EnsemblGenomes-Tr; EBT00001614811.
DR   EnsemblGenomes-Tr; EBT00001614812.
DR   EnsemblGenomes-Tr; EBT00001614813.
DR   EnsemblGenomes-Tr; EBT00001614814.
DR   EnsemblGenomes-Tr; EBT00001614815.
DR   EnsemblGenomes-Tr; EBT00001614816.
DR   EnsemblGenomes-Tr; EBT00001614817.
DR   EnsemblGenomes-Tr; NATL1_rrfVIMSS1309405-1.
DR   EnsemblGenomes-Tr; NATL1_rrlVIMSS1365723-1.
DR   EnsemblGenomes-Tr; NATL1_rrsVIMSS1309404-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAAlaVIMSS1309191-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAAlaVIMSS1309204-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAArgVIMSS1309183-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAArgVIMSS1309188-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAArgVIMSS1309209-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAArgVIMSS1309215-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAAsnVIMSS1309217-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAAspVIMSS1309200-1.
DR   EnsemblGenomes-Tr; NATL1_tRNACysVIMSS1309216-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAGlnVIMSS1309214-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAGluVIMSS1309208-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAGlyVIMSS1309187-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAGlyVIMSS1309190-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAGlyVIMSS1309207-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAHisVIMSS1309211-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAIleVIMSS1309203-1.
DR   EnsemblGenomes-Tr; NATL1_tRNALeuVIMSS1309184-1.
DR   EnsemblGenomes-Tr; NATL1_tRNALeuVIMSS1309185-1.
DR   EnsemblGenomes-Tr; NATL1_tRNALeuVIMSS1309198-1.
DR   EnsemblGenomes-Tr; NATL1_tRNALeuVIMSS1309210-1.
DR   EnsemblGenomes-Tr; NATL1_tRNALysVIMSS1309193-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAMetVIMSS1309182-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAMetVIMSS1309196-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAMetVIMSS1309206-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAPheVIMSS1309181-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAProVIMSS1309194-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAProVIMSS1309195-1.
DR   EnsemblGenomes-Tr; NATL1_tRNASerVIMSS1309189-1.
DR   EnsemblGenomes-Tr; NATL1_tRNASerVIMSS1309192-1.
DR   EnsemblGenomes-Tr; NATL1_tRNASerVIMSS1309197-1.
DR   EnsemblGenomes-Tr; NATL1_tRNASerVIMSS1309205-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAThrVIMSS1309180-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAThrVIMSS1309202-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAThrVIMSS1309213-1.
DR   EnsemblGenomes-Tr; NATL1_tRNATrpVIMSS1309199-1.
DR   EnsemblGenomes-Tr; NATL1_tRNATyrVIMSS1309201-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAValVIMSS1309186-1.
DR   EnsemblGenomes-Tr; NATL1_tRNAValVIMSS1309212-1.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC2518516; 18769676.
DR   EuropePMC; PMC3390001; 22768379.
DR   EuropePMC; PMC6102989; 29915114.
DR   EuropePMC; PMC6617141; 31216720.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01067; ATPC.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01704; Downstream-peptide.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02064; STnc370.
DR   SILVA-LSU; CP000553.
DR   SILVA-SSU; CP000553.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1864731
FT                   /organism="Prochlorococcus marinus str. NATL1A"
FT                   /strain="NATL1A"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:167555"
FT   gene            188..1348
FT                   /gene="dnaN"
FT                   /locus_tag="NATL1_00001"
FT   CDS_pept        188..1348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="NATL1_00001"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG592 DNA polymerase sliding clamp subunit (PCNA
FT                   homolog) [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74564"
FT                   /db_xref="GOA:A2BZA4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZA4"
FT                   /protein_id="ABM74564.1"
FT                   /translation="MKLNCSQSELNNALQLVSRAVSNRPTHPVLANVLLAADEVTGKLR
FT                   LTGFDLSLGIQTSISASIESSGAITLPAKLFGEIVSKLSNDSPLVLTSDETSQQVELTS
FT                   KSGTYQVRGMVSDDFPDLPLVESGNSFKLNPLLLSNAIKSTLFASSTDEAKQLLTGVNL
FT                   TFDGYGIESAATDGHRLAVLNLNNILSDSKEIDSSTKFEKFSITLPSKSLREVEKFLST
FT                   CDISQPINFFVDKGQVVFISVEDIITIRALEGSYPNYSQLLPDTFENELEFDRKEFISS
FT                   LERIAVLADQHNNVIKVTTDGSANLIKISTDAQDIGTGYESLPVSYKGDSFQIAFNVRY
FT                   LLDGLKVIDSNLIKLSCNSPTTPAVFSPINSDVNFTYLVMPIQIRN"
FT   gene            1351..2121
FT                   /locus_tag="NATL1_00011"
FT   CDS_pept        1351..2121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74565"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZA5"
FT                   /protein_id="ABM74565.1"
FT                   /translation="MAVPKKLLLSDLLKHNVRCDSGMDHGPVITPWMHPPVHRILGFIT
FT                   RPSNLRLEREVWRLDQLKGINQQEVYVKGPCSVSDQQTLDRFPTLLNANVFNKSGQKIG
FT                   LIADFLFEPKKGNIQYYLVSRSNPFIPGTSRWLLSIAQIIDKQPGSISCDIETFEDLPI
FT                   QKASLKEEFLSKSRKWTAQFQDLTYSASDKLEGWIDEQISESDNDSYESLNDDSSYDDW
FT                   IDNLDIDSSEEFNRMNESKKNTNSSNERDLDPWI"
FT   gene            2124..4535
FT                   /locus_tag="NATL1_00021"
FT   CDS_pept        2124..4535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00021"
FT                   /product="phosphoribosylformylglycinamidine synthetase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="COG46 Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, synthetase domain [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74566"
FT                   /db_xref="GOA:A2BZA6"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZA6"
FT                   /protein_id="ABM74566.1"
FT                   /translation="MTVSFENKDFNQFINSSKFLVEYDVMSALKQEGLKQSDYVEICRR
FT                   LNRGPNRNELGMFGVMWSEHCCYRNSRPLLKNLPTTGSRILVGPGENAGVVDIGFGQRL
FT                   VFKIESHNHPSAVEPFQGAATGVGGILRDIFTMGARPIALLNALRFGPLDDEKNISLLE
FT                   GVVAGISHYGNCVGVPTIGGEVGFDSSYSGNPLVNVMGLGLMETEEIVCSGASGIDFPV
FT                   LYVGNTTGRDGMGGASFASSELSKTSIDDRPAVQVGDPFLEKGLIEACLEAFKTGYVIA
FT                   AQDMGAAGLTCSCSEMASKGEVGIELNLDLVPAREKGMTAYEFLLSESQERMLFVVKPG
FT                   SEEELRELFIRWGLYVEVVGKVLKEKVVRVIHKGEVVANLPASALADDTPIEEHLLINS
FT                   TPEYLQEHWKWTEDLLPKTLDNGIINIKNNLFISWNNVLLDLLSMPSIASKNWIYKQYD
FT                   YQVQSNTVVSPGEADAAVIRIRSQNDFLTKPKKDRGIASVVDCNDRWVYLDPLRGSMSA
FT                   VAEAARNLSSVGAEPIAITNNLNFSSPDKPVGFWQLSMSCEGITKACLALSTPVTGGNV
FT                   SLYNDTKLQNNTVLPIHPTPVIGMVGLIEDINKICKKSWVKAEDQIWMIGLPLENNINQ
FT                   DERISLSASSFLEYIHGLKTGRPPEIDLNLEKQVHAFLREVIKQGIVNSAHDLGDGGLA
FT                   VAIAECCISSGYGANIILPPSQSRLDRLLFAEGGARVLVSCSTDQSEELKKYYKNISLQ
FT                   GSNLFSISHLGNVNNQKKLLVSQSNNTIIDVNILDLKDTYKDAIHKKITK"
FT   gene            4597..6054
FT                   /gene="purF"
FT                   /locus_tag="NATL1_00031"
FT   CDS_pept        4597..6054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="NATL1_00031"
FT                   /product="Glutamine amidotransferase
FT                   class-II:Phosphoribosyl transferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="COG34 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74567"
FT                   /db_xref="GOA:A2BZA7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZA7"
FT                   /protein_id="ABM74567.1"
FT                   /translation="MCGIVGVVSTDQCNQQIYDSLLLLQHRGQDSTGIATMDGSVFHIN
FT                   KSKGQVREAYRTRDMRALIGRSGLGHVRYATKGAAHREEEAQPFYVNAPYGIILVHNGN
FT                   LTNTRELEKELFKVDKRHTNTSSDTEMLLNVLATELNSEVKGKDVDPEDLFNAVKRLHC
FT                   RVEGSYASIALIAGHGLLAFRDPFGIRPLVIGKRVKENNKPEWVIASESLVIENNDYVI
FT                   VRDVEPGEAIFITSNGEFFSKQCSDNPQLFPCSFEYVYLARPDSIMNGISVYESRLRMG
FT                   DLLAETIKKQISLGDIDVVMPIPDSSRPAAMQVARQLGIEYREGFFKNRYVGRTFIMPG
FT                   QSLRKRSVRQKLNAMSTEFKNKNVLIVDDSVVRGTTSQQIVQMARSAGANKVTFTSAAP
FT                   PIRYPHVYGINMPSRNELIAYNRDINQIENNLFIDKMIYQEVNDLTQAITQNSKIKELD
FT                   LSCFTGKYITGTVTDEYLTWVEETSLS"
FT   gene            complement(6051..8534)
FT                   /locus_tag="NATL1_00041"
FT   CDS_pept        complement(6051..8534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00041"
FT                   /product="DNA gyrase/topoisomerase IV, subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="COG188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74568"
FT                   /db_xref="GOA:A2BZA8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZA8"
FT                   /protein_id="ABM74568.1"
FT                   /translation="MAKERLKPISLHQEMQRSYLEYAMSVIVGRALPDARDGLKPVQRR
FT                   ILFAMHELGLTPERPYRKCARVVGDVLGKYHPHGDQAVYDALVRQVQIFNSRYPILDGH
FT                   GNFGSIDDDPPAAMRYTETRLAPISNDAILSEIDKETVDFSPNFDGSQQEPDVLPAQLP
FT                   FLILNGSTGIAVGMATSIPPHNLNEVVEALIAIIKKPSLNEEKLLEIIPGPDFPTGGEI
FT                   LVSNGIKETYTKGRGSITMRGIARIEEINPGKGKHKRSGIIISELPYQLNKAGWIEKLA
FT                   DLVNNGKISGIADIRDESDRDGMRILVEVKRDSDPKKILDFLYQKTSLQSNFGAILLAL
FT                   VNGQPVQLTLRKLLNNFLEFRENTILLRSNYLLKNIKNREEIVEALIQATNNVRKVIEL
FT                   IENSKDTPEAKSNLIISLKINERQADGILGMPLKKITGLEKDSLKNELKDLKTKRAELE
FT                   LIINDKENLMKVMVKELKDLKKRFGSKRRTKLIEGGDALIAEKMANQRPNKELQRINAL
FT                   KELSKDSEIIIQSNNEIKIIPSLTIKKLKLKESDQERKDILPAKLIWPIKNEPKILAVS
FT                   QEGKIGLLKWEFAGQKPGPLKQFLPAGLENDKIINLIPLTEIRDISIGLISTDGKFKRI
FT                   SINEISDISNRSTTILKLKDSIKLKSCILCKENSYLYIVSDIGRIIKIKITENDFPFMG
FT                   KLAQGTNIIKLFPNENIVEALSFQEKKNKDLILITNKGSFVKHSTKEITISKKGALGIM
FT                   GIHFKDNKTIKERVIDCFINNKHVFIKTDKDRYQRLKTDQIDNSSYRKENKLNIELNND
FT                   EFLKSTFSMKVPDKN"
FT   gene            complement(8656..9486)
FT                   /locus_tag="NATL1_00051"
FT   CDS_pept        complement(8656..9486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00051"
FT                   /product="Flp pilus assembly protein TadD, contains TPR
FT                   repeats"
FT                   /note="COG5010 Flp pilus assembly protein TadD, contains
FT                   TPR repeats [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74569"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZA9"
FT                   /protein_id="ABM74569.1"
FT                   /translation="MMKKVSKIFKYLLGLSLINNFFIPNSSVAFFPRINEPNQQEFEST
FT                   SKQIGKTAKQLIQFGEYKEAIKILKLALKLNPTEETLWTTLADAQFKSKDSNNALLSLD
FT                   KVLVINPKNASIYFAKGSIYMNLKNLENAILMLNQGLLLDNKNESGYFQLGNAYIMLKE
FT                   YKKALHTYNKVTKLNPNFWQVINNQGLILYEINKKDEALSKFKLAAKLSNNAEPRLALA
FT                   IASYSIKGISIETLNIAKNALIDNPKYADIEYQSEQLWGKKLQHSAKLFLKRKK"
FT   gene            complement(9489..10427)
FT                   /locus_tag="NATL1_00061"
FT   CDS_pept        complement(9489..10427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00061"
FT                   /product="Uncharacterized Fe-S protein"
FT                   /note="COG1600 Uncharacterized Fe-S protein [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74570"
FT                   /db_xref="GOA:A2BZB0"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZB0"
FT                   /protein_id="ABM74570.1"
FT                   /translation="MKNSIDLTKKIKEKAFEEGFDAVGIAKVPGSSRIKLRTASLERWL
FT                   QAGHQAKMEWMKSPRRKDIESMLQGVKSVLAVGLNYYVDTEREPKDISIARYGWGKDYH
FT                   KIIEEKLKKIANFLETERPNAKWKICVDTSAFLDKAWAEEAGIGWIGKHSNVINSEIGS
FT                   WMFLGHLLSTEALEADKPSKPICGECEKCIEACPTKAIEEPFIINSYKCLAYHTLENRD
FT                   QELPKNIINKMGNWIAGCDICQDVCPWNQKHIPSTTEPDLQPSEWMLHTTKQDLLSWSD
FT                   SKWKESLKNSALKRIKPWMWRRNIDSISKKK"
FT   gene            10620..11342
FT                   /locus_tag="NATL1_00071"
FT   CDS_pept        10620..11342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00071"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG2928 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74571"
FT                   /db_xref="GOA:A2BZB1"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZB1"
FT                   /protein_id="ABM74571.1"
FT                   /translation="MQSSPKEDLTLGSRLQQDLKNDLIAGLLVVIPLATTIWLSTIVSR
FT                   FVLAILTSIPKQLNPFITLNPLLQDLINLALGLTVPLLGILLIGLMARNFVGRWLLEFG
FT                   EGTLSRIPLAGSVYKTLKQLLETFLRDNSTRFRRVVLVEYPREGLFSVGFVTGIVGPSL
FT                   QTEPNQPLLSVFIPTAPNPTTGWYTLVPEDSVKDLDISVEDAFRTIISAGIVNPDDRSN
FT                   STNTSFSSLFSQLRASSS"
FT   gene            11360..11986
FT                   /gene="nusB"
FT                   /locus_tag="NATL1_00081"
FT   CDS_pept        11360..11986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="NATL1_00081"
FT                   /product="Antitermination protein NusB"
FT                   /note="COG781 Transcription termination factor
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74572"
FT                   /db_xref="GOA:A2BZB2"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZB2"
FT                   /protein_id="ABM74572.1"
FT                   /translation="MQLKSISRELALLLLGQIKKKDINKLNIESLLSKAIESLTQHWRE
FT                   QLDSCASQLEKANQELLDSEFQVDAGLLIKSQNHLKTCLIDSENILNCLSESIELPRLL
FT                   ALVDQKEIRELAVRRVDLVIEKQDEIDHTLDSVMEGWRLKRLPRIDRDILRLAWVDLID
FT                   FNTPMAVTCNEAVNLANRYSDVQGRRMINGVLRKLQNSALILNLK"
FT   gene            11983..13278
FT                   /gene="ftsY"
FT                   /locus_tag="NATL1_00091"
FT   CDS_pept        11983..13278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="NATL1_00091"
FT                   /product="signal recognition particle docking protein FtsY"
FT                   /note="COG552 Signal recognition particle GTPase
FT                   [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74573"
FT                   /db_xref="GOA:A2BZB3"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZB3"
FT                   /protein_id="ABM74573.1"
FT                   /translation="MKEDCSQDEKNFSKMNQSENSSSMNDDSLDWAKQAYLQLKQKQKE
FT                   EKELCQKEIAEKEILKTKTNTSEDFKSNITVENSLQVSQETEVEDQPQLGDFDDTFTWS
FT                   AEVLAAQGKKIDQFSLDDIDWLSRLKQGLEKTRKGFVTDLLEKLGDDPLTPEVLDDLET
FT                   LLLRADAGVSATDQILESLRTKLNEEVVEASEGLRFLKEQLVNVLEKPIKDSGADLLSP
FT                   QKGCLNIWMLVGVNGVGKTTTLGKLASVAKRSGFSAMIAAADTFRAAAVQQVKVWGDRT
FT                   GVEVIANESKNADPASIVFDAIGASKSKNIDLLLVDTAGRLQTKNNLMEELKKIRKIID
FT                   KLAPKANVESLLVLDSSQGQNGLRQALAFADSAELTGVILTKLDGSSKGGVAMAVASEA
FT                   KLPVRFIGAGEKIRDLRPFNSFEFIEALLTVR"
FT   gene            13337..14734
FT                   /gene="rsbU"
FT                   /locus_tag="NATL1_00101"
FT   CDS_pept        13337..14734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /locus_tag="NATL1_00101"
FT                   /product="Protein phosphatase 2C domain"
FT                   /note="COG2208 Serine phosphatase RsbU, regulator of sigma
FT                   subunit [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74574"
FT                   /db_xref="GOA:A2BZB4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZB4"
FT                   /protein_id="ABM74574.1"
FT                   /translation="MKENSPISEQQNQHPTNLCSSAASKSLSDLVHSLSQEQVVNQDLL
FT                   LSLSFALRSFTNLQRFLELIPLLVTQLVGVKGSLLIPFQDNGSLWREQLQMVPIDEDQE
FT                   LFRKLFLLEKGKKTGFGMEEKNIEMLDGLVQRHLDSSNVIATSIVSRGRQRGRLYAFDK
FT                   KEIVFGSNVHRKHIQIVADLAGVAIENDAIFQVIRNHEKVDRQISIGAEIQSQLLPDQC
FT                   PVIEGVELAACCRPAFQVGGDYYDFMPTRSDLNETAKASGRWAFVIGDVMGKGVPAGLL
FT                   MTMLRGMLRAEVLTGLPPDSILHDLNQLALEDLTQSHRFVTLFYSDFDAKSRKLRFANA
FT                   AHNPPLLWSSKTKSINRLDTPGLLIGLQPEAEYGCGEIFLQPGDVLLYYTDGVTEAPGI
FT                   SGERFDENRLITFLDKFAKEGLGAKQILNKLFERLDGFVGVSDHHLEDDASMVVLKVKE
FT                   STVPELN"
FT   gene            14783..16174
FT                   /gene="argH"
FT                   /locus_tag="NATL1_00111"
FT   CDS_pept        14783..16174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="NATL1_00111"
FT                   /product="Fumarate lyase:Delta crystallin"
FT                   /EC_number="4.3.2.1"
FT                   /note="COG165 Argininosuccinate lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74575"
FT                   /db_xref="GOA:A2BZB5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZB5"
FT                   /protein_id="ABM74575.1"
FT                   /translation="MEKALSKTWSDRFDKGLNPFIEKFNASIEFDICLLEEDLDGSIAH
FT                   ARMLGIQGIITKEEALRLENGLQQIRKEASDGLFQPVIADEDVHFAVEKKLIDLIGPVG
FT                   KKLHTGRSRNDQVGTDLRLWLRKRIDEIDMDLVRLQKSLFLLAEENLYTLIPGYTHLQR
FT                   AQPLSLAHHLLAYIEMAQRDRNRLKDVRKRVNISPLGAAALAGTSISISRKITSSELHF
FT                   QGIYSNSLDAVSDRDFVVEFLGASSLIMAHLSRLSEEVILWASEEFAFIQLTDRCATGS
FT                   SLMPQKKNPDVPELVRGKSGRVFGHLQAMLTMIKGLPLAYNKDFQEDKEAIFDSVKTVK
FT                   NSLIAISILFEEGLIFRKERLNQAVSSDFSNATDVADYLVAKDIPFREAYQLVGRIVKT
FT                   SLEEGILLKDFPLERWKTFHKFFEKDIYEKLLPSSVVESRLSAGGTGFERVQEQLLSWR
FT                   EKLFN"
FT   gene            16301..17053
FT                   /locus_tag="NATL1_00121"
FT   CDS_pept        16301..17053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00121"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74576"
FT                   /db_xref="GOA:A2BZB6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZB6"
FT                   /protein_id="ABM74576.1"
FT                   /translation="MSIFVGNLPFRAEQEDVMELFSPFGEVSNCSLPLERDTGRKRGFA
FT                   FVEMADEAVEASAIESLQGAELMGRPLRINKAEPRGSAPRRGGYGGGGGGGYGGGGYGG
FT                   GGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGGQ
FT                   GGYGGGGQGGYGGGGQGGYGGGGYGGGGQADQSAQDRPSGAKGWEDRSHGNASQDVNDF
FT                   DQGRSRRRRGASPEGGADSTADYGGAES"
FT   gene            complement(17073..18080)
FT                   /locus_tag="NATL1_00131"
FT   CDS_pept        complement(17073..18080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00131"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /note="COG42 tRNA-dihydrouridine synthase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74577"
FT                   /db_xref="GOA:A2BZB7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZB7"
FT                   /protein_id="ABM74577.1"
FT                   /translation="MISNSLKTNEIANYRLSIAPMMDCTDRHFRVLMRQITKKSLLYTE
FT                   MIVAQALHYSKNRNKLLDFDEIEHPISIQLGGDNPKLLAEAAQMAEDWGYDEINLNIGC
FT                   PSPRVKSGNFGACLMGKPKIVANCIEKMKESCNIPITVKHRLGIDNLDSDDYLLTFVDT
FT                   CSLAGADRFIIHARKAWLNGLNPKENRTIPPLQYERVQKLKNHRPELIIELNGGINTIN
FT                   DSIEALKVFDGAMVGRAAYSHPFLWTKIDSLIFGQKEKYLSRSKIIKRLIPFAEKHLEN
FT                   DGRLWQISRHILNLIENIPNAKILRQELSEKCQTQKADISILKKIAQQLEDAGQ"
FT   gene            18170..18637
FT                   /locus_tag="NATL1_00141"
FT   CDS_pept        18170..18637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00141"
FT                   /product="Domain of unknown function DUF25"
FT                   /EC_number="1.8.4.11"
FT                   /note="COG229 Conserved domain frequently associated with
FT                   peptide methionine sulfoxide reductase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74578"
FT                   /db_xref="GOA:A2BZB8"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZB8"
FT                   /protein_id="ABM74578.1"
FT                   /translation="MFGLLNTLFGFTIEPKSAFASSKPMENYKTLTDADWENRLPKDAF
FT                   YVLRKEGTERPFSSSLNDEKRKGVFRCAGCGLALFSSTTKFDSGTGWPSFFDHLPDAIE
FT                   TKTDFKLIVPRTEYHCRRCGGHQGHVFNDGPRPTGKRYCNNGVALAFEVDS"
FT   gene            18732..19511
FT                   /gene="grpE"
FT                   /locus_tag="NATL1_00151"
FT   CDS_pept        18732..19511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="NATL1_00151"
FT                   /product="Heat shock protein GrpE"
FT                   /note="COG576 Molecular chaperone GrpE (heat shock protein)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74579"
FT                   /db_xref="GOA:A2BZB9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZB9"
FT                   /protein_id="ABM74579.1"
FT                   /translation="MNSDVSSSEHELSQDGSSQNNPSENFVSSSNSNESVNQVELSDNP
FT                   EVEHQVKNDSVDTAKEQSSTSCESNIKGSDTEARLQQLEKEHETLNSQYMRIAADFDNF
FT                   RKRQTRDQDDLKIQLTCTTLSEILPIVDNFERARQQLNPEGEEAQALHRSYQGLYKQLV
FT                   EVLKNLGVAPMRVVDQAFDPSLHEAVMREPSDEKAEDIVIEELQRGYHLNGRVLRHALV
FT                   KVSMGPGPKAVNEEIPDQSASNQELSESVDGPTKDEN"
FT   gene            19556..20686
FT                   /gene="dnaJ"
FT                   /locus_tag="NATL1_00161"
FT   CDS_pept        19556..20686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="NATL1_00161"
FT                   /product="DnaJ protein"
FT                   /note="COG484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74580"
FT                   /db_xref="GOA:A2BZC0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZC0"
FT                   /protein_id="ABM74580.1"
FT                   /translation="MADFYDLLGVSRDADADTLKRAYRQQARKYHPDVNKEAGAEDKFK
FT                   EIGKAYEVLSDSQKRARYDQFGEAGIGGAAGMPDMGDMGGFADLFDTFFNGFGGASSAG
FT                   GSRPQRRGPQQGDDLRYDLTIDFDKAIFGQEKEITVPHLETCDVCRGTGAKKGTGPVTC
FT                   STCSGAGQVRRATRTPFGSFTQVAECPTCGGTGQVIKDPCNACGGKGVKQVRKKLKINI
FT                   PAGVDSGTRLRVSGEGNAGLKGGPSGDLYVFLKVKNHPNLKRDGLTILSEVNISYLQAI
FT                   LGDTIEIETVDGPTKLQIPAGTQPNSILNLENKGVPKLGNPVARGNHQVSVKIKLPTKL
FT                   SDSERNLLEELAGHYSALGPQHHYHKSGLFSKLFGK"
FT   gene            20689..20928
FT                   /locus_tag="NATL1_00171"
FT   CDS_pept        20689..20928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74581"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZC1"
FT                   /protein_id="ABM74581.1"
FT                   /translation="MEKNIFIDHYLDLSGLACPVNFVKCCLVLENLSSNQVLKVDLDIG
FT                   EAETSVIDGLQEKGYKVKILNKDSKTVTLIISSE"
FT   gene            20921..21859
FT                   /locus_tag="NATL1_00181"
FT   CDS_pept        20921..21859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00181"
FT                   /product="Predicted GTPases"
FT                   /EC_number="3.6.5.1"
FT                   /note="COG1162 Predicted GTPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74582"
FT                   /db_xref="GOA:A2BZC2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZC2"
FT                   /protein_id="ABM74582.1"
FT                   /translation="MNKNKSNKLKGIVVALKANFLIVEIDHKNFKDYSFDEFNGKIRLL
FT                   CIRRSKLNYQGLFIDVGDIVGVESIDYKNKRAVVSDVEPRQSFLKRPAVANVTLVSICI
FT                   SADEPLFDMEQTSRFLLTAECANIEPLIILTKIDLITKNDLILYINKFKSWGYDCIPVS
FT                   IHNSQGIDSLIERLRKTKLTVLAGPSGVGKTSLINHLIPTVSLPTSSVSKKLKRGTHTT
FT                   RHVELFAIGNGSLLADTPGFNRPEIVCEPSDFAFLFPEFRTQLSNSQCKFRNCLHRDEP
FT                   GCVIDKDLERYPFYRENLEEMINSPLPYQAG"
FT   gene            complement(21828..22175)
FT                   /locus_tag="NATL1_00191"
FT   CDS_pept        complement(21828..22175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00191"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG718 Uncharacterized protein conserved in bacteria
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74583"
FT                   /db_xref="GOA:A2BZC3"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZC3"
FT                   /protein_id="ABM74583.1"
FT                   /translation="MAGFGLPNFGQLTEAFKKAQQIQQNAQKLQEELEVMEIEGTNDDN
FT                   RAKIWMSGNQKPLRVEIDPSLLSEGKAIIEEAILEAMKSAHEVSTSTMKERMEDLTGGF
FT                   KLNLPGMGEES"
FT   gene            complement(22213..23088)
FT                   /gene="murB"
FT                   /locus_tag="NATL1_00201"
FT   CDS_pept        complement(22213..23088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="NATL1_00201"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="COG812 UDP-N-acetylmuramate dehydrogenase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74584"
FT                   /db_xref="GOA:A2BZC4"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZC4"
FT                   /protein_id="ABM74584.1"
FT                   /translation="MNSIKLQKNISLSNFTTWGIGGPAEWIAQPKNIEELKYVINWTNK
FT                   KKIPCSVIGAGSNLLINDKGIKGLSLCMRNLKGIEIDKNNGIIEVLSGEMLPTLARKAA
FT                   ASGLHGFEWAVGIPGTIGGAVVMNAGAQEHCISSYLESITTLSLTGEYQRIKGKDLNFG
FT                   YRHSLLQNEKLIVVSARLKLASGHAKEIRQVTNENLNHRLKTQPYQAQTCGSVFRNPEP
FT                   LKAAKLIEELGLKGFRFGGAEISKIHSNFIINVNKASSYDVRELIKYVKKRVFDSYGIL
FT                   LETEVKQCGF"
FT   gene            complement(23092..24576)
FT                   /gene="murC"
FT                   /locus_tag="NATL1_00211"
FT   CDS_pept        complement(23092..24576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="NATL1_00211"
FT                   /product="Probable UDP-N-acetylmuramate-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="COG773 UDP-N-acetylmuramate-alanine ligase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74585"
FT                   /db_xref="GOA:A2BZC5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZC5"
FT                   /protein_id="ABM74585.1"
FT                   /translation="MTSYLSNDTEAKLKKTKELPPHIHFIGIGGIGMSALAMILAQKGY
FT                   SISGSDQKKNLTLKKLEENKVHIFPTQVESNIDEILKVHGKNILVVKSSAIHRDNLELC
FT                   KAKKYNLKIKHRSEILAFLIEEKKSIIVSGSHGKTTTSTYITTLFSYANKSPTAIIGGI
FT                   VPLYKSNYSFGKSEFLIAEADESDGSLVKFNPNIGLITNLELEHVDHYLDLEDLIETMK
FT                   QFAQKCECLITNFDCDNLRANIHGSKWFSIQKIINIDFALIPKESNGCEIIAEYYEKEK
FT                   FIDVIKIPVPGIHNLSNAAAAIAACRVAGILFKDIKKGIEKLKLPSRRFEFKGLWRNRL
FT                   IVEDYAHHPSEIDAAISIASTIIETKHKLSKILPRRIVTIFQPHRYSRTKKFQKEFAKT
FT                   LSQSDLVFITPIYSAGEDKIEGINNKSIGHELKKIKPNLEIYTPDNNQNLIKLIKEKTL
FT                   ENDLILIMGAGDINLISENLFLELLNNKLISNDIAA"
FT   gene            24726..25748
FT                   /gene="gap2"
FT                   /locus_tag="NATL1_00221"
FT   CDS_pept        24726..25748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap2"
FT                   /locus_tag="NATL1_00221"
FT                   /product="Glyceraldehyde 3-phosphate
FT                   dehydrogenase(NADP+)(phosphorylating)"
FT                   /EC_number="1.2.1.12"
FT                   /EC_number="1.2.1.13"
FT                   /note="COG57 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74586"
FT                   /db_xref="GOA:A2BZC6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZC6"
FT                   /protein_id="ABM74586.1"
FT                   /translation="MTLRVAINGFGRIGRNFMRCWLSRGANTNIEVVGINVTSDPKTCA
FT                   HLLKYDSILGAIKDAQISHTDDTFQINGKTIKCYSDRNPLNLPWKEWGIDLVIESTGVF
FT                   NTDVGASKHLQVGAKKVILTAPGKGDGVGTYVVGVNADSYSHEDFDILSNASCTTNCLA
FT                   PIVKVLDQKLGINKGLMTTIHSYTGDQRILDNAHRDLRRARAAAMNLVPTSTGAAKAVA
FT                   LVYPQMKGKLTGIAMRVPTPNVSAVDLVFESGRKTSAEEVNSLLKTASQGEMKGIIKYG
FT                   DLPLVSTDYAGTNESTIVDEALTMCIDDNMVKVLAWYDNEWGYSQRVVDLAEIVAQKWK
FT                   "
FT   gene            complement(25758..26747)
FT                   /gene="thiL"
FT                   /locus_tag="NATL1_00231"
FT   CDS_pept        complement(25758..26747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="NATL1_00231"
FT                   /product="putative thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="COG611 Thiamine monophosphate kinase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74587"
FT                   /db_xref="GOA:A2BZC7"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZC7"
FT                   /protein_id="ABM74587.1"
FT                   /translation="MTTTIQDLGEIELLNRLKKFMRCGQIDDDVAEINKINKSLLINTD
FT                   LLVEKIHFSDEISNAKDIGWKCITTNISDLICSGSENIISFTVGLVLPPNTHWKWVENL
FT                   YEGMLEAMQEFGGEIIGGDCSCGETKMISITAIGEMNLPRLHRGNALPGDYIVSTGIHG
FT                   LSRLGLALLTSEKLPSEAPVSPKLINKAINAHKRPYPALKALKALKACKPQSTSWRAAG
FT                   TDSSDGLIESIRGICQASNCQAILSKTSILKHPDWPEDDIWDEWILNGGEDYELILSLP
FT                   KDWAKSLSNKLKSAKIIGFIKEGKPNIFWDNLEQTRIDQSSLFRHFKL"
FT   gene            complement(26760..27836)
FT                   /locus_tag="NATL1_00241"
FT   CDS_pept        complement(26760..27836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00241"
FT                   /product="Cyclophilin-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /note="COG652 Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) - cyclophilin family [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74588"
FT                   /db_xref="GOA:A2BZC8"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZC8"
FT                   /protein_id="ABM74588.1"
FT                   /translation="MAKKICILALITILFSLGSPWVNPAFASLPNGNRLKDPYAILRNS
FT                   LPIDQKELRELQNKLEETSEDLRGSRWSAISKATSRSQFLVSNKKNQILDSMPAENKEN
FT                   ASNLLSNLKEELDELGQIANEKNKVSFLDVRRQSLKTIDDIESLLITKNFPYQIPSEYN
FT                   HLPRLLGRANVEIKTSKGSMNAIIDGYNAPLTAGAFIDLSMKGFYDGLPINRAEEFFIL
FT                   QTGDPKGETIGYIDPDNNELRRVPLEIRTSSLEDTLYGETFEDVGLYTETPVLPFATLG
FT                   TLGWAHSDTDLNDGSSQFFFFLYEAELNPAGRNLIDGRNAAFGYVIEGSEILNKLGVDD
FT                   KIISITVLNGSENLKLKA"
FT   gene            27900..28463
FT                   /gene="efp"
FT                   /locus_tag="NATL1_00251"
FT   CDS_pept        27900..28463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="NATL1_00251"
FT                   /product="Elongation factor P (EF-P)"
FT                   /note="COG231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74589"
FT                   /db_xref="GOA:A2BZC9"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZC9"
FT                   /protein_id="ABM74589.1"
FT                   /translation="MISSNDFRTGTTIELDGAVWRVIEFLHVKPGKGSAFVRTKLKAVV
FT                   SGSVVEKTFRAGEMVPQALLEKSKLQHTYMDGDEFVFMDMTSYEETRLTAKQIGESRKY
FT                   LKEGMEVNVVSWNEKPLEVELPNSVVLEIKETDPGVKGDTASGGTKPAILETGAQVMVP
FT                   LFISIGEKIRVDTRNDSYLGRETQ"
FT   gene            28460..28957
FT                   /gene="accB"
FT                   /locus_tag="NATL1_00261"
FT   CDS_pept        28460..28957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="NATL1_00261"
FT                   /product="Biotin / Lipoyl attachment:Acetyl-CoA biotin
FT                   carboxyl carrier subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG511 Biotin carboxyl carrier protein [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74590"
FT                   /db_xref="GOA:A2BZD0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZD0"
FT                   /protein_id="ABM74590.1"
FT                   /translation="MTMNLDHEELHRLLATLAESDIKEFRLEGEDFCLEVKRNLGTSSD
FT                   SIASNKKITSEDIDSPPPQSKLDALPVQSTPPPSVPGSRSELVEVTAPMVGTFYRAPGP
FT                   EEPPFVEIGSRIKVGQAVCILEAMKLMNELESEVSGEVIEILVENGTPVEFGQVLMRLK
FT                   PV"
FT   gene            complement(28968..29993)
FT                   /gene="pdxA"
FT                   /locus_tag="NATL1_00271"
FT   CDS_pept        complement(28968..29993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="NATL1_00271"
FT                   /product="putative pyridoxal phosphate biosynthetic protein
FT                   PdxA"
FT                   /EC_number="1.1.1.262"
FT                   /note="COG1995 Pyridoxal phosphate biosynthesis protein
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74591"
FT                   /db_xref="GOA:A2BZD1"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZD1"
FT                   /protein_id="ABM74591.1"
FT                   /translation="MQKSEITKENSTTLIISLGDPAGIGTEITLKALGSKSLNKNIKPL
FT                   LVGCKNNIHETYSKLIKHGIDNIPDPNKLHIIDIPLENKVTPGIIDKYTGSASFKWLLN
FT                   ATNILLEGKANALVTAPISKIAWHKAGHKFAGQTELLGKLTNKKTSMLFTAISPNNGWR
FT                   FNTLLATTHIPLNKINDTLTKELIKHKLDTLLNFCRKFKEKPSIQIAGLNPHAGEEGKI
FT                   GMEEQNLIIPILNEWKLDNPDIKIIGPIPPDTCWITSVNAWNGASIKNNAPDGILALYH
FT                   DQGLIPVKLIAFDEAVNTTLGLPFVRTSPDHGTALDIAGMFKAREKSMVAAMNNAWLLS
FT                   Q"
FT   gene            complement(30180..31076)
FT                   /locus_tag="NATL1_00281"
FT   CDS_pept        complement(30180..31076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00281"
FT                   /product="Nucleoside-diphosphate-sugar epimerases"
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74592"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZD2"
FT                   /protein_id="ABM74592.1"
FT                   /translation="MIQEIVKRSKPLPPKSKLIIFGGGFSGQRIASVGRHLGVKVLCSR
FT                   RREGSKGANFIFNTDQEFTNEVLEGATHVLSCIPPLLSGEDPVLLKLKTQLLNAKKIKW
FT                   VGYLSTTGVYGDSKGNWVNENTPPNPLQERSIRRLSCEKQWLDTKLPIQILRLPGIYGP
FT                   GRSVFESLLNGTTKMIDKPGQVFSRIHVDDIAGSVLFLINLYFQGKTPSIVNVADNLPA
FT                   NNLDVINFAANIAKKSLPSKVPFEIAQKTMSPMAKSFWQENRKVDNKLLCKKLGYSLIY
FT                   PDFKSGLKNCYFQQKIN"
FT   gene            31085..31333
FT                   /locus_tag="NATL1_00291"
FT   CDS_pept        31085..31333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00291"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74593"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZD3"
FT                   /protein_id="ABM74593.1"
FT                   /translation="MYYVDYLAMIASYFKPSLNSINGARKLRNDKKISVQEKNQNLIKP
FT                   LLASICFLFCIILVPEKSSNLASICEKYNSSVACQVW"
FT   gene            complement(31337..31747)
FT                   /locus_tag="NATL1_00301"
FT   CDS_pept        complement(31337..31747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00301"
FT                   /product="HNH endonuclease:HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74594"
FT                   /db_xref="GOA:A2BZD4"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZD4"
FT                   /protein_id="ABM74594.1"
FT                   /translation="MHNRDAVFLEDLCPKLRNRRWRKSLHEFTGNSCIYCGKTSESIDH
FT                   VLPRSRGGLSITENCVPSCLSCNGSKTDNDAFEWYRKQRFYDPRRSMAIRAWTEGDIRL
FT                   ALRLLKWAQPKPIESFKNSKSKLNVDYSWQAA"
FT   gene            complement(31899..32321)
FT                   /locus_tag="NATL1_00311"
FT   CDS_pept        complement(31899..32321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00311"
FT                   /product="type II secretion system protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74595"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZD5"
FT                   /protein_id="ABM74595.1"
FT                   /translation="MSLGIKRNLLPISIICLACGSTLGLRINAAVTNGADIYCFMRNGG
FT                   NTHEPSWQAAYQFIKNKKQGLFKTSPKQAASLIVEEVVQNPTKYEDCINYLGDLYTGES
FT                   SSIGVNNEKDLTSEVTSPSDSAEKTPKGKYVDRYSY"
FT   gene            32479..32685
FT                   /locus_tag="NATL1_00321"
FT   CDS_pept        32479..32685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00321"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74596"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZD6"
FT                   /protein_id="ABM74596.1"
FT                   /translation="MFTKIIMNTVQVKKQAFLKEACFFFKNASVYAEEGDLQTCACLIL
FT                   KALDKERRADGVGPQVLHLIKTI"
FT   gene            complement(32708..33862)
FT                   /gene="dhsS"
FT                   /locus_tag="NATL1_00331"
FT   CDS_pept        complement(32708..33862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhsS"
FT                   /locus_tag="NATL1_00331"
FT                   /product="soluble hydrogenase small subunit"
FT                   /EC_number="1.12.1.2"
FT                   /note="COG75 Serine-pyruvate aminotransferase/archaeal
FT                   aspartate aminotransferase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74597"
FT                   /db_xref="GOA:A2BZD7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZD7"
FT                   /protein_id="ABM74597.1"
FT                   /translation="MQDKLNLMIPGPTPVPENVLSSMSKHPIGHRSGDFQKIVQKTTEQ
FT                   LKWLHQTTADVLTITGSGTAAMEAGIINTLSKGDQVICGDNGKFGERWVKVARAYGLDV
FT                   KVVKADWGTPLDPNQFKRILEEDTNEKIKAVILTHSETSTGVINDLKSINNEVKNHSKA
FT                   ITIADCVTSLGACNIPMDEWGIDVIASGSQKGYMIPPGLSFVAMSKRAWEANNQSNLPK
FT                   FYLDLKQYLKTVNQNSNPFTPAINLYFALEASLTMMQKEGLNNIFARHARHQKATQEGI
FT                   KAMGLNLFTKENFGSPAITAVKPENIDAESIRKAIKNDFDILLAGGQDHLKGKIFRIGH
FT                   LGFVNNRDIISVISALESTLDKMGKLNVPIGQGIAKTISVLNNE"
FT   gene            33942..35087
FT                   /gene="cbiD"
FT                   /locus_tag="NATL1_00341"
FT   CDS_pept        33942..35087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiD"
FT                   /locus_tag="NATL1_00341"
FT                   /product="CbiD protein"
FT                   /note="COG1903 Cobalamin biosynthesis protein CbiD
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74598"
FT                   /db_xref="GOA:A2BZD8"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZD8"
FT                   /protein_id="ABM74598.1"
FT                   /translation="MNQFTLPVWVVAAAKSATNILIGNKFRDKERIDLPNKEESISVPI
FT                   SSSALLDNGKRSLAVSHCQSGLPLDITRGVEIWAYIQLSKGSSQSKGKVQNGFPDWLDF
FT                   HAGCGVGKFQSSGQPCISQFARDLLCINLYPLVPKGNSIKVEIILPEGKDRASKTSNEA
FT                   FGVVDGLSLIGTQAEVQISASPDQLKNCKEILYHKCSEAKFDGCLTFVIGENGMDLAMK
FT                   YGLPANQIIKTGNWLGPLLVAAAENGVKKLLLFGYHGKLIKLSGGVFHTHHHLADGRIE
FT                   ILTSLAFREGISFDLIELISKSTSVENALLTLEVSNPDAVSLIWSRMAKEIEIKSRSYV
FT                   NRYLSSSMEIGSVLFDRKRQMRWAGLEGLKQINSLGLILKR"
FT   gene            35154..36740
FT                   /locus_tag="NATL1_00351"
FT   CDS_pept        35154..36740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00351"
FT                   /product="Glutamine amidotransferase class-I:GMP synthase"
FT                   /EC_number="6.3.4.1"
FT                   /EC_number="6.3.5.2"
FT                   /note="COG519 GMP synthase, PP-ATPase domain/subunit
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74599"
FT                   /db_xref="GOA:A2BZD9"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZD9"
FT                   /protein_id="ABM74599.1"
FT                   /translation="MASMISAEKRNPAIVILDFGSQYSELIARRIRETEVYSLVMSYTT
FT                   SADKLRSLKPKGIILSGGPGSVYEEGAPYCDPEIFNLGIPVLGVCYGMQLMVHELGGSV
FT                   KPATGKAEYGKAPLEVDDPTALLTNVISGSTMWMSHGDSVQKLPKGFVRLAHTSNTLEA
FT                   AIALHDKSFYGVQFHPEVVHSTHGMVVIRNFVYDICSCEPDWTTNLFIDEAVSQVQQQV
FT                   GDKKVLLALSGGVDSSTLAFLLNKAIGPQLTCMFIDQGFMRKGEPEFLMSFFDEKFKIN
FT                   VEYINARERFISQLKGVTDPEQKRKIIGREFIRVFEEESLRLGPFDYLAQGTLYPDVIE
FT                   SSGTNIDPKTGERIAVKIKSHHNVGGLPKDLQFKLVEPLRRLFKDEVRKVGKSLGLPDE
FT                   IVRRHPFPGPGLAIRILGEVTHEKLNCLRDADLIVREEINNAGLYNKIWQAFAVLLPVY
FT                   SVGVMGDQRTYAWPIVVRCVSSEDGMTADWSRLPYAVLEKISNRIVNEVEGVNRVVLDI
FT                   TSKPPGTIEWE"
FT   gene            complement(37038..38111)
FT                   /locus_tag="NATL1_00361"
FT   CDS_pept        complement(37038..38111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00361"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74600"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZE0"
FT                   /protein_id="ABM74600.1"
FT                   /translation="MDTERNNLVSKKEVINSLYKIICTTTQSSSDRKIDDNSYFKRRVG
FT                   GFKAEIEFENELKKNTTYSFLSGGMVLSPEIDGTKDMKNEFTYISIDSLAPSSYEEVYS
FT                   NIINWNEIKYCYYAQINFENWELEEFNTKENKGDKNTVKTQILKPNYTLYKFDKDTKKF
FT                   KKTLVDNFSEVFSIGRRKENTPSKYHLREKDRFDYFDDYDLKTLQKIYTNRYFLMKKYF
FT                   NVVFNIIDIDGFIIKDKKIIIVEIKEKSPNKNKKSPDNKQFWFYGWDTRRILWYEFIQR
FT                   KIGLDILYTVRQTNNRREKEFIKWDSIFLNDFLKVVSWHKSIDGGGGEGTLIAPYNHFK
FT                   SLDQVLSKYNFQGKTYD"
FT   gene            39055..39972
FT                   /gene="dcm"
FT                   /locus_tag="NATL1_00371"
FT   CDS_pept        39055..39972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcm"
FT                   /locus_tag="NATL1_00371"
FT                   /product="Site-specific DNA methylase"
FT                   /note="COG270 Site-specific DNA methylase [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74601"
FT                   /db_xref="GOA:A2BZE1"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZE1"
FT                   /protein_id="ABM74601.1"
FT                   /translation="MSNNFRFIDLFAGIGGIRIPFEELGGECVFSSEWDKYSQITYEAN
FT                   FGEIPKGDITKINAEDIPKHDLLVGGFPCQAFSQAGLKKGFQDTRGTLFFDIARILKFH
FT                   KPKAFLLENVKHLKGHDSGKTFKTIMNVLRDIGYQTIEYKVLNAKDFGVPQNRERIFIF
FT                   GYIDFIFFEFPEPSKVQTKVGDILDDNVPDKFTLSDKMWTNAIRRKENNRKRGYGFGFS
FT                   LFDKDSEYTSTISARYYKDGSEIWIDQDSKNPRMLTPNEARKLQGFPEGFKIPVSNLQA
FT                   YKQFGNSVSVPVIRAIAERIVKLL"
FT   gene            complement(39959..40753)
FT                   /locus_tag="NATL1_00381"
FT   CDS_pept        complement(39959..40753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00381"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74602"
FT                   /db_xref="InterPro:IPR019063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZE2"
FT                   /protein_id="ABM74602.1"
FT                   /translation="MDAVKEKIKELFFKNVYGLSPNIEGYDKKHAGAKGHWLEKKLGKT
FT                   PDASNEADFWGYECKNFTSNKTTWGDWSANEYIFDKNNEFQIPRDKFIKLFGKPNQAKK
FT                   NRCSWSGQPVPDSPNKYTLFGQIMSIDESLNISITYSFEKDQRDNKFDLMPKEFHTNNL
FT                   LLAKWYGYERNNNSKKTALETKISKKFNQKGWFKCLMKNNTYNEIAFGKPINFEFWMNY
FT                   VEKGDIFFDSGMYQGNNRNYSQWRSINSFWEELIEERYTKAI"
FT   gene            complement(41013..41780)
FT                   /locus_tag="NATL1_00391"
FT   CDS_pept        complement(41013..41780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00391"
FT                   /product="Glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="COG625 Glutathione S-transferase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74603"
FT                   /db_xref="GOA:A2BZE3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZE3"
FT                   /protein_id="ABM74603.1"
FT                   /translation="MKEPAKKVEDSSQKDIHLYTAPTMNGWKPIIFLEEAGIEYDLTYV
FT                   DFSKNEQKDKNYIKNINPNGRIPSIIDRSNNDFCVFESGAILWYLAEKYNKFLPRNANE
FT                   KSITMQWLMFQVGGIGPMMGQAMYFQRIAALNGENNQFSIKRYVDESRRLFEVLDKQLA
FT                   SHKFIVSNEFTIADIATYPWARTYYWANVPIDGLPNLKAWFNRIDNRKNTQRALEIPQP
FT                   RWAFFGKGDIQSQESENAENFKSDVKSVLNGNK"
FT   gene            complement(41780..41974)
FT                   /locus_tag="NATL1_00401"
FT   CDS_pept        complement(41780..41974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00401"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74604"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZE4"
FT                   /protein_id="ABM74604.1"
FT                   /translation="MISNKRSQELLMLANTGKPLNKDATEEEKKFYEECKHDYKVMHET
FT                   AKKHGIKNPILEIPMEVDF"
FT   gene            42106..42969
FT                   /locus_tag="NATL1_00411"
FT   CDS_pept        42106..42969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00411"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74605"
FT                   /db_xref="GOA:A2BZE5"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZE5"
FT                   /protein_id="ABM74605.1"
FT                   /translation="MKHIPLKTIQLKNHQVLNERWLQDIIAEDPSIIGIGDVILKDKER
FT                   IHQGAGRLDLLLQDADGIERYEVEIQLGATDESHIIRTIEYWDIERKRYPQYNHTAIII
FT                   AEDITSRFLNVISLFNGSIPLMAIQVCAIQTAEGVGLHFTKVLDVQQLGLVDEDEEVAE
FT                   VTNRDYWLKRGTPKTVAMADKLLSYIHEFDHDAELNYNKFYIGLKINSRSKNYAIFRPK
FT                   KNFIGLEIKMPQTEENDEIINQAEIANLDYSKRYGYYRLSIYERDLEEKSDFIKKLLLD
FT                   AKERFG"
FT   gene            complement(43375..44829)
FT                   /locus_tag="NATL1_00421"
FT   CDS_pept        complement(43375..44829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00421"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74606"
FT                   /db_xref="GOA:A2BZE6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZE6"
FT                   /protein_id="ABM74606.1"
FT                   /translation="MKGFGEQHKSKKKRNETTTFQVPFPFPLRESQENINIITNTPSKL
FT                   SKEQIINQALKFHSKGNISEATKYYQYFINQGFKDHRVFSNYGAILRKQGKVKESGFFM
FT                   RKAIEIQPNIPIINFNMGNILKDLGKLKEAEIFIRKSIRMDPNLTKAYLSLSTITYSNI
FT                   DNKTWQDNLFSDFILKYKSQVEQVEIYFARANILHKEKKYKKSYQNLKLANNLQLAIKA
FT                   SDINKRIKKSQLLLIESDKKVVNKKEKINYAQSIFILGLPRCGSTLLESILSMNKDVYD
FT                   LGEINILEESFIEYKKFIQDISLAELYNDKVKNKTDLNITTNKWLYNYQYAGIIARHIP
FT                   NAKLIHCFRHPLDNILSLYRTHFASGNEYSSSLVDCARVYLDQEKVMKEYKNRYRSKIY
FT                   DLNYDSLVNDPNKEIRSLISWLGWEWQDSFLSPQLNSRSVSTASNVQVRSPINSKSIGG
FT                   WKNYKDMLKPAIEILAKTNGYKNIAS"
FT   gene            complement(45128..46435)
FT                   /locus_tag="NATL1_00431"
FT   CDS_pept        complement(45128..46435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00431"
FT                   /product="Hypothetical protein"
FT                   /note="COG5010 Flp pilus assembly protein TadD, contains
FT                   TPR repeats [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74607"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZE7"
FT                   /protein_id="ABM74607.1"
FT                   /translation="MEESQKEEQRKKNIPQVQTFTVPFTSVEVKENITITTNNPSKPSK
FT                   EQIINQAIQFHLKGNIPKATKYYQQLINQECNDYRVFSNYGAILQGLGKSKEAEASLRK
FT                   AVELNPDLAESHSYLGNLLNDLGKFKEAEASLRKAVELNPNLALAHAYLGILLNDLGQL
FT                   KEAEASLKKAIKLKFGSVKAYDALSNVLNKLGRKKEAEESSKKILYLTPVSDSKLEDKR
FT                   KGQNNMFTKPSPIEYPIFYRPGMGTENVGSFLRSMVMMLRPKRVLEIGAGYTTPFLLEA
FT                   LINNERVFDDGNLSESYFQNYNYEAKLVVIDNQSLGNLTKVPGMKDIVNSKYTEFIEGT
FT                   FEGKAKELSTKYSHFDFVWFDCGGPKEYLSFIQEYWEYCSNYILFHFTYRDGKPNVNHK
FT                   IIHDNIKGNPVIIDIVEPHKKRQGSITMVKKENFKK"
FT   gene            complement(46962..48923)
FT                   /locus_tag="NATL1_00441"
FT   CDS_pept        complement(46962..48923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00441"
FT                   /product="Hypothetical protein"
FT                   /note="COG2226 Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74608"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZE8"
FT                   /protein_id="ABM74608.1"
FT                   /translation="MDSPSQKGAGKKKINEVKTFPVPFPLEKNQGNLTINSKSPSKPSK
FT                   EQIISQAIRFHEQGKIIEATKYYQYCLNHDFNDPIVFLNYGTILRSIGKLKKAEIFIRK
FT                   AINIDPNLQDVHFKLGVVLNELNRPKEAIKYFLYESYTSLDNTKKSFYISNFLSENYQT
FT                   IFDKEDIKYLLNILIKKDNISHDILFNIFNQLYDLEKILDDKEKKLLLHDQLISKSLER
FT                   MIFTSQRWENFLRKIREEICSILANGSRVLINSESNFLISLAHQCFINEYVYYCTNKEL
FT                   NYIKIIINKMNKGEKNKDLIFVLACYYPLYKLIELIPCIKSFKSTEIKINNLLKLQIGD
FT                   RKQEIELSKRLKKLGNINDEISKKVMTQYENRPFPSWRNIFDIDKLKKYADQKINDEIN
FT                   PNIISPNFKSKKLKVLIAGCGTGQQVLLAKEYKNSEITGIELSSSSLSYAQRKFNELGI
FT                   NNIKLIQMDILELSLLKEKFDLIESIGVLHHMKSPEEGLKALLEVLKINGFLKLGLYSK
FT                   KARGTIQAARDYIESRNIEVNEKNIRKFRMSIFNGDLPEFKSFIQEPLFYTVSGVEDLC
FT                   FHTQEWQFNLFEIQQMIETNKLDFKGFLLPQSIKSLYAKYFPEDKTQTNLQNWARFEEK
FT                   HPSTFAGMYNFWVSKTKI"
FT   gene            complement(49387..49563)
FT                   /locus_tag="NATL1_00451"
FT   CDS_pept        complement(49387..49563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00451"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74609"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZE9"
FT                   /protein_id="ABM74609.1"
FT                   /translation="MIRKKSSTKQAISESMIRAESKFLALKLIRIKFISLEKDFYDVVQ
FT                   IRITRINMNKTEK"
FT   gene            49619..50356
FT                   /locus_tag="NATL1_00461"
FT   CDS_pept        49619..50356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00461"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74610"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZF0"
FT                   /protein_id="ABM74610.1"
FT                   /translation="MDQMSFEVTYNGDIQYIKVFYSTEKTRAGKYYGEFYKKMDALASD
FT                   LKRLKQELDEDCEKAAKIAKDAANKALSERFGSLRYIIDEHLWDQDIVISKILDDRKEE
FT                   MLALAQKTFNNEVLLEEDGAEEYKIHLDEGGIEVDGKSVETSIMEFFDSDDYHESNEAK
FT                   LEKLEKLDWFIIWSRTEAGEFRTEGGQHEGNYSSKELNMEDCLLTYRDLPLVIPSNGTD
FT                   IFSNELEIHFVDETRASLEMSES"
FT   gene            50712..51509
FT                   /locus_tag="NATL1_00471"
FT   CDS_pept        50712..51509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00471"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74611"
FT                   /db_xref="GOA:A2BZF1"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZF1"
FT                   /protein_id="ABM74611.1"
FT                   /translation="MNELRLRIYKQLKNDSPEGRTSVFNKICGVTIFISIFFAVIVTEN
FT                   SIDYQFGDQIDLLDWIIGGWFCVEYLCRLWVAPLEKKYGQGWKGVFRYVISPMSIIDVI
FT                   AIVPSFFGVRAELKILRIIRLLRILKIGRSEKFKQSIFHFNYALRSKSQELQISTFYTV
FT                   LLLLISSTFMYLAESSIQPGLLGSIPRCLWWSITTVSAVGYGDSIPVTAFGKIIASITS
FT                   LMGIAAIAIPTGILASGFSESIGVQAKNQNVSNGIQGPSSNTG"
FT   gene            51725..52087
FT                   /locus_tag="NATL1_00481"
FT   CDS_pept        51725..52087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00481"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74612"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZF2"
FT                   /protein_id="ABM74612.1"
FT                   /translation="MDEAWLKELNKKNLFPQGEDDSKSDFATVTLSSSVLDKLSQEEQS
FT                   KFQMTDFKRATNEIEHWARIEEICEFFGVDDPDLAGDIYVRKFKNLTLNDEIKWMELRD
FT                   ISEDIPEGFGVKVDWG"
FT   gene            complement(52308..52700)
FT                   /locus_tag="NATL1_00491"
FT   CDS_pept        complement(52308..52700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00491"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74613"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZF3"
FT                   /protein_id="ABM74613.1"
FT                   /translation="MHLKTIKSICLSYLAFLIIFYPPKIDALSHKWIAVPKSQYGEQLW
FT                   DQNSIEKNSNGFIRILSKFVPKSTTDITQDILYTMEINCSETTFRDIAVGANKFNEFEN
FT                   KDSEWKEPNGDKLILGVINQVCVFIN"
FT   gene            complement(53061..53321)
FT                   /locus_tag="NATL1_00501"
FT   CDS_pept        complement(53061..53321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74614"
FT                   /db_xref="GOA:Q0GPM0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GPM0"
FT                   /protein_id="ABM74614.1"
FT                   /translation="MRLTNLQMSEENKTAKKKCGGKGKAMFAYGIIQLGSSVVSALALT
FT                   AIALSFCSLKQESKVFNECVEEIQSTGKSSSDAVRFCNGGK"
FT   gene            complement(53773..54090)
FT                   /locus_tag="NATL1_00511"
FT   CDS_pept        complement(53773..54090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00511"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74615"
FT                   /db_xref="GOA:A2BZF5"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZF5"
FT                   /protein_id="ABM74615.1"
FT                   /translation="MLRKQEKNAVTRGVILAIGWGWGLDRFYEGDKKGGILSIIGWGIV
FT                   FTSFLYLKCSGIEYVDGVKDYSSYSPNPLIVLPLIAGLYGIYLILRKGFRLAKQFENAE
FT                   D"
FT   gene            54398..55009
FT                   /locus_tag="NATL1_00521"
FT   CDS_pept        54398..55009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74616"
FT                   /db_xref="GOA:A2BZF6"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZF6"
FT                   /protein_id="ABM74616.1"
FT                   /translation="MTVAHQTDSHLSRRLQKDSITISGKVIYINPFLYWRRFDNNTDRW
FT                   LREPGQLTEEQINLNRARFYPEVEWTFLRDEERVIKDAAVEMFLKTLELISTFHPHLTA
FT                   GQLLEVERKMAVTKKKSFERWVEKSFRKKINQASKERNRFARERLIRGWKEWLTLETTH
FT                   QAFLPFAAIIVISIFAGWSIGISNNSCTPYFPTTETGILK"
FT   gene            55026..55400
FT                   /locus_tag="NATL1_00531"
FT   CDS_pept        55026..55400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00531"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74617"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZF7"
FT                   /protein_id="ABM74617.1"
FT                   /translation="MAKDQLRDFHLFAMESALPFGIGIIKNAKTGGFQKIMDVIKLKDP
FT                   FSEFQADGETSAKKVRDKIDQLIPGLGYPVVSVDVTVEENYPDYESNDTDSLVSTLNRI
FT                   DRDLDQLRRMISNDSLNIHD"
FT   gene            55423..57252
FT                   /locus_tag="NATL1_00541"
FT   CDS_pept        55423..57252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00541"
FT                   /product="Putative penicillin-binding protein"
FT                   /note="COG768 Cell division protein FtsI/penicillin-binding
FT                   protein 2 [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74618"
FT                   /db_xref="GOA:A2BZF8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZF8"
FT                   /protein_id="ABM74618.1"
FT                   /translation="MKKKEKLHLSSKKHVGAFNQPLIFFLFICLIFSVTVGRLFWIQII
FT                   RGSYYKKLSVENRVKLIANPPIRGRLLDRNGVVLADNKLFYSLAIQPRLLTKSEWIDLR
FT                   NSLSDLLNVSTDQLDIAFNRSNSDTPYKKVLLTDLSVEQVIRFKEQENNLYGAQIDIGL
FT                   IRNYPYKSLAAHTLGYTQLITQNEFSKLSERGYKLSDRIGRKGIEAAFESQLRGAWGGE
FT                   MLEIDSIGTVQRSLGLKLPKAGRDIKLTLDLELQLTAEKVLSDKIAGAIVAIDPYTGAI
FT                   RAIASQPTFDLNFFSQPFTNKQYNDLFLSSNLPLLSRAFNAYDPGSTWKPITAIAGMES
FT                   GKFPASKKLNTVPCITYGSHCFPEYNKRGFGWIGYEDAFRVSSNTFFYQVGVGSGSKAL
FT                   YDAATKLGFDNYTGIETFIDENKGLVGNKKWAAEGRGWGNPGETPWIVEDMASASIGQS
FT                   VVLVTPLQLARAYAVFANGGYLITPHLVDANINWRSEKYLKKVDIEDKTLETIRRGLRK
FT                   VVTSGTGIGINLDNSILPPVAGKTGTAEDSSGGADHAWFAGFAPYDSGKIVIVAFAQNT
FT                   PGGGSVHALPMARKVLRAWYEQKSKNELIRSKD"
FT   gene            complement(57261..57785)
FT                   /locus_tag="NATL1_00551"
FT   CDS_pept        complement(57261..57785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00551"
FT                   /product="possible reductase"
FT                   /note="COG431 Predicted flavoprotein [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74619"
FT                   /db_xref="GOA:A2BZF9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZF9"
FT                   /protein_id="ABM74619.1"
FT                   /translation="MSNKKLLVITASNGENLKLAKRFLVAGKELNYSCELLDLTESKND
FT                   LPIFNPRNNSKDKAPENLKSINTEMESHSHWVICAPEYNGSIPPILTNAIAWLSVQGTD
FT                   FRSLFNERPIAIASFSGGGCMELLLSMRIQLTHLGALVLGRQLATNKSKVAEDKSINAI
FT                   LNQLLQLNHPN"
FT   gene            complement(57836..59338)
FT                   /locus_tag="NATL1_00561"
FT   CDS_pept        complement(57836..59338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00561"
FT                   /product="flavoprotein"
FT                   /note="COG426 Uncharacterized flavoproteins [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74620"
FT                   /db_xref="GOA:A2BZG0"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZG0"
FT                   /protein_id="ABM74620.1"
FT                   /translation="MNVKYKNLTVICSNPGAKLFKEIWNLRKPSQNTNPKEALETVEVL
FT                   PNIQIIKQLETHTLNSNFEVTYIPAPTARWPGGLIVFEKQTGLLMSDKLFGAHVYEEKW
FT                   AELTSSSTEEERRHYFDCLMAPMSTQVNSIIEKFEDFEIDTIVPGHGPAISGSWRSLLN
FT                   NYQSWGESQKYSNLRVALLFASAYGNTAAIADAIARGISKTGVNVKIINCEFTASDSLV
FT                   TEIRKADGYLIGSPTLGGHAPTPIVSALGSLLAEGDRGKPAGVFGSYGWSGEALDLLEK
FT                   KLKDGGFKFGFEPIKIKFSPDPLMIKKLEETGIQFGKQLINAKLRQQRKANVGLNTSKS
FT                   DPTINALGRVVGSLCILTAQKGDEDNLISGAMVASWVSQASFSPPGITIAVAKERAVEN
FT                   LLHTGDNFALNILEQNNHQSLLKQFLQSFKPGDNRFTNLEIKLSPSNQPLLNEALAWLE
FT                   GTVSQRMECGDHWLIYAEIKYGKVIKKDGVTAVHHRKTGANY"
FT   gene            complement(59689..61467)
FT                   /locus_tag="NATL1_00571"
FT   CDS_pept        complement(59689..61467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00571"
FT                   /product="flavoprotein"
FT                   /note="COG426 Uncharacterized flavoproteins [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74621"
FT                   /db_xref="GOA:A2BZG1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZG1"
FT                   /protein_id="ABM74621.1"
FT                   /translation="MIFTKSTALENQKSDTPPKLSLQYEQIATDTHTLRSLDWDRSRFD
FT                   IEFGLRNGTTYNSFLIRGKKTALIDTSHLKFKDIWFEKLRQEINPTDIDYLIVSHTEPD
FT                   HSGLIKYLIELNPNIEIVASKVAIKFLEDQIHQPFKSRAVKSGEELNLEFNSISGIEHR
FT                   IEFISAPNLHWPDTIFSFDHGTQVIYTCDAFGLHYCSEKLYDENPSLLNEDFRFYYDCL
FT                   MGPNARSVVQALKKIDSLSTIQTIGVGHGPILNFNTQLWLNHYREWSKQKSTGENYAVV
FT                   CYLSQYGFCDRLSQAIAHGIGKANAQVQLVDLIASDTQELSALISEASAVVVPTWPIKS
FT                   DSELQSNIGTLLASLKQKQWVATYDSYGGNEEPIDFITNQLRKLGQKEAFKPLRVRDEP
FT                   NKSVYQQFEEAGTDLGQILTRKKNLAATKSLDGDLNKALGCLSGGLYIVTAKDNEGADS
FT                   RDGAMVASWVSQASFDPPGITVAVAKDRAIESLLQVNDRFVLNILQENNYLHLFRHFLK
FT                   RFPPGANRFKGVELMNDLAAGGPVLSDALAFLSCKVIQRMETTDHWIIYSSVEKGNLSN
FT                   TQSKTAVHHRRVGSNY"
FT   gene            61762..64422
FT                   /gene="alaS"
FT                   /locus_tag="NATL1_00581"
FT   CDS_pept        61762..64422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="NATL1_00581"
FT                   /product="Alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="COG13 Alanyl-tRNA synthetase [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74622"
FT                   /db_xref="GOA:A2BZG2"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZG2"
FT                   /protein_id="ABM74622.1"
FT                   /translation="MEKSSSSSINPPSLSGDEIREAFINFFVQHNHQKLASSSLIPDDP
FT                   TVLLTIAGMLPFKPIFLGLKESSTPRATSSQKCIRTNDIENVGRTARHHTFFEMLGNFS
FT                   FGDYFKKEAIQWAWELSTEVFRLNPQNIVISVFKEDLEAEQIWKEVVGVDANRIIRMGA
FT                   ADNFWSSGATGPCGPCSELYFDFKPELGSDEIDLEDDSRFIEFYNLVFMQYNRDLEGNL
FT                   EPLANCHIDTGMGLERMAQILQKKSNNYETDLIFPLIKAAALLAQLEYETTNKKNKTSL
FT                   KIIGDHCRAVTHLICDGVSASNLGRGYILRRLIRRMIRHGRLVGIVQPFLPQLAEMAIE
FT                   LMKNAYPQLLEKKKIILNELKIEESRFLETLERGEKLLAEITSHECDLISGAQAFELYD
FT                   TYGFPLELTEEIANEKGISVDINGFENEMAKQRKRAKEASVSIDLTEEGSIEREISLFD
FT                   ETRFEGYEKLETTSTVIGIFKNNESVKQAVQGDLVKIIVNRTPFYAESGGQIGDKGIIT
FT                   SQDLEVSVENVRKKKNIFIHSGIVNTGVLEINSSVQMNVTPSFRQRTTSNHTATHLLQS
FT                   ALKLSIDSSVSQRGSLVSNHRLRFDFNAPKPLTIKELEDMEVRINQWINEDHPIQIKTM
FT                   PIKEAMAAGALAMFGEKYGDVVRVVDVPGVSMELCGGTHVTRTSQLGTFKIINETGIAS
FT                   GIRRIEAIAGPSVLDYFNERDLVVKELSKSFKVQSYEIVERVSSLQLELKDKTKELIKV
FT                   KNDLALAKALGLASYAKSVGKSKLLIRRLDGVDGSGLQSAASSLIDHLGKYSAVIFGGI
FT                   PNQEIDNKLVFVAAFSPDLVSDGLHAGKFISGVAKMCGGGGGGRPNLAQAGGSQPQSLD
FT                   LALEKANENLTQQLS"
FT   gene            complement(64424..66367)
FT                   /gene="speA"
FT                   /locus_tag="NATL1_00591"
FT   CDS_pept        complement(64424..66367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="NATL1_00591"
FT                   /product="Orn/DAP/Arg decarboxylases family 2"
FT                   /EC_number="4.1.1.19"
FT                   /note="COG1166 Arginine decarboxylase (spermidine
FT                   biosynthesis) [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74623"
FT                   /db_xref="GOA:A2BZG3"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZG3"
FT                   /protein_id="ABM74623.1"
FT                   /translation="MAVKNTNQSLSWTIQNSSELYGIDRWGKGYFTINEKGNISICPNG
FT                   SKNKSHDLIELLDELESRKLKFPLLIRFDDILEDCLKNLHKAFEKAINDYQYEGKYQGV
FT                   FPIKCNQQRHVVEELITCGSKWNFGLEAGSKPELLIGLSILENPKALLICNGYKDQRYI
FT                   ETAILARQLGRQPIVVIEQANDVELIIKSSDLLGASPLIGIRAKLSSQSSGRWSSSIGD
FT                   KSKFGLSIPEILKTIKRLKEANLLNELKLLHFHLGSQINDIGVLKDALQEAGQIYAELI
FT                   NLGAPMGYLDVGGGLGIDYDGSQTASIASTNYSLQNYANDVVATIKECCESKKIPLPTL
FT                   ITESGRAIASHFSILIFNILGKNSLPSDIPKESEKECLSVRNLRDTLVHINSLELKQEE
FT                   DLAKLQEAWNDSLKFKADALAAFRLGYIDLVERAKAEQLTWACAKTIVNQLPKNILLPK
FT                   ELKKLSESLAVTYYANLSVFRSAPDTWAIDQVFPIMPIHRLRKEPKKLGHFADLTCDSD
FT                   GKLDQFIDNGKIKNLLPLHEFNQDEKYLIGLFLGGAYQEVMGNLHNLFGSTNAVHIRFT
FT                   ENGNYKVEHVIRGNTKSNVLEYLEHDPEILLERLRKSSELAIQGGHLKIHDAQKLIEHV
FT                   EASLRQSTYLQS"
FT   gene            66510..66965
FT                   /gene="ndk"
FT                   /locus_tag="NATL1_00601"
FT   CDS_pept        66510..66965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="NATL1_00601"
FT                   /product="Nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="COG105 Nucleoside diphosphate kinase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74624"
FT                   /db_xref="GOA:A2BZG4"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZG4"
FT                   /protein_id="ABM74624.1"
FT                   /translation="MTLERTFVAIKPDGVQRGLIAEILGRFETKGFKLVGLKQLTPSKE
FT                   LAEKHYGVHKDRPFFSGLVDFITSGPVVAMVWEGEGVIASARKLIGATKPLEAEPGTIR
FT                   GDLAVNIGRNVIHGSDGSDTAVFEINLWFQENELVDWNPSDQAWRVE"
FT   gene            complement(67001..68104)
FT                   /gene="dadA"
FT                   /locus_tag="NATL1_00611"
FT   CDS_pept        complement(67001..68104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /locus_tag="NATL1_00611"
FT                   /product="putative thiamine biosynthesis oxidoreductase"
FT                   /EC_number="1.4.3.19"
FT                   /EC_number="1.4.99.1"
FT                   /note="COG665 Glycine/D-amino acid oxidases (deaminating)
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74625"
FT                   /db_xref="GOA:A2BZG5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZG5"
FT                   /protein_id="ABM74625.1"
FT                   /translation="MGVLNEKPLLILGGGLMGLAIAHELAKRGKRVEVLSRSRREAAGF
FT                   VAAGMLAPHAEGLQGNLLNLGKSSLQRHSTWIENIETNSKMSCGLKTCGIVVPFESHKD
FT                   CESYPTYKFGKKLNRIELLQEVPRLSEKWKLGLLFKQDGQIDNRRLLMRALEKACFELG
FT                   VHFQEGVEVVEIMKGLNKFNGVKIKDINGNINHLKSEEAVLCCGAWSKQIFKTLPIFPV
FT                   KGQMLSIQGPKQILKRIVFGPGIYLVPRDDGLIIVGATSEPEAGFQTGLTPNGQSELQK
FT                   GIQSLIPELNQLPHMERWWGFRPCTPDEGPLLGMSSINGLWLATGHHRNGVLLAAITSE
FT                   LIGKSICSTPLSNEEDSLLSHFRWDRF"
FT   gene            68204..69679
FT                   /gene="gatB"
FT                   /locus_tag="NATL1_00621"
FT   CDS_pept        68204..69679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="NATL1_00621"
FT                   /product="Glutamyl-tRNA (Gln) amidotransferase subunit B"
FT                   /EC_number="6.3.5.7"
FT                   /note="COG64 Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog) [Translation, ribosomal structure
FT                   and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74626"
FT                   /db_xref="GOA:A2BZG6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZG6"
FT                   /protein_id="ABM74626.1"
FT                   /translation="MSESNVSWEVVIGLETHVQLGTKSKIFTSASTTFGDDPNTHIDPV
FT                   VCGLPGTLPVLNKKVLEYAVKAAMALNLNIASHSKFDRKQYFYPDLPKNYQISQFDEPI
FT                   AEDGWIEVEVAEKGKETYVKKIGIERLHMEEDAGKLVHAGSDQLSGSTHSLVDYNRAGV
FT                   ALAEIVSKPDLRTGREAAEYAAEVRRIMRYLGVSDGNMQEGSLRCDVNISVRPTINDPF
FT                   GTKVEIKNMNSFSAIQKACEYEIKRQIKAYESGEEVKQETRLWDEGKQLTKSMRSKEGS
FT                   SDYRYFPDPDLGPIEVSNELKEKWRSELPELPAAKRNRYSTELGLSIYDARVLTDESSM
FT                   ATYFEKVVNEGGAAKSSANWITGDLAAYINSNRLTFDQLHFQPSELAEMLKMIDTGEIS
FT                   GKIAKEILPELLSKGGSPKQLVQERGLGMIGDPKVIEEIIDQLILKHPNEVESFRSGKK
FT                   KLLGFFVGQLMKETKGKADPKLANQILNKKLQG"
FT   gene            complement(69676..70320)
FT                   /gene="coaE"
FT                   /locus_tag="NATL1_00631"
FT   CDS_pept        complement(69676..70320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="NATL1_00631"
FT                   /product="putative dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COG237 Dephospho-CoA kinase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74627"
FT                   /db_xref="GOA:A2BZG7"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZG7"
FT                   /protein_id="ABM74627.1"
FT                   /translation="MIDQKQTNNLCLRWKGKQRRIGITGGIASGKTIIGDFLFQAKQWP
FT                   ILDADLYAHEALSAESEIVKKVWLRYGSKIIKNSSKNDHIINRKALAKIVFQNEIEKKW
FT                   LEGIIHPFVNKRIEEELEKLKSNSIVILIIPLLFEKNYTGLCSEICYIDCTRSMQLKRL
FT                   QSRDHLSIKEANQRIDAQWANSLKKQFADHIINNSNDDETWKLQLKKLYKF"
FT   gene            70336..71598
FT                   /gene="argJ"
FT                   /locus_tag="NATL1_00641"
FT   CDS_pept        70336..71598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="NATL1_00641"
FT                   /product="ArgJ family"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /note="COG1364 N-acetylglutamate synthase
FT                   (N-acetylornithine aminotransferase) [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74628"
FT                   /db_xref="GOA:A2BZG8"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZG8"
FT                   /protein_id="ABM74628.1"
FT                   /translation="MKNALLNLSLLTSSVWSPISGGITAPDGFLAAGISAGLKPSGKKD
FT                   LALLYAPDGACCSGTFTQSVTRAYCVDLCIDRIKASEGKIRAVVINSGHANACTGSRGK
FT                   IDSEMITHKLAQRLRLSSEEVLICSTGVIGEAIPVEKVNSHLDQLINSLDKEAYLDAAN
FT                   AILTTDLQVKQIAYQAVLGGRRISIGGMAKGSGMIHPSMATMLSYLTCDVGVDHALWSD
FT                   MIKRVAESSFNSITVDGDTSTNDTFLAFASGAELDPRYLSILEEGLHLTAQHLAKAIAR
FT                   DGEGANCLLEIKVEGASSDLDARAIARTIASSSLVKTAVNGADPNWGRIIAALGRAGTS
FT                   FNFNDVKLWIGPYEIFSNGTPLDFDRQIVSNFMKARLTGKYLIDDLISIRLRIGIGIGS
FT                   ATAWGCDLSDQYVRINADYTT"
FT   gene            71859..72950
FT                   /locus_tag="NATL1_00651"
FT   CDS_pept        71859..72950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00651"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74629"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZG9"
FT                   /protein_id="ABM74629.1"
FT                   /translation="MNFIDDNGNTKLSVEDNKIFAHYDNKKFGLCAYTISVPGYSDDIV
FT                   GWETDNKKSWPGIFVYDNGDYFKFYAEVFNNTGIIVFEGLDINNKVQRYQVYEFSLIDI
FT                   GVITKYFSQNPDGTFSSYFFTSSEYPEDEFILKPPDGSLSSWEALDTDPYYRTHGQGTY
FT                   TDFLKEYGQVINPASGDRKFFPAKSFDYQFFDLGNQEYGIRPDAGGTVDPLTGFSSIQF
FT                   IDKFMTIEADIIGVFDQVTGLNTDSGKMFRLYNAAFARFPDADGLRYWISNFSSGIDDE
FT                   RAVSSSFLASAEFKERYGENITHETYVENLYLNVLNRELDQGGYDYWVGNLNNGIEERH
FT                   EVLLGFSESVENKFLFTEMTGFG"
FT   gene            complement(73317..73907)
FT                   /locus_tag="NATL1_00661"
FT   CDS_pept        complement(73317..73907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00661"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74630"
FT                   /db_xref="GOA:A2BZH0"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZH0"
FT                   /protein_id="ABM74630.1"
FT                   /translation="MSLGITELELTDASTISIPTDAILILFLLIVFALIGYYFHNILDN
FT                   QTNQFVEKVDDSLHLELVKEKLEDQLTLESAKVNHEKTEKPNIKKLNFIPPSKFWGIGS
FT                   LAVVAIGGSSLLRIQSIQNSYKGVNTSQVNIKTENQSTKSLLSMAQIKSSNQSQTRIKK
FT                   ISYVDPLLSTNNSSKNNNFLQVQRRRTEDFFSF"
FT   gene            complement(74024..74356)
FT                   /locus_tag="NATL1_00671"
FT   CDS_pept        complement(74024..74356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00671"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74631"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZH1"
FT                   /protein_id="ABM74631.1"
FT                   /translation="MPVLIIGWKIYDRLPEDEQKEFALVERYRTDYFYECYEYENAKGN
FT                   KNYEWSDRCFKNQEELLEFFGYEMIEDLNLDAVYARKVETFTDEDEKELMKFCDDGNQI
FT                   KVMGAN"
FT   gene            complement(74344..74616)
FT                   /locus_tag="NATL1_00681"
FT   CDS_pept        complement(74344..74616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00681"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74632"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZH2"
FT                   /protein_id="ABM74632.1"
FT                   /translation="MKKPSTSGGQKSMTEKIDWKQELLDSEKFNRKQEKLLKIGAKSLT
FT                   DSWLLGALYIRWKKLKSIREQSSPDCSSNFQEWTKKIEDADICQS"
FT   gene            complement(74767..74946)
FT                   /locus_tag="NATL1_00691"
FT   CDS_pept        complement(74767..74946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00691"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74633"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZH3"
FT                   /protein_id="ABM74633.1"
FT                   /translation="MNSSFPTGRRSTMKVEVSCFVGGMVIKEIVHVDKFEDADKVAKSR
FT                   NPFCRVVNRKVLIK"
FT   gene            complement(75407..75850)
FT                   /gene="cynS"
FT                   /locus_tag="NATL1_00701"
FT   CDS_pept        complement(75407..75850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynS"
FT                   /locus_tag="NATL1_00701"
FT                   /product="Cyanate lyase"
FT                   /EC_number="4.2.1.104"
FT                   /note="COG1513 Cyanate lyase [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74634"
FT                   /db_xref="GOA:A2BZH4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZH4"
FT                   /protein_id="ABM74634.1"
FT                   /translation="MSFPESTQLLLKAKKEKGLTFADIGILLGLDEVWVASLFYGQSTA
FT                   SDEEADKLLTTLGLGTEHKEILTTPPVKGSLDPVIPTDPLIYRFYEIMQVYGMPMKDVI
FT                   QEKFGDGIMSAIDFTINVDKVEDPKGDRVKVSMCGKFLPYKKW"
FT   gene            complement(76076..76231)
FT                   /locus_tag="NATL1_00711"
FT   CDS_pept        complement(76076..76231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00711"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74635"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZH5"
FT                   /protein_id="ABM74635.1"
FT                   /translation="MSDSSSEMTPQEKIIQDRVNQSRSFLRLNGFNQSLGDLWREIKED
FT                   SKYDLL"
FT   gene            complement(76877..77044)
FT                   /locus_tag="NATL1_00721"
FT   CDS_pept        complement(76877..77044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00721"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74636"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZH6"
FT                   /protein_id="ABM74636.1"
FT                   /translation="MITEEKKRREEKRREAFKFNADLSDQEIRSIRASAQGMTTHQYEL
FT                   FLREIGIRFK"
FT   gene            77837..80287
FT                   /locus_tag="NATL1_00731"
FT   CDS_pept        77837..80287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00731"
FT                   /product="Hypothetical protein"
FT                   /note="COG3914 Predicted O-linked N-acetylglucosamine
FT                   transferase, SPINDLY family [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74637"
FT                   /db_xref="GOA:A2BZH7"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZH7"
FT                   /protein_id="ABM74637.1"
FT                   /translation="MGGQEEKKKVTEVKTFPVPFALGEIKENITINTNISSKLSELSKG
FT                   QIINQAIQFHAQGNIQKAAKYYQYFIDQGFKDPRVLANYGVILKGFGNSQEAELLYRKA
FT                   IELNPNFADAHYNLGNTLRDLGKLKEAELSYRKAIEISPNYANTLYNLGTILSDLGKLQ
FT                   DAEFSYRQAIIINPNYTEAHYNLGNTLRDLGKLKDAELSYRKAIKISPNYAKVHCNLGT
FT                   ILRDLGKLKDAELYTRKAIQLNPDFAEAYSNLGNILSDLGNLKEAEISQKKTIELKPDC
FT                   AEAHSNLGNILRDLGKLKDAELSYRKAIEISPNYANAHSNLGNILRDLGKLKGAELSYR
FT                   KAIEISPNYANAHYNLGNILKDIGNFGDALKQFKQALKLNNELSLAKYALIITKGKICD
FT                   WSDEVTHNIWLKSLGIQGKSIEPLGLFPLEDNPSNHLKRSKNYYIENFTRPSKCIQSYE
FT                   KNIIHIGYFSADFRTHPVMQMLAPLIEIHDKSRFKIYLYSLAKKEDEYTERAKMSGCIF
FT                   KNITELNDIEAVELARSDKLDIAVDLMGYTRNNRMPIFSYRVAPIQINYLGFPGSTGSD
FT                   TIDYIIGDNITIPRENEKFYTEKIIRMPNCFLCDDNKKEISKESICRKDFNLPDQGFIF
FT                   TCFNENYKITKKEFNIWMNLLIKIEGSVLWLYKSNQCSMNNLYKEARKRKVNPDRLIFA
FT                   ERLAMNKHLPRHSLGDLALDTFNYNGGATTSCALLAGLPVLTKIGQSFMARVSASLLSS
FT                   IGLSELITYSESEYEEKALYIANNPKEILRLKSKLNKLKETSTLFNSELFTRDLESKFI
FT                   ELVK"
FT   gene            complement(80488..80604)
FT                   /locus_tag="NATL1_00741"
FT   CDS_pept        complement(80488..80604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00741"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74638"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZH8"
FT                   /protein_id="ABM74638.1"
FT                   /translation="MKVLPNDMGKAKERIKHGFVQACRGDPLARLADERKFI"
FT   gene            complement(81003..81620)
FT                   /locus_tag="NATL1_00751"
FT   CDS_pept        complement(81003..81620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00751"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74639"
FT                   /db_xref="GOA:A2BZH9"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZH9"
FT                   /protein_id="ABM74639.1"
FT                   /translation="MKLRNTAIALGIGAATATGLSLLQVNKDLVVGSTAVVVGAGLMIS
FT                   LKDKNDINLKARNYEYFFNRAQDKFELADYEEAILDYNKALELSPTEICLVYSMRGNAK
FT                   RNSGDFDGAISDQNKALDFDPLYADGYFNRGIAKFKKGDFDGAIQDYSQVLKINPKDSD
FT                   AFFNRANVKKEIDDMKGACEDWRTAADLGDDDAKKFLRENCE"
FT   gene            complement(81623..82090)
FT                   /locus_tag="NATL1_00761"
FT   CDS_pept        complement(81623..82090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00761"
FT                   /product="Hypothetical protein"
FT                   /note="COG1525 Micrococcal nuclease (thermonuclease)
FT                   homologs [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74640"
FT                   /db_xref="GOA:A2BZI0"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZI0"
FT                   /protein_id="ABM74640.1"
FT                   /translation="MPTKKLNSEQRFIRNLLIGFFSALFIVFVLAMIALFQTLTTYPSA
FT                   PDLPSVTIQSCYDGDTCTTTDGEKIRLACIDSPELRGKKADPTPAKAARDYLNDLVAGS
FT                   TVTIRRITEDRYGRTVAELSKGPMNIQEHLVEKGIASIYERYSSQCEWSMN"
FT   gene            complement(82065..82223)
FT                   /locus_tag="NATL1_00771"
FT   CDS_pept        complement(82065..82223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00771"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74641"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZI1"
FT                   /protein_id="ABM74641.1"
FT                   /translation="MDWVKLGSQSLNFRFPLWLNPIPSFWPRTLKKIRSPKKRKRLNKN
FT                   ANKKAEL"
FT   gene            complement(82281..82487)
FT                   /locus_tag="NATL1_00781"
FT   CDS_pept        complement(82281..82487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00781"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74642"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZI2"
FT                   /protein_id="ABM74642.1"
FT                   /translation="MDSANQIQALVEEVEKNPEYKISEQEAKGFLSEIKRLTKEDKTNM
FT                   PPLVVIIMAYINMLFPELDEVKA"
FT   gene            complement(82661..82825)
FT                   /locus_tag="NATL1_00791"
FT   CDS_pept        complement(82661..82825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00791"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74643"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZI3"
FT                   /protein_id="ABM74643.1"
FT                   /translation="MSHFQFTDEQFIEIREIWRDINSQCKLLQEQTGCPDSEIVKMIDS
FT                   AKSYWENKS"
FT   gene            83024..83197
FT                   /locus_tag="NATL1_00801"
FT   CDS_pept        83024..83197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00801"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74644"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZI4"
FT                   /protein_id="ABM74644.1"
FT                   /translation="MKKFIPYLLFSATTLHTVLGVSPVMAMGCSSHSDKAEVVCEEGDT
FT                   DCEEKISASTIN"
FT   gene            complement(83362..83481)
FT                   /locus_tag="NATL1_00811"
FT   CDS_pept        complement(83362..83481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00811"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74645"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZI5"
FT                   /protein_id="ABM74645.1"
FT                   /translation="MKYIQEHYFHYKADESTEILGKGRKIKPAEDSLRWIGSS"
FT   gene            complement(83679..83798)
FT                   /locus_tag="NATL1_00821"
FT   CDS_pept        complement(83679..83798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00821"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74646"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZI6"
FT                   /protein_id="ABM74646.1"
FT                   /translation="MPPPLQSDTNHLGAGGIFELDLGDSEMPLRPKQEREQKL"
FT   gene            complement(83844..85352)
FT                   /locus_tag="NATL1_00831"
FT   CDS_pept        complement(83844..85352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00831"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74647"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZI7"
FT                   /protein_id="ABM74647.1"
FT                   /translation="MTWSLANIEQLSVSGTNALGVSSHLEINQGDSNDKYQLYYTGDGG
FT                   VTVNSMSTDLELTKQGEIKLIQDLTIITTNEGIRRAYYVEVDPNTGNHEILTALLSEDG
FT                   LTLSQATRTGILDNGDNAWGVPDSVVLPDGRIRIYWVSTDNTDSEWTVPQDDEIIKNDG
FT                   FKTPNGEWVSANEYFENDRKIPDSATKTLANEVILSATSDTSKGTEFTVDEGYRTEGGY
FT                   VDFEVLKAKENDWLAIMSSSPVTIPDEPQGIYIGISSDGLSWEIDDNNLAPLERSYLDP
FT                   TGLLLSNTPNKYQIVMSSSLSILGDREYTLVTAELTSATTTYLGNSFDYNFFNIGNGVY
FT                   GIRPDSTGTIDSLTGISNIQFDDKKLNITSDIKATFDQVTGLNTDSGEMFRLYNAAFAR
FT                   FPDADGLKYWIEQFSSGKNTRRVVAQSFLGSAEFTEKYGSNVSDETYVNNLYKNVLGRD
FT                   ADAEGLNYWVGNLSNGIETRYEALLGFSESEENKALFTEMTGFG"
FT   gene            complement(85539..90293)
FT                   /locus_tag="NATL1_00841"
FT   CDS_pept        complement(85539..90293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00841"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74648"
FT                   /db_xref="GOA:A2BZI8"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR040384"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZI8"
FT                   /protein_id="ABM74648.1"
FT                   /translation="MTFSPGPATEAAPAGDPAPVAEAAPAGDPAPVAEAAPAGDPAPVA
FT                   EAAPVSDAAAEAAAADPDAAAAAAAPVGDAAPVGDDSSPNDEGPTEDAPSLGPKGDEPP
FT                   TGDVAPDQSGDPAPTGDDSSPVDEGPTEDAPSLGPKGDEPPTGDVAPDQSGDPAPTGDD
FT                   SSPVDEGPTEDAPSLGPKGDEPPTGDVAPDQSGDPAPTGDDSSPVDEGPTEDAPSLGPK
FT                   GDEPPTGDVAPDQSGDPAPTGDAATAPVSDAVAEAAAADPDAAAAAAAPVPPPAEIGGV
FT                   APSELAKDDIANLDSDVIEDLKEDQVAALDATAVGGFKEDQVAALDATAVGGFKEDQVA
FT                   ALDATAVGGFQEDQIAALDATAVGGFQEDQVAALDATAVGGFQEDQIAALDATAVGGFQ
FT                   EDQIAALDATAVGGFQEDQIAALDATAVGGFQEDQVAALDATAVGGFQEDQVAALDATA
FT                   VGGFQEDQIAALDATAVGGFQEDQIAALDATAVGGFQEDQIAALDATAVGGFQEDQVAA
FT                   LDATAVGGFQEDQIAALDATAVGGFQEDQIAALDATAVGGFQEDQIAALDATAVAGFDE
FT                   THVAAFDPLAVAGFDETHVAAFDPTAVAGFDETHVAAFDPLAVAGFDETHVAAFDPLAV
FT                   AGFDEKHIAAIDTQAITGFNADHVAALDAQAMTGLAKDQFVAFEPTAMAGFNADHIAAI
FT                   DHSYMTGLGKDHVAGFDPTAVAGFDEAHVAAFDPLAVAGFDETHFAAFDPLAVAGFDET
FT                   HVAAFDPLAVAGFDETHVAAFDPTAVAGFDETHVAAFDPLAVAGFDEKHIAAIDTQAIT
FT                   GFNADHVAALDAQAMTGLAKDQFVAFEPTAMAGFNADHIAAIDHSYMTGLGKDHVAGFD
FT                   PTAVAGFDEAHVAAFDPLAVAGFDETHFAAFDPTAVAGFDETHVAAFDPTAVAGFDETH
FT                   VAAFDPLAVAGFDETHVAAFEISAMEGFNPTHVASFNPEAMAGFKGTQLKELDPESFAA
FT                   LTTEQAAEMTPDAAAAFKNWVLPDDDIIRWEGGLRGPDGEWMSSDIYFDKRTTGDIPAE
FT                   TTVWTPPEVDIIAKGGGFTKADGTFVEEDDYFKDPTSAGWTVPPDDLIKKDGGFRNPNG
FT                   KWVTAKEFINNTGEIPETDEIKKNGGYFDADKQWVSSISHFGEGSDEVQNVAWIPPETT
FT                   EINTDGGFWDPFGQWVTSEDYEKEGWKAPEDTVKPVVPEGITAEEIKIEGGYTATDGSW
FT                   VTDASFFDTTLDNEVNKVAGYWGATKDPIKEAALIGSEEDTLVDPTEVELEKKLISDVA
FT                   YPWKDIKDLKGSTATENSDSTSHWATLVKSKEDGDDRLEGGESSDKIFGGLGSDFIDGG
FT                   EGEDIAFYAGNFEDYKFDRTKDTVSLEDQREGLNDGNDVLKNVEYIQFADQKVDVSKLD
FT                   IVKTYTGESKDFKFYKRDDGSIEVKTEDGFDDITGVPKLEFDDKTFSGISDIEETFNQV
FT                   TSKDDETGQMFRVYNAAFARFPDADGLEYWIDKNQSGENSNRQVADSFLGSEEFKETYG
FT                   EDVDTGTYVNTLYKNILGREADQEGYNYWVTQLDSGQENRGELLLGFAESVENKALFSE
FT                   VTGLF"
FT   gene            complement(90819..91400)
FT                   /locus_tag="NATL1_00851"
FT   CDS_pept        complement(90819..91400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00851"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74649"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZI9"
FT                   /protein_id="ABM74649.1"
FT                   /translation="MTESIENKYDFKDQLYDIHLIQFADQIVEESKVDVIKNFSGSFSD
FT                   YKFYNKGDNTYQIKTKSGYEDITGFPTLNFSDKTISAIIDVQGTFDQITGLNTDSGEMF
FT                   RLYNTAFARFPDADCLEYWIGNFSSGIDDERALSSSLLASAEFKERYGDNITHETYVQN
FT                   LYLNVLNRKLDQGGYDYWVGNLNNGIEQPH"
FT   gene            91613..91786
FT                   /locus_tag="NATL1_00861"
FT   CDS_pept        91613..91786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00861"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74650"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZJ0"
FT                   /protein_id="ABM74650.1"
FT                   /translation="MIYKIIRQDKESDDITVQSFHCYDEAYDLLEEIYSDVCCSDADYG
FT                   DRPYYEIIEVEE"
FT   gene            91924..92130
FT                   /locus_tag="NATL1_00871"
FT   CDS_pept        91924..92130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00871"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74651"
FT                   /db_xref="GOA:A2BZJ1"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZJ1"
FT                   /protein_id="ABM74651.1"
FT                   /translation="MFKQEDLLEYLSSPEGINNIIVGIILVGAMNAIFITYSVRRTYGA
FT                   AKKEREQLKIQQAKIDKLFPKED"
FT   gene            92348..92512
FT                   /locus_tag="NATL1_00881"
FT   CDS_pept        92348..92512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00881"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74652"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZJ2"
FT                   /protein_id="ABM74652.1"
FT                   /translation="MKFIFLIVIVCGFTFPSARITLAALLEGSSDYLYESAMQEKSFIP
FT                   YWLKKLRND"
FT   gene            92942..93118
FT                   /locus_tag="NATL1_00891"
FT   CDS_pept        92942..93118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00891"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74653"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZJ3"
FT                   /protein_id="ABM74653.1"
FT                   /translation="MSNSQDIEELIADSMTGLMIRAERLDEFDQLAISEEFREWLNEGV
FT                   RVEDVLKVVSIKE"
FT   gene            complement(93140..93349)
FT                   /locus_tag="NATL1_00901"
FT   CDS_pept        complement(93140..93349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00901"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74654"
FT                   /db_xref="GOA:A2BZJ4"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZJ4"
FT                   /protein_id="ABM74654.1"
FT                   /translation="MLVEFYILVIPFCVIPVFLVSLDYLNKSTELKRSNYNVIDFDKFV
FT                   KCKEEGDDVDIDIAKLLDIDQIAA"
FT   gene            complement(93549..93695)
FT                   /locus_tag="NATL1_00911"
FT   CDS_pept        complement(93549..93695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00911"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74655"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZJ5"
FT                   /protein_id="ABM74655.1"
FT                   /translation="MINLDRSRIELTESQLLTIKDRIKSWSTKDQVIEIMRYRYGRLED
FT                   QAA"
FT   gene            complement(93949..94284)
FT                   /locus_tag="NATL1_00921"
FT   CDS_pept        complement(93949..94284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00921"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74656"
FT                   /db_xref="GOA:A2BZJ6"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZJ6"
FT                   /protein_id="ABM74656.1"
FT                   /translation="MTPDLPIIPTSKIKKKKLEKTRIHKWTLFSLCFITTLVVVSLIKA
FT                   YLPLLVSALAMLFVWSQMTKPIAEIETKSTNDDTNQLDLFHRQYKIGRKYSKITRELHE
FT                   KKDSKVA"
FT   gene            complement(94898..95428)
FT                   /locus_tag="NATL1_00931"
FT   CDS_pept        complement(94898..95428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00931"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74657"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZJ7"
FT                   /protein_id="ABM74657.1"
FT                   /translation="MQLKSLDGCRLAIGKYPSFSYNAYGGGGEAELLPNQKSNLLHIRF
FT                   SSKTFSIPPLTSKSTKFLSLPLPPGFKIEMYMEQLEGTIDKNSGEVLLRFESKFLFSIG
FT                   AMLKFPKLIVKTLLTSGKVKGKLHEGEGYVLQDNGTIKLVGISMIPKTGNKILDIFLGL
FT                   PNEALAELKCEIK"
FT   gene            95777..96094
FT                   /locus_tag="NATL1_00941"
FT   CDS_pept        95777..96094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00941"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74658"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZJ8"
FT                   /protein_id="ABM74658.1"
FT                   /translation="MVLMPDSLTPDWSSEFEHYKKLSREVVTNEDIINFFNKNQKAFYL
FT                   DSFSSSWAKMMEAYEVEESLSSDQLNNLEEMQWQEMPDSLKLFAYNFCIKNGFCYTGTS
FT                   I"
FT   gene            complement(96195..96407)
FT                   /locus_tag="NATL1_00951"
FT   CDS_pept        complement(96195..96407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00951"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74659"
FT                   /db_xref="GOA:A2BZJ9"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZJ9"
FT                   /protein_id="ABM74659.1"
FT                   /translation="MNINTIFLLLLVIAAYLNLYLTFNKRKQKKKTKLPISSKEWREKV
FT                   EDENFKSWLSNRERLKDKRKEYIDQ"
FT   gene            complement(96518..96760)
FT                   /locus_tag="NATL1_00961"
FT   CDS_pept        complement(96518..96760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00961"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74660"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZK0"
FT                   /protein_id="ABM74660.1"
FT                   /translation="MASSFLASAEFKERYGEDVSNESYVNTLYINVLGRDYDQAGYNYW
FT                   LGNLNNGVETKYELLLGFSESVENKGLFSEMTGLE"
FT   gene            97207..97602
FT                   /locus_tag="NATL1_00971"
FT   CDS_pept        97207..97602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00971"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74661"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZK1"
FT                   /protein_id="ABM74661.1"
FT                   /translation="MKIIKKDSFIVILIGFLVIFFLQTPILQALEFDLTAAQNTVGKRF
FT                   ASKFCEAKEKGFSTESSSEFALNNTYLKFVAFPEDERFIEDLWEYTIGIIRKDCGQYVT
FT                   DDEKTILRDFFKEEGEIASNRDLYLPY"
FT   gene            97602..98717
FT                   /locus_tag="NATL1_00981"
FT   CDS_pept        97602..98717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00981"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74662"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZK2"
FT                   /protein_id="ABM74662.1"
FT                   /translation="MTNIYDFIVIGAGISACTFASLLNKRFPDLSILLVEHGRRIGGRA
FT                   TTRKSRKNRILEFDHGLPSINFRERISEDILELVSPLINSGKLVDISKDILLINEFGIL
FT                   SNAFTNDIIYRSSPFMANFCEEIINQSNNPKKINFLFQTLTKSIKRINNLWEVKVNTGR
FT                   HIKSKNLILSSSLIAHPRCLNLLQINSLPLRDAFIPGKDKVVDALIKETRKLTYIIRKV
FT                   YIFHVSNLSLSQKFNYQYLQIIFANVIREDSNFERIIFQRQSDGSIIIALHCSCINNLP
FT                   EIKIDNITKSLISLFANYKIFLDLFLQATLIDKMDWRASQPLNHLLSKELQWSNSSKIG
FT                   FCGDWFDLNCSVGVESAMNSSLRLVNFVNRN"
FT   gene            98882..99154
FT                   /locus_tag="NATL1_00991"
FT   CDS_pept        98882..99154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_00991"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_00991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74663"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZK3"
FT                   /protein_id="ABM74663.1"
FT                   /translation="MITVIFLLALGLAGWTVSTLMSKGKHQEDITKELGNIFESLKFLT
FT                   SSITALVKLLMKDSIASAKDEDFQPISSNVIDLLKVENKDHKEAA"
FT   gene            complement(99218..99520)
FT                   /locus_tag="NATL1_01001"
FT   CDS_pept        complement(99218..99520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01001"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74664"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZK4"
FT                   /protein_id="ABM74664.1"
FT                   /translation="MLTTTSRLRIQEILTRLSMGKQVTLEERIYINKYATRNQNVSSWL
FT                   RKASRIQRQEKINNQIDELLNGLDLNSDEPHVTYNPDHDDLGEWFSGAPSWIRRS"
FT   gene            complement(99768..100130)
FT                   /locus_tag="NATL1_01011"
FT   CDS_pept        complement(99768..100130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01011"
FT                   /product="Hypothetical protein"
FT                   /note="COG3651 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74665"
FT                   /db_xref="InterPro:IPR018714"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZK5"
FT                   /protein_id="ABM74665.1"
FT                   /translation="MSQKNVLGTELKSCSCSPMTGWYRDGSCRTDISDQGMHTVCAVIT
FT                   EQFLSYSKAQGNDLSTPQIGFPGLKKGDHWCLCAPRWKEAFEDGMAPLIDLEATEERTL
FT                   KIIDLETLKKFSHDRQ"
FT   gene            100202..101989
FT                   /locus_tag="NATL1_01021"
FT   CDS_pept        100202..101989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01021"
FT                   /product="Hypothetical protein"
FT                   /note="COG652 Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) - cyclophilin family [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74666"
FT                   /db_xref="GOA:A2BZK6"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR025282"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZK6"
FT                   /protein_id="ABM74666.1"
FT                   /translation="MTAPLIQGASGMEGEKLTYASTNENNKEIYTFTANEPVTWSISGG
FT                   EKHLFSIDQDTGKLSFKDVPDYETIKSLNGTTVEFHTNFSTASVGSKFFVEVYNDQNQT
FT                   NKTTPITTNNFIEYVSDGSYDNTLIHRLVSDFVIQGGGYTWPSLASNESGGYPLTVKSK
FT                   GEIINEPINSNLMGTIAMAKVSGQPNSATSEWFINLSDNINLDSQNEGFSVFGHLLGDS
FT                   INNPLLLNNQTKYNVNFSDVGLNIPELPLINLQGNVINIANYFAIHKVSTISQRPSEIE
FT                   NVFNVIVTANDSLGNQSNQYVVVNVKDIQGEVLDGIDGPDVLKGGLGNDTFKGNGGNDT
FT                   IDGGSDFDIATYSGNFSDYTFTIANKVVTISDNRLSENDGIDTLSNIEKLTFVDKNALI
FT                   TSKEIKAIDVLGFQAEKVYSGKSDSYKFYDLGGNNYGVGTSTGIDQLTGESILKFDDKN
FT                   MNLKHDIKATFDQVTGLDTDSGKMFRLYNASFKRLPDPDGLRYWISNFSSGKDDERAVA
FT                   SSFLASAEFKERYGEDVSNESYVNTLYINVLGRDYDQAGYNYWLGNLNNGVETKYELLL
FT                   GFSESVENKGLFSEMTGFY"
FT   gene            102312..102419
FT                   /locus_tag="NATL1_01031"
FT   CDS_pept        102312..102419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01031"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74667"
FT                   /db_xref="GOA:A2BZK7"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZK7"
FT                   /protein_id="ABM74667.1"
FT                   /translation="MNSGAERFNGLMAMLGIVAGVGAYATTGQFIPGIF"
FT   gene            complement(102510..102680)
FT                   /locus_tag="NATL1_01041"
FT   CDS_pept        complement(102510..102680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01041"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74668"
FT                   /db_xref="GOA:A2BZK8"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZK8"
FT                   /protein_id="ABM74668.1"
FT                   /translation="MNHLILGGLLSTPAPTAPIVGIAFIVLFAIVGVMVGPDYDGMNAP
FT                   TVDKSKKADQN"
FT   gene            103167..103382
FT                   /locus_tag="NATL1_01051"
FT   CDS_pept        103167..103382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01051"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74669"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZK9"
FT                   /protein_id="ABM74669.1"
FT                   /translation="MKYILNRLGLNHISHYLISMSNEERIEVAEQRIIELKTLINHWKT
FT                   SNISSRRATVDFVDAILSDRDGTQAA"
FT   gene            103536..104075
FT                   /locus_tag="NATL1_01061"
FT   CDS_pept        103536..104075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01061"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74670"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZL0"
FT                   /protein_id="ABM74670.1"
FT                   /translation="MIKKMNISRNLNLKENIWNIVHKLTNSFSILTVNNLGNGYIKCIW
FT                   EISRIDNLRIELSNSCFYAIRLFDISNNRNKNNSTCIMKEIEISKFQSSITFPIPINKG
FT                   VYYFEFGYRKKDGEWRKLAYQKLNLGYRIKKLLQTFDDNSWFDPKIRIRRNEVSLHEEA
FT                   YQLSLNSAIGGSENIS"
FT   gene            104698..105363
FT                   /locus_tag="NATL1_01071"
FT   CDS_pept        104698..105363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01071"
FT                   /product="Short-chain dehydrogenases of various substrate
FT                   specificities"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG300 Short-chain dehydrogenases of various
FT                   substrate specificities [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74671"
FT                   /db_xref="GOA:A2BZL1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZL1"
FT                   /protein_id="ABM74671.1"
FT                   /translation="MTTYLITGSNRGIGLELVRQLKDRGDDVIATCRSASPELNSLSVR
FT                   VETNIDITSGDSVVKLRDNLKDNSVDVLIQNAGIAEFNSLSNLDPQSIVHQFEVNALSP
FT                   LCCVHTLLSKLSKSAKIALISSRMGSIEDNNSGGSYGYRMSKVALCMAGKSLSVDLMPR
FT                   GISVGILHPGLVSTRMTGFTSNGIQPKESVKGLIQRIDELTLENTGNFWHSNGEILPW"
FT   gene            complement(105441..105794)
FT                   /locus_tag="NATL1_01081"
FT   CDS_pept        complement(105441..105794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01081"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74672"
FT                   /db_xref="GOA:A2BZL2"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZL2"
FT                   /protein_id="ABM74672.1"
FT                   /translation="MIIQSSKENIYTCKKFFLMHINNMISKKMLIKKILLNTKRNLFNV
FT                   LSIFKQQKGELSDRCENLTSIPGIGTKNCNNFYEAGYMTPESIISASDEELLTIPGVGI
FT                   SFVKKLRKTLGRI"
FT   gene            105959..106630
FT                   /locus_tag="NATL1_01091"
FT   CDS_pept        105959..106630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01091"
FT                   /product="Hypothetical protein"
FT                   /note="COG1192 ATPases involved in chromosome partitioning
FT                   [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74673"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZL3"
FT                   /protein_id="ABM74673.1"
FT                   /translation="MFITVCGQKGGVAKTCTSIHLASVWSSEGKNVCLVDADRNRSALA
FT                   YGLRGNLKFNIVPVEAAAKATRFSEIVITDGQASTDEEELKHLAAGSDLVLLPTAPKAR
FT                   SVELTVELASLLKQLNIPHAVLLVKVDFRQRRIANEAREALEKFDLTVLEGDIPLLSAF
FT                   DKAENQGSAVIDAVDDKGRSDPRRMSGWSAYCSIAQQIQCQISKHLSDINKRVEDLPLS
FT                   A"
FT   gene            complement(106831..108666)
FT                   /locus_tag="NATL1_01101"
FT   CDS_pept        complement(106831..108666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01101"
FT                   /product="Hypothetical protein"
FT                   /note="COG2274 ABC-type bacteriocin/lantibiotic exporters,
FT                   contain an N-terminal double-glycine peptidase domain
FT                   [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74674"
FT                   /db_xref="GOA:A2BZL4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZL4"
FT                   /protein_id="ABM74674.1"
FT                   /translation="MIGTSKTYHLLMRLLKALPVRRRSSLLKLIPVAAFTGLVDVIVVG
FT                   IVSRLFTVFIGQPNQPPLPFQHFIPEDPKTKVISLVVIYIAMNWLASFSKLFLKAAQER
FT                   LRVAVWKDLSELAQKKLLSQSYEFFLNKKKSDLSSKVLINISRVSEFLVKPILQISSGL
FT                   CVITFICIAVLFIAKSIALYLIISLLIFYIFISSFVTPFIRYSSRKRIKLEKETNNILT
FT                   ESMRTIIDVHLTSSEPYFEKRYKLASKSSFPFMWKAEVLPELPRSLIEPFGITLIFAIG
FT                   LFPYITGENDSILIEIVPFLATIAVAALKLTPPLQDSFRALTSMRASIPDLEEILKLIE
FT                   LPSTRLTKRSIGVPTKEGIQPRNNIKLEKLSYKYPNSNEYTLKGINLTIPIGSRIAFVG
FT                   ETGSGKTTTANQLLCLLRPTDGHLLLDGVAVTDTEVPAWQDCCSYVPQSITLLNSNIIQ
FT                   NIAYGLDEKIIDHGRVWDALRAAQLADLVSEMPMGLHSSVGDNGIRLSGGQRQRLAIAR
FT                   AFYRQSKLLVLDEATSALDNRTEAEVMNAIEIIGRRCTIVTIAHRLSTIERSDCIYEFK
FT                   DGEIVSFGNYQQLLKQSKTFFNMVEIAKRTYGSNI"
FT   gene            complement(108839..109348)
FT                   /locus_tag="NATL1_01111"
FT   CDS_pept        complement(108839..109348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01111"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74675"
FT                   /db_xref="GOA:A2BZL5"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZL5"
FT                   /protein_id="ABM74675.1"
FT                   /translation="MLRANFFKFFKYKKNSNHGIVQYNSNKNFSVQDQIKTNIIEIDQK
FT                   ILEISKSLVQAQIVKLRSTFSKSNNFLEQIGKNVYKTKVEDSINWHKKQLKELYLRRRE
FT                   LEIKLEKLKGIFWLNRIKRLLRIILIGFIILLTLFVFLSGFMIIIYLMPLIILILLGYF
FT                   LSTKRY"
FT   gene            109396..110460
FT                   /locus_tag="NATL1_01121"
FT   CDS_pept        109396..110460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01121"
FT                   /product="Hypothetical protein"
FT                   /note="COG438 Glycosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74676"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZL6"
FT                   /protein_id="ABM74676.1"
FT                   /translation="MTSIVFNGSYITKKNTGIGVVSKDLVYSLSAHKITTLIPKDLGIK
FT                   GDIYIPNNLSPGTGLKSHFRRLYWLQHSVPKLMNNLNAEYFLSPLLEAPLFSNIKSIVL
FT                   AHDLIPIRYPSVSFLTLYYLIYIPLILKQSKLILCNSVSTANDLHRFYKVPMHKLFPIK
FT                   LGFNNKKYYPIKKIRKKFFLIIGRHNPHKNLRRVIKAFAYSKINDYKLIFVGPFDQRHT
FT                   PILLKLIDKYKIRHLCVWKGWIDDNEKLSLLNECHALIIASLWEGFGLPALEAMACGTP
FT                   VIASDRGALREVMGNYGYFINPFNIQSIACAMNAVINDKKCFEKALQEGPSRAESFNWL
FT                   DTARTIEKIIHEID"
FT   gene            110659..110829
FT                   /locus_tag="NATL1_01131"
FT   CDS_pept        110659..110829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01131"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74677"
FT                   /db_xref="GOA:A2BZL7"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZL7"
FT                   /protein_id="ABM74677.1"
FT                   /translation="MPRPKSKKKLTSKIIQANEEKKTTPRTAKIVLFVFGLGPLILMCL
FT                   FLSSNGFFNSP"
FT   gene            110997..111314
FT                   /locus_tag="NATL1_01141"
FT   CDS_pept        110997..111314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01141"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74678"
FT                   /db_xref="InterPro:IPR021734"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZL8"
FT                   /protein_id="ABM74678.1"
FT                   /translation="MQLYLVDCQFTDTDNQIAAYKQFVEFWENGEMSKQDKFDGFEMLF
FT                   RVHAPGEGRVVILCNANGDKELFQHFAPWRAQFGLDMEITPVISCQNVVDYHKDLFAKM
FT                   S"
FT   gene            111432..111587
FT                   /locus_tag="NATL1_01151"
FT   CDS_pept        111432..111587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01151"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74679"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZL9"
FT                   /protein_id="ABM74679.1"
FT                   /translation="MKPTLSFSNRIGRLINTLNPIKAKESVVNRAMPHSDEAKAKIDRC
FT                   MELIIY"
FT   gene            complement(111741..111898)
FT                   /pseudo
FT                   /locus_tag="NATL1_pseudoVIMSS1362562"
FT                   /note="frameshift; Pseudogene derived from NATL2_00961"
FT   gene            112838..113962
FT                   /locus_tag="NATL1_01161"
FT   CDS_pept        112838..113962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01161"
FT                   /product="Putative RNA methylase family UPF0020"
FT                   /note="COG116 Predicted N6-adenine-specific DNA methylase
FT                   [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74680"
FT                   /db_xref="GOA:A2BZM0"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZM0"
FT                   /protein_id="ABM74680.1"
FT                   /translation="MKIVASISQGLEKEGAKELIELGAKSVKASRRHISFEADMACLYR
FT                   IHLRARLSFRFLREIVKFTCHGPNQLYDGVQRLIDWENWLQPRQSFRVDVTGFGEGLSH
FT                   THFTALQVKNAIIDLQRERWGSRSSIDLNNPDICFHLHLSNYQAVLSVDGSNSSLHKRG
FT                   YRPAVGMAPIKETLAAGLMRMTEWDGTKNLVDPLCGSGTFLIEGVSMLLGIASGMDRQF
FT                   LFKNWPDFDISFWNKELQMAKKIKPLNKKLSKIIGCEVDEMIAHSASENVRKAGLKDYI
FT                   EIINCPFQEFQLPPGLGFLICNPPYGKRIGDENELPNLYKQLGEYCKTQASGWDLWLLN
FT                   GNPKLSKYLGMKASRRFQVNNGSIDCRWLNYKIK"
FT   gene            complement(113964..114350)
FT                   /locus_tag="NATL1_01171"
FT   CDS_pept        complement(113964..114350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74681"
FT                   /db_xref="GOA:A2BZM1"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZM1"
FT                   /protein_id="ABM74681.1"
FT                   /translation="MANSERKKGIGAAARVTALASSVMDLHVRIALQEMDREKRRLISG
FT                   VIFLATGGVLMLFALVGSELILGYWLRDLLEIDNKSTILILVFLNLVLAGMSLRIGGYL
FT                   AKGPYLPETLEGIAKTTKAVLGKN"
FT   gene            complement(114350..114805)
FT                   /locus_tag="NATL1_01181"
FT   CDS_pept        complement(114350..114805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74682"
FT                   /db_xref="GOA:A2BZM2"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZM2"
FT                   /protein_id="ABM74682.1"
FT                   /translation="MNSSPSSTSNTVEAEEAIAEKSPEQWFNDHFDNLLPKIQERWPDL
FT                   AKQTLEATKGSLEDLINVISLHSGKNSFGVQEQLEEIFHSATDTTRGLADSLEPLEKQL
FT                   EDILDELNSTLRPRIEKPVRKRPLLAIGIAAGIGVLFGILLGGGRRN"
FT   gene            115032..115169
FT                   /locus_tag="NATL1_01191"
FT   CDS_pept        115032..115169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01191"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74683"
FT                   /db_xref="GOA:A2BZM3"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZM3"
FT                   /protein_id="ABM74683.1"
FT                   /translation="MGVGISSMVFASNTIPTDFGLVLAAIAGAGSLLLIALRFVPEAKS
FT                   "
FT   gene            115265..115654
FT                   /locus_tag="NATL1_01201"
FT   CDS_pept        115265..115654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74684"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZM4"
FT                   /protein_id="ABM74684.1"
FT                   /translation="MSNLGEKKVYRWVLLKHIGSPDDIKGIHFDLLLEDKELCRTWRLI
FT                   DIPLLDGPYVDSVFIAPHNLYWLDIEEKVVSGNRGVATRIKKGIFLQSLPSIDNGFLNL
FT                   SIQWEGVESHLVIDKYGCRIFSKRY"
FT   gene            115731..119336
FT                   /gene="smc"
FT                   /locus_tag="NATL1_01211"
FT   CDS_pept        115731..119336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="NATL1_01211"
FT                   /product="putative chromosome segregation protein, SMC
FT                   ATPase superfamily"
FT                   /note="COG1196 Chromosome segregation ATPases [Cell
FT                   division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74685"
FT                   /db_xref="GOA:A2BZM5"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZM5"
FT                   /protein_id="ABM74685.1"
FT                   /translation="MVHINHVDLSHFKSFGGSMSIPLEEGFTVVTGPNGSGKSNILDGV
FT                   LFCLGLANSRGMRADRLPDLVNSGVLKAGKSSETKVTVKFDLTDWKPDEAEEGIEPTEE
FT                   GPWIKPDQKEWTVSRRLKVMPGGSYASTYSADGETCNLQQLQTQLRRLRIDPEGSNVVM
FT                   QGDVTRIVSMSNKDRRGLIDELAGVALFDTRIDQTRAKLDDVYERQERCRIVEQELILS
FT                   KQRLQKDCEKASLYKDLKNQLLIGRQQELVLSYEKAKKGLEKLDIDHQELLKKEKIDSE
FT                   KLLNHENDLSTCIEKLNILQKNVKELGEDQLLEVQGKLAGIESQHRELERQGLNHKNEG
FT                   EKLQESRNDLLQKKKDYQTDLQSKLNEINPEELEEADLRCKEAEAWVESSRRKLSDVAG
FT                   RSGAWIEKHQKARDELNKIRLELDPKRLEKQNIEESLLQLNVILKELETDQKADQSSNE
FT                   KVHIEISNLNEKWDSILDLLSVKKEEFQVLVSEKGIQERTKYRLEKEQVKLQNDIARLE
FT                   SRKEMISESRGTNAITLLLESGLEGIHGPVANLGEVEDRYRIALEVAAGARLGQVVVDS
FT                   DQIAAKSIDLLKRKRAGRLTFLPLNKILKNSQSRSDVFQRSVHTNLNKSTGLIGKAIDL
FT                   IQYDSIYKNVFLYVFGETIVFSDLSSARDQIGIKRAVTLEGELLEKSGAMTGGSLNNRA
FT                   LGLSFGRVKDNDDCDLLKNRLLEIGETLTNCQKNENQLINKLDNLRSQLSKLEQEKAAL
FT                   DAERVTSKRSNSPLLERQSHRSKRISDLQKSKKEKLCQLESINLIIKPLEVILLEIEKE
FT                   EKKIDKSSDSSVWSKLQNDLEDADKNLLSFRNKRDEISNKQSQTKLAIDRLNDQETTLI
FT                   SEEKRLKDSIDTLASAHIAWREQSKLLTTNRQDLINQQKDLETRFGEQRRERDCVEADV
FT                   AKKRFNLQEMQWSLQRLREDQKNMKEEIRMETIRCTELERKLPNPMPLISDEIRDNGLD
FT                   DLLSKLEDLQKRMEELEPVNMLALEELAKLEERLNELENRLQVLTDERSELLLRIETVA
FT                   TLREEAFMEAFKAVDIHFREIFASLSEGDGHLQLENPEEPLEGGLTLVAHPKGKPVRRL
FT                   AAMSGGEKSLTALSFLFALQRFRPSPFYALDEVDSFLDGVNVERLAALIAKQAEQAQFL
FT                   VVSHRRPMIGASMRTIGVTQARGNHTQVVGLPIAA"
FT   gene            119395..120435
FT                   /locus_tag="NATL1_01221"
FT   CDS_pept        119395..120435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01221"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74686"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZM6"
FT                   /protein_id="ABM74686.1"
FT                   /translation="MTNTQAPQEATSAVPSDRLWLRSELMGTQVITRDTGRRLGLVGEV
FT                   VVDIDRREVVALGLRDNPLTRFLPGLPRWLPLDQIRQVGDVILVDTIDSLSENFVPDRF
FT                   NKVINCQVITESGDQLGRVLGFSFDIETGELLTLVMGALGVPLLGEGVLSTWEMPVDEI
FT                   VSSGPDRIIVYEGAEEKLKQLNSGFLEKLGVGNSGWEESERERYRVNLVPVENQLTSGE
FT                   SVNDDQRLLEQSQEIFEEEEMEYVELQDSEEQQYNKELRYLDEPNQSSIYSEIDEDQVN
FT                   YSESNFKNRTDDFQAKFSSKNTKNQSKIIRDKEPIDVEPLEDLTTNNSQDMISNDKELI
FT                   DIEDPW"
FT   gene            complement(120436..121713)
FT                   /locus_tag="NATL1_01231"
FT   CDS_pept        complement(120436..121713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01231"
FT                   /product="cyanobacteria-specific protein"
FT                   /note="related to lipid A disaccharide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74687"
FT                   /db_xref="GOA:A2BZM7"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZM7"
FT                   /protein_id="ABM74687.1"
FT                   /translation="MSHNHLAIIFVSNGPGELATWVNPLAKELHKQIKLKPRVHSSSKS
FT                   LNLVLVPCPNATGNEIIAAKKWFQFEKIIKAKNFWKLLLNPKKFGSWPSNGLVIFLGGD
FT                   QFWSVLLSARLGYLHMTYAEWIARWPFWNNRIVAMSERIVDKLPKRIQPRCSVIGDLTA
FT                   DLTETAKIDNPLPSGKWIALLPGSKSSKLKIGIPFFLEVADKISKSMPDCQFLIPLAPT
FT                   TNINELKYFSSSKNPISKQYKSGIKSITKANKKEGRGILITNNSTVILIQEKHPAYSDL
FT                   SQCDIALTTVGANTAELGSLNIPMIVVVPTQHISVMEAWDGFIGLIARLPILKWCIGLL
FT                   ISFIKLKKRGYMAWPNIYAKKMIVPERVGHITPAQIAEETIDWLNSPTRLSGQKEDLQL
FT                   LRGSKGAVKKFCYQIINLLEEKKLLN"
FT   gene            complement(121741..121822)
FT                   /locus_tag="NATL1_tRNALeuVIMSS1309185"
FT                   /note="tRNA-Leu"
FT   tRNA            complement(121741..121822)
FT                   /locus_tag="NATL1_tRNALeuVIMSS1309185"
FT                   /product="tRNA-Leu"
FT   gene            121949..123292
FT                   /gene="accC"
FT                   /locus_tag="NATL1_01241"
FT   CDS_pept        121949..123292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="NATL1_01241"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /EC_number="6.3.4.14"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG439 Biotin carboxylase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74688"
FT                   /db_xref="GOA:A2BZM8"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZM8"
FT                   /protein_id="ABM74688.1"
FT                   /translation="MPIGKLLIANRGEIALRILRSCREMGIATVAVYSTVDKNALHVQL
FT                   ADEAVCVGDSPSSKSYLNVPNILAAATSRGVDAIHPGYGFLAENDRFAEICGDHGLIFV
FT                   GPSPHAIRSMGDKSTAKSTMQKVGVPTVPGSEGLLDSVSDASKLASGMGYPVMIKATAG
FT                   GGGRGMRLVTHSDELENLFKAAQGEAEAAFGNPGLYMEKFIDRPRHVEVQILADRFGNV
FT                   VHLGERDCSIQRRHQKLLEESPSPALDDHLRIRMGEAAVAAAKSINYEGAGTVEFLLDR
FT                   HGSFYFMEMNTRIQVEHPVTELVTGMDLISEQLRIAGGEKLQFAQAEIKLEGHAIECRI
FT                   NAEDPSHNFRPSPGKITGWLPPGGPGVRVDSHVYTGYDIPPFYDSLIGKLIVWGKNREA
FT                   ALKRMERALSECAVTGITTTIDFHLKLLKRKEFIEGDVHTKFVEKEML"
FT   gene            complement(123306..123605)
FT                   /locus_tag="NATL1_01251"
FT   CDS_pept        complement(123306..123605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01251"
FT                   /product="YGGT family, conserved hypothetical integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74689"
FT                   /db_xref="GOA:A2BZM9"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZM9"
FT                   /protein_id="ABM74689.1"
FT                   /translation="MPLLVKSLPTLHFFMGFSIGALTLAFLLRIILTWYPKIDLRTGFW
FT                   PIIFLPTEPILVLTRKIVAPIGGVDVTPIIWVGLLSLFRELFLGQQGLLTQIIF"
FT   gene            123693..123863
FT                   /locus_tag="NATL1_01261"
FT   CDS_pept        123693..123863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01261"
FT                   /product="Photosystem II protein X PsbX"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74690"
FT                   /db_xref="GOA:A2BZN0"
FT                   /db_xref="InterPro:IPR009518"
FT                   /db_xref="InterPro:IPR023428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZN0"
FT                   /protein_id="ABM74690.1"
FT                   /translation="MAFHLLNLFLSAGTSSEAATSSAVGMIGSFLAAGALIVAPAAAAL
FT                   IWVSQKDALSR"
FT   gene            123947..124909
FT                   /locus_tag="NATL1_01271"
FT   CDS_pept        123947..124909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74691"
FT                   /db_xref="GOA:A2BZN1"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZN1"
FT                   /protein_id="ABM74691.1"
FT                   /translation="MVNASLNWASIVGIVLAVCGAGLYFLRSFKPALARDYDVFFAAIG
FT                   LLCGGILFFQGWRLDPILQFGQFLLAGTTVFFAYESVRLRGIATDQARRSSYFDDEPEL
FT                   PRSSRGGLSGADSDRNYDRFEESQPINRRFAGREDYQEEYSDDENYGRRPSRAAIPEQA
FT                   VSRRPRNISSSEINSRGTERDRRMERFNSESSSDRASSFGDRRTSRQETRQGSRPSASG
FT                   QTSSRRRNGAPPTQSSSSRLNSDNSTRASTGSKRPSKTNNNIEDAAFSSAEKGVRRASR
FT                   RSAKNPGANPANQRPSSKSSYSSSTRKSRPRDNSSRFDD"
FT   gene            complement(124921..125160)
FT                   /gene="hli2"
FT                   /locus_tag="NATL1_01281"
FT   CDS_pept        complement(124921..125160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hli2"
FT                   /locus_tag="NATL1_01281"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74692"
FT                   /db_xref="GOA:A2BZN2"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZN2"
FT                   /protein_id="ABM74692.1"
FT                   /translation="MNSNTEKAQESESTEPEKTDSEIKNLSPSATTNDIPEFGWSGYAE
FT                   RINGRFAMIGLIAVLLVEALSKISFLEWAGIISQ"
FT   gene            complement(125170..127158)
FT                   /locus_tag="NATL1_01291"
FT   CDS_pept        complement(125170..127158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01291"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /note="COG4178 ABC-type uncharacterized transport system,
FT                   permease and ATPase components [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74693"
FT                   /db_xref="GOA:A2BZN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZN3"
FT                   /protein_id="ABM74693.1"
FT                   /translation="MTSSISKAQKGLVSQLIKLRKLTQPYFLPYTKNNGWLFVYLLIAL
FT                   LFCVGGTVLFLLTGLMSLLTNLAPEVTNQFLGGVQNSLKVIWNGPSGIIISSLFALGIF
FT                   SFITVRGQLRQRRWLPWLLLGVIILMLLSVNGINAGITFLVRDITNALIQKDESESYKN
FT                   LWILGICFIAALPIRSFQFYFSAKLQLLWREWLSKSLITDYLDDRTYYILNPNDESETN
FT                   VDNPDQRITEDARDFTAQTIDLSLNIFDSLLVFSLNIFILLSISKELTLALIVYATLVS
FT                   SLLLFASRKLFKLNYDQLRFEADFRYGLVHVRNNAESIAFYSGENQEEKEVSRRLKSVV
FT                   DNFNLLIIWEALLRVLQRSGIYGSVFIPFIILAGPILSGQMDYGSFQQANLNYNLLEGS
FT                   LFFIIYKIEALARFSASIGRLEGFQSNMNEIRNNQFEDFKVEIKNNDSIILKNVSIKTP
FT                   GKDNYLINNLNLSLETGQSVLVVGPSGCGKTSLLRAISGLWAIQSGEIETPSNGELLFI
FT                   PQKPYMTLGSLREQLCYPLDKNRFSDDHLKAVLEEVKLPQIIQRYPDLDIKQDWQRLLS
FT                   LGEQQRLAFARLLLNSPKYVVLDEATSALDVNTEKHLYELLNKREMACISVGHRPTLKN
FT                   YHENVLEITENKGWRLLPAASYQFTEN"
FT   gene            complement(127281..127562)
FT                   /locus_tag="NATL1_01301"
FT   CDS_pept        complement(127281..127562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74694"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZN4"
FT                   /protein_id="ABM74694.1"
FT                   /translation="MDSQTAKDKNGIISKANINLQDLWSNLSEKQQSILKKIWSILTYK
FT                   WQWQIILNAPFLLIWALDQTIPAVHTFDMQLISSLPIPTIIKTYLGFS"
FT   gene            complement(127668..128003)
FT                   /gene="hit"
FT                   /locus_tag="NATL1_01311"
FT   CDS_pept        complement(127668..128003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hit"
FT                   /locus_tag="NATL1_01311"
FT                   /product="HIT (Histidine triad) family protein"
FT                   /note="COG537 Diadenosine tetraphosphate (Ap4A) hydrolase
FT                   and other HIT family hydrolases [Nucleotide transport and
FT                   metabolism / Carbohydrate transport and metabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74695"
FT                   /db_xref="GOA:A2BZN5"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZN5"
FT                   /protein_id="ABM74695.1"
FT                   /translation="MTTIFDKILSGEIPCDEVFSDNKCLAFKDITPQAPTHILIIPRKP
FT                   IPSLQDIKKEDQELLGHLLLKGTEIANAAGLESWRTIINTGEEAGQTVFHLHIHIIGGR
FT                   KLSWPPG"
FT   gene            complement(128073..128681)
FT                   /gene="def"
FT                   /locus_tag="NATL1_01321"
FT   CDS_pept        complement(128073..128681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="NATL1_01321"
FT                   /product="putative formylmethionine deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COG242 N-formylmethionyl-tRNA deformylase
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74696"
FT                   /db_xref="GOA:A2BZN6"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZN6"
FT                   /protein_id="ABM74696.1"
FT                   /translation="MAGSFAQLAKNAEKKKPSISVSKEPVENPPLKVYQLGDEALRTPA
FT                   NRIVKVDDAIRKLAKDMLITMYSSKGIGLAAPQVGIQKRLLVIDLNFEDPNSPPMVFIN
FT                   PEIISSSATVDTYEEGCLSIPGVYLNVLRPSSIKLSYRDEMGRPKKMNADGLMARCIQH
FT                   EIDHLNGVCFVDKVTDEEELKKQLNENNFKRSDVIKATN"
FT   gene            128762..130696
FT                   /gene="dap2"
FT                   /locus_tag="NATL1_01331"
FT   CDS_pept        128762..130696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dap2"
FT                   /locus_tag="NATL1_01331"
FT                   /product="Esterase/lipase/thioesterase family active site"
FT                   /note="COG657 Esterase/lipase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74697"
FT                   /db_xref="GOA:A2BZN7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZN7"
FT                   /protein_id="ABM74697.1"
FT                   /translation="MKNKTMRILDAEKVYGEAPIFKEPRIIGDWILWLEQRPNEKGRTT
FT                   ALIRPWGQKDVLPQELTPYPSDLRTKIHGYGGAPLTATLDGSDLILTWVDNKDNRLWMR
FT                   TWFYEEEKEKSFSFKFIPKIESICLTKKHSYFLAGGVIDLEKNIWIGLMEDEEGDHIVS
FT                   YSLNKSEQYPKIIYSSQGLLGYLALNSKDRKLAWVEWKNTSMPWDLNELKLAKLGEKEN
FT                   IINVVTVNNEYLKCTEKISFFNPIWSDTGDLFVAEDSSGWWNITQIKTDLNNNSITIFQ
FT                   NQWTIKAEIAFPQWVLGMSSFSCVGDNVVGAFAQEGIWTLALFQKDGSIKTFDQTFIEF
FT                   SGIHSHQNRLVAIASSAEITEGIFEIDLLNQSWEHTPASSFSLDPKEISIGESFWFIGS
FT                   NEEKVHAWYYPPLNKQILLPPLLVKSHSGPTGMARCGLDLEVQFWTSRGWAVVDVNYGG
FT                   SSGFGREYRDRLRGNWGVIDVMDCTKAAQSLIASGKADKDRIAIMGSSASGFTALGCLI
FT                   SSDIFNIGACKYAVTDLIGMANSTHRFEEFYLDYLIGNIETDYEKYLKRSPIENVNFMN
FT                   MPLILFHGLKDKVIPSDQSIAIKDELLKREIPVQINLFENEGHGFKDGKIKVDVLNKTE
FT                   AFFRQYLNI"
FT   gene            complement(130693..131943)
FT                   /locus_tag="NATL1_01341"
FT   CDS_pept        complement(130693..131943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01341"
FT                   /product="putative cysteine desulfurase or selenocysteine
FT                   lyase"
FT                   /EC_number="4.4.1.16"
FT                   /EC_number="2.8.1.7"
FT                   /note="COG520 Selenocysteine lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74698"
FT                   /db_xref="GOA:A2BZN8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZN8"
FT                   /protein_id="ABM74698.1"
FT                   /translation="MNNLVKNIAEKSRNDFPLFNRDINKNLIYLDHAATSQKPKQVIDS
FT                   LKKYYSFQNANVHRGAHQLSAIATEKFENSRKLTANFINSKNEKEIIFTRNATEAINLV
FT                   AYTWGNYELQENDEILISLMEHHSNIVPWQLIAKAKKCKLIYINIDKNGELDFDDFRKK
FT                   LSDKTKIVSLVHVSNTLGCCNPIEEISSLAHQKGSLVLLDACQSLAHKQVDIKKLGIDF
FT                   LAGSSHKLCGPTGIGFLWGREEILKKIPPFLGGGEMINEVFKDNSTWAELPHKFEAGTP
FT                   AIGEAIGMGTALKYLQSIGLNEIHNYEKELTKYLFEKLEEIDDLKILGPSPFIQPDRGP
FT                   LATFYIKGVHSNDVAELLDNSNIYIRSGHHCCQPLHRFYGIKSTARASLSFTSTPSEID
FT                   YLAEELKSVISFLKKNS"
FT   gene            complement(131940..133178)
FT                   /locus_tag="NATL1_01351"
FT   CDS_pept        complement(131940..133178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01351"
FT                   /product="ABC transporter, membrane component"
FT                   /note="COG719 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74699"
FT                   /db_xref="GOA:A2BZN9"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZN9"
FT                   /protein_id="ABM74699.1"
FT                   /translation="MKSSTICQDWLDSLPLTDGYLKNEQSIGREFLLEKGMPSKKDEAW
FT                   RLSNFNKLNSFLSLPTIIDSKGIKSVFPEKDENRERIIINPNENPILNINLPNGIEELN
FT                   KKEIEENLGEIIKSTNIKNDISVCLNQASSLEVLALKVKRNHNHSLELVIPSIEEKSIS
FT                   TRIFFLIEEGAKLDLLQIFLGKNNSAQNHLIEIKLEAQAEFTHGFISLGEEKESSSICT
FT                   LAVDQSEKSKYSLHSIHHGWDYARFEPRIIQSEGEASTTIKGLQVTKSKEQIATHSLIR
FT                   FEGPNGKLDQLQKAVASEYSHCIFNGSIEVPQKAQKTEAAQLSRNLLLSKRARIDTKPE
FT                   LEIVADDVRCTHGATVSQLQDEELFYLLSRGIDKQCANSLLLQGYYDEVISHFPKSAGK
FT                   WNFIEKLIQDIKK"
FT   gene            complement(133175..133966)
FT                   /gene="sufC"
FT                   /locus_tag="NATL1_01361"
FT   CDS_pept        complement(133175..133966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="NATL1_01361"
FT                   /product="ABC transporter, ATP binding component"
FT                   /note="COG396 ABC-type transport system involved in Fe-S
FT                   cluster assembly, ATPase component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74700"
FT                   /db_xref="GOA:A2BZP0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZP0"
FT                   /protein_id="ABM74700.1"
FT                   /translation="MISSTSETILSIKDLHASVEDQEILHGVNLLVKEGEIHAIMGRNG
FT                   SGKSTLSKVIAGHPAYKVLSGSIQFKGKNILELEPEERARIGIFLGFQYPVEIPGVSNL
FT                   EFLRVATNSRRKELLKSELDTFQFEDLVKQRLKIVEMNPAFLERSVNEGFSGGEKKRNE
FT                   ILQMALLEPVISILDETDSGLDIDALRIVASGINRLSQPNSATILITHYQRLLNEITPD
FT                   FVHIMADGKIIKTGNKELAIDLEKSGYDCIDKNTKEKEIAK"
FT   gene            complement(134017..135459)
FT                   /locus_tag="NATL1_01371"
FT   CDS_pept        complement(134017..135459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01371"
FT                   /product="ABC transporter, membrane component"
FT                   /note="COG719 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74701"
FT                   /db_xref="GOA:A2BZP1"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZP1"
FT                   /protein_id="ABM74701.1"
FT                   /translation="MTQSNTVEEIVSQPYKYGFITEIETEKIPKGLNEDVIRLISSKKN
FT                   EPEFLLKFRLRAYEQWLKMKEPDWSGLTYSKVDYQDLVYYAAPKQDIKKKSLDEVDPKL
FT                   LETFEKLGIPLSEQKRLSNVAVDAVFDSVSIATTYKEKLAEHGVIFCSISEAISEYPDL
FT                   IEKYMGTVVPLNDNFFAALNSAVFSDGSFVYIPKGVECPMELSSYFRINSGDTGQFERT
FT                   LIIAEESSSVSYLEGCTAPMFDTNTLHAAVVELVALDNASIKYSTVQNWYAGNEEGVGG
FT                   IYNFVTKRGECRGKKSKISWSQVETGSAITWKYPSCVLQGDNSIGEFYSIALTNNCQKA
FT                   DTGTKMIHIGKNTKSKIVSKGISAGKSKNSYRGLVSISPNAEGARNYSQCDSMLIGDKA
FT                   SANTYPYIQSKQPQSNIEHEASTCRISEDQLFYLQSRGIDFEESVSMLVSGFCSDVFNE
FT                   LPMEFASEADKLLALKLEGSVG"
FT   gene            135937..136299
FT                   /locus_tag="NATL1_01381"
FT   CDS_pept        135937..136299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01381"
FT                   /product="conserved hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74702"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZP2"
FT                   /protein_id="ABM74702.1"
FT                   /translation="MMESTFNDNSKNSPLSKEDINLIGLTNLSANEKHHLRMLAHCLQC
FT                   FKSMSKDNPKGLIPVKEEWLEWCLKNPIMMKDDEFVQVIFEQFSGAAIQLERLSNDLKV
FT                   APLDLTLRNLIDAYEV"
FT   gene            136586..137668
FT                   /locus_tag="NATL1_01391"
FT   CDS_pept        136586..137668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01391"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3330 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74703"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZP3"
FT                   /protein_id="ABM74703.1"
FT                   /translation="MTFDQESLSRLTLRQLRTKASELGIPLYSRKSKADLVKGVLLYEE
FT                   KKELEKQLINNKVQPSSETTYQNSSETKVVFLPRDPEWAYIFWEISDSDRSNAQKEGAI
FT                   RLCLRLADVTNKNNGETNPGTLQEIVVDSHSTEWYLPIPLAGRDYKVELGYRIGHKWMS
FT                   LAHSSSAKVPSLHPSEQILDQFVPFSLEAPVTTSSDSKIESFASEQPDSGLHERLYQSA
FT                   TTKFRTRRVGSEEFQEGFPGDLNSNNESGSGLWASGLNESGIGGVPQARSFWLVADAEL
FT                   IVYGATDPSAKLFIEDEEVPLGNDGTFRLQVPFRDGIQNYSIKAIDKDGVDSRNITMKF
FT                   ERVTPVDNTNPNSKAESEWF"
FT   gene            137688..137858
FT                   /locus_tag="NATL1_01401"
FT   CDS_pept        137688..137858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01401"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74704"
FT                   /db_xref="GOA:A2BZP4"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZP4"
FT                   /protein_id="ABM74704.1"
FT                   /translation="MVRLFVAFTPLVGAIAFPLLIPTTIERLGLGPGVLSALILSTLWF
FT                   IAMLRTSEMPH"
FT   gene            137922..139571
FT                   /gene="pgm"
FT                   /locus_tag="NATL1_01411"
FT   CDS_pept        137922..139571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="NATL1_01411"
FT                   /product="Phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="COG33 Phosphoglucomutase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74705"
FT                   /db_xref="GOA:A2BZP5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZP5"
FT                   /protein_id="ABM74705.1"
FT                   /translation="MFSTEFTQLTVQLNSPFTDQKPGTSGLRKSTLQFEETHYLESFIE
FT                   SILCSLPGVRGGVLVVGGDGRYGNKRAIDIIIRMAAAHGIQKVITTVDGILSTPAASNL
FT                   IRINKAIGGIILSASHNPGGLEGDFGVKLNGSNGGPASESLTDEIYNYSKNLKEYKIIK
FT                   CQSNNSFSLGKYKLASMIVEIIDGIDDYLDLMKKIFDFDLISSYINNDFPIVFDALNAV
FT                   TGPYAKRLFVDHLGATAETVRNGIPLEDFGGLHPDPNLTYAKDLADLLLKGNLFSFGAA
FT                   CDGDGDRNMILGRGCFVNPSDSLAILAANYDCVPGYAKGLSGVARSMPTSSAVDVVAKH
FT                   LGINCFETPTGWKFFGNLLDANQITLCGEESFGTGSDHVREKDGLWAVLFWLQILASKK
FT                   KSVSEIMKNHWLFFGRHYYSRHDYESIPSEVANSLYSRLSNMLPTLIGESFARRTIENA
FT                   DDFSYTDPVDGSITLNQGLRILLDDGSRVLVRLSGTGTQGATLRVYFESFVPRDGDITQ
FT                   DPQLALDPLIKSIDSLAEISKRTGMSAPTVIT"
FT   gene            139659..141863
FT                   /locus_tag="NATL1_01421"
FT   CDS_pept        139659..141863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01421"
FT                   /product="Hypothetical protein"
FT                   /note="COG2256 ATPase related to the helicase subunit of
FT                   the Holliday junction resolvase [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74706"
FT                   /db_xref="GOA:A2BZP6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZP6"
FT                   /protein_id="ABM74706.1"
FT                   /translation="MSKDLFAFNGEQLIQNNAPLADRLRPQTLDEFVGQDHILAQGRLL
FT                   RRSIVADKVGNLLLYGPPGVGKTTLARIIALNTLSHFSVVNAALAGIKDLRSEIESAID
FT                   RLNKFGKRTILFIDEVHRFNTAQQDALLPWVENGTLTLIGATTENPYFEVNKALLSRSR
FT                   LFRLNSLNSKALHQLLQRALNDKKRGYGLKLINLASEAEDHLVDVCNGDARVLLNALEL
FT                   AVESTIANQDTSINIDLKIAEDSIQERAVLYDKKGDAHFDTISAFIKSLRGSDPDAALF
FT                   WLARMLEAGESPRFIFRRMLIAAGEDIGLADPNAIVIVESCAAAFDRIGLPEGVYPLAQ
FT                   ATLYLASTEKSNSVKAIFKAVQKVKDSQKQNVPSHLKDPNRDQESFGDGMGYRYPHSFS
FT                   KHWVPQQYLPDTLLNEIFWEPTEHGWEGQRRSLLNERRSEQLASLIEVEQQNPLTITSG
FT                   KVDNDLEKWLSRQVLQEGERLKNLMTKLWSGITWKKNHRVLVLAPSSLLWSLKPLREVS
FT                   EGGVFLAVSEDNHPKLLAELEVLAPMERPVLIDSKVESIKKLEDNLKFEVIGGRIPWKV
FT                   FSETNFFELWPILTEKCTANTALSLIISNPCSGPAFSLKERLEFYSNKKNTDFSFLSDL
FT                   ICKEEKWLNKQEHKKKFILQLEKLGWNISFEEWTEFVYQKVDNTIIKRWLNQGSEYREI
FT                   ILKNCEEETLIRLQELFKRLEGQTIKQKLIHTKFLAKNSN"
FT   gene            complement(141860..142552)
FT                   /locus_tag="NATL1_01431"
FT   CDS_pept        complement(141860..142552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01431"
FT                   /product="possible 4'-phosphopantetheinyl transferase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74707"
FT                   /db_xref="GOA:A2BZP7"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZP7"
FT                   /protein_id="ABM74707.1"
FT                   /translation="MKSGAESPIQRVMITTQINNKRVLGLWLFLMPSKLLPISSEEKKW
FT                   VQKLAPSRGLIYHFSRGCLRHVMSNITGLGPLDIPLKADPGEPPLLAEGWGNISMSHCS
FT                   DALLIGWSSGKIGVDIERKDREFQAYKLSKRFFTQYENYEIENLSPCQAKDLVLKRWVI
FT                   KEAAVKWQRGKIANNINQWTWKNKSSFAHHKKLGHKVKVYEQNYDQWTYAIALDEDSIT
FT                   CKPIICVD"
FT   gene            142515..142982
FT                   /locus_tag="NATL1_01441"
FT   CDS_pept        142515..142982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01441"
FT                   /product="putative bacterioferritin comigratory (BCP)
FT                   protein"
FT                   /note="COG1225 Peroxiredoxin [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74708"
FT                   /db_xref="GOA:A2BZP8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZP8"
FT                   /protein_id="ABM74708.1"
FT                   /translation="MTLCIGDSAPDFTLPNQDGVDISLSSFQGSRVVIYFYPKDDTPGC
FT                   TKEACSFRDNWELFKSNNIQVLGISKDASKSHIKFIDKHKLPFTLLTDSDPCPVAASYE
FT                   SYGLKKFMGREYYGMMRHTFVVNKYGKIELIYLKVKSDNMANQILNDLKLN"
FT   gene            complement(142969..143712)
FT                   /locus_tag="NATL1_01451"
FT   CDS_pept        complement(142969..143712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01451"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="COG1521 Putative transcriptional regulator, homolog
FT                   of Bvg accessory factor [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74709"
FT                   /db_xref="GOA:A2BZP9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZP9"
FT                   /protein_id="ABM74709.1"
FT                   /translation="MWDPFKYAITRNKLVYSEENFLMIGNTRWHWASKVKKDWKYFHTS
FT                   PNPIEFKDKDYSQLTWASVGPIPENIKLCPSKKIILDNVPLNNLPSNLGIDRALSSWSA
FT                   FKKQSFLKSKEQDLIVIDAGTILSVTKISNKGEFIGGQLISGFSLQLSSMSNRAMNLET
FT                   PIVKKIPTETFQYETHNAMIRGSMNALIGLILTLFEETKLPIWMCGGDAPIILNELKNT
FT                   NIDINHSPNLVLEGMIDIYKKINSI"
FT   gene            complement(143685..144455)
FT                   /gene="cysH"
FT                   /locus_tag="NATL1_01461"
FT   CDS_pept        complement(143685..144455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="NATL1_01461"
FT                   /product="Phosphoadenosine phosphosulfate reductase"
FT                   /EC_number="1.8.4.8"
FT                   /note="COG175 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase and
FT                   related enzymes [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74710"
FT                   /db_xref="GOA:A2BZQ0"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZQ0"
FT                   /protein_id="ABM74710.1"
FT                   /translation="MKKESNDNYINDLRNAAQLPQPALMKSIHETSEDLEKLSPQDQLQ
FT                   WAFEEFDENFVVTTSFGIQSAVLLHMTKELKSSQKPKVIWVDTGYLPKETYNYAEKLTT
FT                   LFELNLVVAQSSVSPARMEALNGRLWETGVQKDLEKYHQIRKVAPLEKAFSDLNVLCWA
FT                   SGVRKGQTKNRQSMSNIDCIRERLTLRPLLNWSKKDIFYYMEKNKLPQHPLFEKGYSTV
FT                   GDWHSSGAENTNTKGRSTRFGGLSEECGIHLNTQ"
FT   gene            144458..145699
FT                   /locus_tag="NATL1_01471"
FT   CDS_pept        144458..145699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01471"
FT                   /product="putative NADH dehydrogenase, transport
FT                   associated"
FT                   /EC_number="1.6.99.3"
FT                   /note="COG1252 NADH dehydrogenase, FAD-containing subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74711"
FT                   /db_xref="GOA:A2BZQ1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZQ1"
FT                   /protein_id="ABM74711.1"
FT                   /translation="MSFECRISQSLFRVFEIILDPVPMDLNNLKSDPIVVVGGGFGGLS
FT                   TVQALLARSNGMPIILIDQSPRFLFKPLLYELLSGELELWEVAPKYSALASELGFIFLE
FT                   ECVVEVDGLERKLITSSGTKVKYSQLVISTGVTTDFSLLRDLKEYAYGFSSLNDLVRIQ
FT                   ELIISINNSSNHSNPLIIAGAGPTGVELACKLSDLVNNRVEIYLVDKGNKILSKSKSFN
FT                   REKAIDAIAERNIKIYLEHYIESINENTIELSTVETERNNSLKINYSGLLWTAGLSPCR
FT                   LPFIDHLLDENKKIKVNKFLQIKEYQNIFFVGDIVFCEDVPFPSSAQVAMQQGSLTAQN
FT                   IISLRKGNKLKSFQFEDLGEMLSLGIGNASITGYGVTLAGSLASKIRHFAYLMRMPGFS
FT                   LFLKSAGSRLLSKK"
FT   gene            145799..147616
FT                   /gene="citT"
FT                   /locus_tag="NATL1_01481"
FT   CDS_pept        145799..147616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="NATL1_01481"
FT                   /product="putative sodium/sulfate transporter, DASS family"
FT                   /note="COG471 Di- and tricarboxylate transporters
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74712"
FT                   /db_xref="GOA:A2BZQ2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZQ2"
FT                   /protein_id="ABM74712.1"
FT                   /translation="MNEISTVLDNPKAVITLAVLIIAVFLFVSSALAPELTGLLSVALL
FT                   MATGVLSPQKALAGFGSPALITLMGLFAVSAALFKSGALDRLRELIASESIRTPRRLIA
FT                   LLGLVVAPVSGVVPNTPVVASLLPVIEAWCVKRKLSPSRVLLPLSFATVLGGTLTLLGS
FT                   SVNLLVSDISDQLGYGPFDLFTFTAIGVPIWLFGTAYMLLAPQSLLPDRGRISSEYGGS
FT                   SDQTGYFTEVTIPSDSELVGHSLRNSRLQRRFDVDVLEIQRENEILLPPLADRIIQSGD
FT                   RLLIRITRSDLLRLKQEHTVQLNKNLNIEKNFFLSNIDESQQTVEVLLPAGSTLAGASL
FT                   RELRFRQRHNATVLALRRGQQTVQERLGQAILREGDVLLLQAPRDSIRGLQDSNDLLVL
FT                   DQFENDLPTVTRKPIAIGIAIAMLIIPSITDLPLVASVLMAVIAMVWGGCLRPAEVQRS
FT                   IRLDVILLLGSLSSFSVAMQTTGLADAFANILILILKDLSTYSALLVIFLSTTIFTQFV
FT                   SNAASVALLAPIAVQLAPSMGLPPLALLITVLFGASQSFLTPMGYQTNLMVFGPGRYQF
FT                   LDVTRYGAGLTILMTLLVPGLILLKYGIS"
FT   gene            147619..147723
FT                   /locus_tag="NATL1_01491"
FT   CDS_pept        147619..147723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01491"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74713"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZQ3"
FT                   /protein_id="ABM74713.1"
FT                   /translation="MLDMIINLGKNLKLPFDFDYLIFSELVSIYFQKK"
FT   gene            147720..149105
FT                   /gene="trkG"
FT                   /locus_tag="NATL1_01501"
FT   CDS_pept        147720..149105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkG"
FT                   /locus_tag="NATL1_01501"
FT                   /product="possible sodium transporter, Trk family"
FT                   /note="COG168 Trk-type K+ transport systems, membrane
FT                   components [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74714"
FT                   /db_xref="GOA:A2BZQ4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZQ4"
FT                   /protein_id="ABM74714.1"
FT                   /translation="MSIRQETYRRLTVPQFTVVTGLLVIAFGTLLLATPFCSNANVGLW
FT                   EALFTATSAVTVTGLSIIDIGIDLTFFGQVILAIMLLTGGLGLMAITTFLQGFIVSGTE
FT                   LKTRLDRGKTLDEFGVGGVGTTFKGIAITASILIFLGSITLYFFGFKNITSSSERIWAS
FT                   IFHSISAYNNAGFSLWSSSLQNYRGNWVVNFVLITLIILGGFGWRVTNDIWINRRSLKL
FT                   RNLSLHTRLVIRSSFILIALGFFGLIFTESLARGSFFSLINFDDRILTALFTSVSSRTA
FT                   GFTNLPISIESVSDSGLLLIMFLMFIGASPGGTGGGIKTTTIAALMAATRATLRGQNEI
FT                   IIRNRQISDKVILKAVGITVGSFLFVLIMALLLSLSNGFNSGENFSFLEMLFTCISAFA
FT                   TVGFDLGVTSKLGHVGQLILIIGMFVGRLGILLFLSAVWQALNKSKIQHRNRIGYPKED
FT                   LYV"
FT   gene            149118..149822
FT                   /locus_tag="NATL1_01511"
FT   CDS_pept        149118..149822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01511"
FT                   /product="putative potassium channel, VIC family"
FT                   /note="COG569 K+ transport systems, NAD-binding component
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74715"
FT                   /db_xref="GOA:A2BZQ5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZQ5"
FT                   /protein_id="ABM74715.1"
FT                   /translation="MSDWWQWSPIKANQKLGFAVVGIGRFGSAVCRELLRNGADVLAVD
FT                   FSEKAIEELRQLEPTIEARVVDSTDEESMKEAGVLEMGTVVVGISEPIEASITTTLIAK
FT                   DTEGSLVKQVIARATSDLHEKMLKRVGADRVVFPSRMQGERLGLELVRPNLIERLELDD
FT                   KTGIDEIKVPEVFVGRSLRDLNLRKNYFVNVLAAGPAQLLTVNPPAKYILEKDHVLVVM
FT                   GSMEDLQKLPQT"
FT   gene            149826..150962
FT                   /locus_tag="NATL1_01521"
FT   CDS_pept        149826..150962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01521"
FT                   /product="Predicted molecular chaperone protein"
FT                   /note="distantly related to HSP70-fold metalloproteases;
FT                   COG2377 Predicted molecular chaperone distantly related to
FT                   HSP70-fold metalloproteases [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74716"
FT                   /db_xref="GOA:A2BZQ6"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZQ6"
FT                   /protein_id="ABM74716.1"
FT                   /translation="MRVLGLMSGTSADGIDAVLVDFTGDPSKPKWQILNTFSYEYPSSI
FT                   REKIIQVGQGLKISSKDWLELAEEITELNAFAARTCDPDSTAEVVGCHGQTLFHRSVKK
FT                   SKRGGSLQILLGPLLANLLDQIVIYDFRSKDIASGGHGAPLVALVDEALVGRLYGWRGV
FT                   LNLGGIANLTIIPPKTGIDKTSQCLGWDCGPANSLVDLAVKESTNSSLTFDENGSLASL
FT                   GIPKLEIIDKWLRDPFFYLEPPRSTGREQFGFQYLQKRKKELGDISKEDLISTLTTFTA
FT                   SIISQDLDNLFKFKQIRLIELLVAGGGSKNLFLMRQLQKQCCGVHVRPINEIGVPSQYR
FT                   EALVFATLSWWNFLGKKVNPKYITGAKKPILYGVRVDP"
FT   gene            complement(150980..151282)
FT                   /locus_tag="NATL1_01531"
FT   CDS_pept        complement(150980..151282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01531"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74717"
FT                   /db_xref="GOA:A2BZQ7"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR012869"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZQ7"
FT                   /protein_id="ABM74717.1"
FT                   /translation="MATRQNSSNGKQKSPRIQVVLPEDLCERLSELAERESRTVSNMAK
FT                   VLIQEGVKYHELKESSASKELETKEIKTQNFINALEKQKTQRLKGIPKRLKFKRD"
FT   gene            151422..151778
FT                   /locus_tag="NATL1_01541"
FT   CDS_pept        151422..151778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74718"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZQ8"
FT                   /protein_id="ABM74718.1"
FT                   /translation="MSKPSLPQASKAFSANVVADKGNVKRQRRKSRSNGKNGDVLISAV
FT                   VSSYLLTHLHHVLQRAEYGASKEGRSSQAANFAQLRKVLCMDARSMKDASALGLKESDL
FT                   DTCNESNGFETKAA"
FT   gene            151812..152042
FT                   /locus_tag="NATL1_01551"
FT   CDS_pept        151812..152042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74719"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZQ9"
FT                   /protein_id="ABM74719.1"
FT                   /translation="MSGNAAELYKLINADPNKKQDLFRQALQNPKGAMQSICALGIEMN
FT                   LPVTSEEVKEYLTTVDDLDTKQWLLKARGGL"
FT   gene            complement(152043..152207)
FT                   /locus_tag="NATL1_01561"
FT   CDS_pept        complement(152043..152207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01561"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74720"
FT                   /db_xref="GOA:A2BZR0"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZR0"
FT                   /protein_id="ABM74720.1"
FT                   /translation="MLRLEQIAALVLAAALAIPSYWFFWTMAGGGGYERRGIRENSQDT
FT                   LEIHSSFKN"
FT   gene            152293..154011
FT                   /locus_tag="NATL1_01571"
FT   CDS_pept        152293..154011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01571"
FT                   /product="ABC transporter, ATP binding component"
FT                   /note="COG488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74721"
FT                   /db_xref="GOA:A2BZR1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZR1"
FT                   /protein_id="ABM74721.1"
FT                   /translation="MLRLEKISKIYPTGEVLKDVSWEIRNGERIGLVGVNGAGKSTQLK
FT                   IIAGLEEATDGSLISEGDPSIAYLKQEFDVDLSRTVREELFAAFKEASDLLHSQKLVQE
FT                   KMESELASKDLDYLDLLIKELSVIQSKFESINGYDLESKVEKLLPTIGFNQNEADRLVG
FT                   DFSGGWQMRIALGKILLQSPDLLLLDEPTNHLDLETIEWLENYLLNQKIAMVIVSHDRS
FT                   FLDKICTRIVNTERGKSKSYLGNYTSYLQQRDFELESTKVAYEKQQKDIQVQKAYIERF
FT                   RASATRSTQAKSREKLLDKVEKIEAPENNLKGPNFKFLEAPRAGRDILNIKDLTHSYED
FT                   NILFLGAFLELEPGERIAFLGPNGSGKSTLLRLIMGLEEPDEGSITIGKYNIIPSYFEQ
FT                   NQAEALELEKTVIETISQSVPDWTQTEIRSLLGSFGLTNDSVFKEVSQISGGEKARLAL
FT                   ALMIIKPSNLLILDEPTNHLDIPSKQMLEQALSNYNGTALIVSHDRYFISKVANKIVEI
FT                   RDGQLIKYQGDYKYYKEKKIEESQEKEKELQLAERERKRLANREKQRRKKKTKQK"
FT   gene            complement(154034..155212)
FT                   /locus_tag="NATL1_01581"
FT   CDS_pept        complement(154034..155212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01581"
FT                   /product="possible serine protease"
FT                   /note="COG265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74722"
FT                   /db_xref="GOA:A2BZR2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZR2"
FT                   /protein_id="ABM74722.1"
FT                   /translation="MHGLDDNRLLIGSLKLRQKKYFKIFVLVVLIFFNFRYETPLHSSE
FT                   ASLLSQENHNKQSFVSKALNISGDAVVTIETQRQVLSSSEGVFPPGILNDRYFERFFGL
FT                   RGLQVPRSRIEKGQGSGVIFSKEGLVLTNAHVIEKTDQLIVGLSDGRRVLGNVVGEDSL
FT                   TDLAVIKLQAKGPWPTAQLGNSDNLKVGDWAIAVGNPFGLENTVTLGIISNLNRDVAQL
FT                   GISDKRIDLIQTDAAINPGNSGGPLLNSVGEVIGINTLVRSGPGAGLGFAIPINRARKI
FT                   AKDLITSGRAKHPMIGVTLSSNIKQKSNFLSQTEDGAIIKYLMPNGPAEKGGLKVNDLI
FT                   ISINNEKISTPADVVKKINKNNLQSALKIKILRGNIESIKIIKPVDVYDLQV"
FT   gene            155444..155722
FT                   /locus_tag="NATL1_01591"
FT   CDS_pept        155444..155722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74723"
FT                   /db_xref="GOA:A2BZR3"
FT                   /db_xref="InterPro:IPR021355"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZR3"
FT                   /protein_id="ABM74723.1"
FT                   /translation="MLSNFLPFVYGLSVFVLLFLAARIMLNGFFSGQASFKIQNSFSKK
FT                   KGDDRTGLVTVHPELLDKDGSITDEDLLTVRFSKDSDHPQSYEKPSE"
FT   gene            155778..156161
FT                   /locus_tag="NATL1_01601"
FT   CDS_pept        155778..156161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74724"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZR4"
FT                   /protein_id="ABM74724.1"
FT                   /translation="MEQRTRIVAAVLKNMKLPPRFRLRLLKEDPVRLELSLTPAYGKDP
FT                   IQVGLVESLDLVARRDREGRMPRDLQGTWDWTVRHGEVSTGGWNPYLKEALQTMFETGL
FT                   PAIIYEELTGEDYHPVDGARHVR"
FT   gene            156263..156409
FT                   /locus_tag="NATL1_01611"
FT   CDS_pept        156263..156409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01611"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74725"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZR5"
FT                   /protein_id="ABM74725.1"
FT                   /translation="MKDNFEPRYGFVNFAEIWNGRLAMMGILIGLTTELLTGQGILTQM
FT                   GIG"
FT   gene            156443..157603
FT                   /gene="xseA"
FT                   /locus_tag="NATL1_01621"
FT   CDS_pept        156443..157603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="NATL1_01621"
FT                   /product="Exonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="COG1570 Exonuclease VII, large subunit [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74726"
FT                   /db_xref="GOA:A2BZR6"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZR6"
FT                   /protein_id="ABM74726.1"
FT                   /translation="MTDLKNAKQSLNTYSVKELNESIGLLLSRGFAPKFIVEATVSKSQ
FT                   IKKGHLWLTLTDGKASVDAVAWSSTIKSLKFLPKQDDGVVIIGKLNFWESQARVSVQVF
FT                   DIRPSISTVLRKFEIVKSKLFKEGLIDDSLRKKLPKYPHSIGILTSVPSSALADMLRTA
FT                   KERWPLTKLQIIPIPVQGDNANKLKSILSKLKKNKLKLEALIIARGGGSREDLMLFDSE
FT                   IIAREIATFPIPVITGIGHEDDLTVADLVSDHRSATPTAAIVDLLPSREIEKNKFLQNK
FT                   KLLKYYLKLFFQNAKKSLITKKSIFQSYSPRLLIKNKRTRINYMYDILNALSPRKLLKR
FT                   GFALITDESGNSIYSVKNIKENDKLIVQFCDGKITAEVDSLNYDKI"
FT   gene            157670..157921
FT                   /locus_tag="NATL1_01631"
FT   CDS_pept        157670..157921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01631"
FT                   /product="Exodeoxyribonuclease VII"
FT                   /EC_number="3.1.11.2"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74727"
FT                   /db_xref="GOA:A2BZR7"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZR7"
FT                   /protein_id="ABM74727.1"
FT                   /translation="MSNKVTNKKNIEIFKQDINRLSYEESISALETILNNVQDENISLD
FT                   EIQINYIKGHLLLKHCEELLQFCEQEINEINPEFLELD"
FT   gene            complement(157923..158252)
FT                   /locus_tag="NATL1_01641"
FT   CDS_pept        complement(157923..158252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01641"
FT                   /product="possible Zinc finger, C3HC4 type (RING finger)"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74728"
FT                   /db_xref="GOA:A2BZR8"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZR8"
FT                   /protein_id="ABM74728.1"
FT                   /translation="MNKPSSLIWMVFILLIILPTPAGKFIIDLAGGIFLIITIIPLVLG
FT                   GVGWFTWKRIQSKVQTCEACGSTFLNSQMICPICGTPITKNADILENIPASAATIDIKS
FT                   EELDL"
FT   gene            complement(158315..159229)
FT                   /gene="rbn"
FT                   /locus_tag="NATL1_01651"
FT   CDS_pept        complement(158315..159229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="NATL1_01651"
FT                   /product="serum resistance locus BrkB-like protein"
FT                   /note="COG1295 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74729"
FT                   /db_xref="GOA:A2BZR9"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZR9"
FT                   /protein_id="ABM74729.1"
FT                   /translation="MGLNWTKKARWLFSSLWRAYERWSKCDCVDLSAAFAYYTLQSFFP
FT                   ILLISLSVASWFLGKQQGIEQRIIELTAEVLPSEVIALVASTLEQLINQGFGAGILGAM
FT                   FLMITAGNAYLTLQRGADRLWEDVLPVKSKPDPLRLQAFRFIRNRIEAFFVVLLVGILM
FT                   VIDQISANIRLIPEAVLEDLANTTPWVENAITKIPVLQVGQFILPLIGFSTMALLLQGL
FT                   LPSRRVPLKPLIPGALMIGTLLTILNLAVSRSILSLGSRFQAYGFIGGVLVLTLWVWMV
FT                   GVIIYFGQCWSVVIASMRRNRYV"
FT   gene            complement(159362..160180)
FT                   /locus_tag="NATL1_01661"
FT   CDS_pept        complement(159362..160180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01661"
FT                   /product="inositol monophosphate family protein"
FT                   /note="COG483 Archaeal fructose-1,6-bisphosphatase and
FT                   related enzymes of inositol monophosphatase family
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74730"
FT                   /db_xref="GOA:A2BZS0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZS0"
FT                   /protein_id="ABM74730.1"
FT                   /translation="MNQDPISKPLSKAQLIAIHQLVDEVGRRQLQDFGQINSDIKPDGT
FT                   LITECDRWSDKTIVQGLSQIAPGEGVLSEEGKKSIPSSSEYWVVDPLDGTTNFAAGIPY
FT                   WAISIARFTNGEPETAFLDIPALRKRIFAIKGKGVWLNDKPLKPESRFKKNSDCISLCS
FT                   RSIKVLQMKPEQSFPGKIRLLGVSSLNMTSVAIGQTIAALEATPKIWDIAAAWLILEEL
FT                   NCLINWLETNPKDILSGTDLTSVNFPLLTASSEDQLNNMLPWASALIQDS"
FT   gene            complement(160198..161778)
FT                   /locus_tag="NATL1_01671"
FT   CDS_pept        complement(160198..161778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01671"
FT                   /product="possible RND family outer membrane efflux
FT                   protein"
FT                   /note="COG1538 Outer membrane protein [Cell envelope
FT                   biogenesis, outer membrane / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74731"
FT                   /db_xref="GOA:A2BZS1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZS1"
FT                   /protein_id="ABM74731.1"
FT                   /translation="MRRVKRKFLIVAGLFISGLNPLWATSSQKIISDIKIKGNSSKSLS
FT                   QNQKQQRILYELNAPEDLFLPSRSREVLVKTYQKVNLDQLENLLINNNRTIKIYLERVE
FT                   QAKSILKSSLSSWYPTLNLTANGIPQYFESNNYNESSVIQDTSSKQWSSSISAQLKWDL
FT                   INPARVPEIASARDSFEKSKYSYAIILRDLKLEAKKRYFNLQKANEEIEVAKKSIESST
FT                   IGLRDAEIRFESGIGTKLEVLEAKTQLARDQQLFNIKSGDQKIGQRSLAEILNFPEDVT
FT                   PLIGSKTQVTGIWDLSLEDSIIAAYNSREELESILLDISINNSNANAALAASQPKLSIV
FT                   NTSTSSFAKGELNQISPNTSNTSSNFSNTIGLNATWFIFDGGNSRSLYNYNKSKAKEAK
FT                   LNFAARRAQIRQEVEQVFFKLDSAKLNISASYTEVLSARESLRLAKLRYKSGITSQREV
FT                   VNNQRDLTDSEVRYIISVTSYNTLLADLSRQTGLDNIKPCDIKVNQQNQSDIDSKSLYE
FT                   TNLIPLCQL"
FT   gene            complement(161816..163165)
FT                   /locus_tag="NATL1_01681"
FT   CDS_pept        complement(161816..163165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01681"
FT                   /product="possible Fe-S oxidoreductase"
FT                   /note="COG1625 Fe-S oxidoreductase, related to NifB/MoaA
FT                   family [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74732"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR017673"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZS2"
FT                   /protein_id="ABM74732.1"
FT                   /translation="MSTLKITQNKIKPAVVASIEEGSIGEELGFEVGDRLISINGVKPR
FT                   DLIDYKFLMAEENIQLIILDEKDKQHTIDIEKDYDDELGLAFTEALFDGLKQCNNQCPF
FT                   CFIDQQPPGKRKSLYLKDDDYRLSFLYGSYLTLTNLSEQDWKRIDQQRLTPLFVSVHAT
FT                   EPSLRSKLLRNPKAIDLLNQLAWFSKKRIQIHAQIVVCPEINDGKALERTINDLYSFAQ
FT                   GDFPVVLSAAVVPVGLTRFRPSNDGLIPVDPDCATKVINQVEPMQRIFYKSTGSRFAWL
FT                   SDEWYLIAKKALPTLNSYEDLPQKENGVGSIRSFLRAMDEATRDLPTKIDQKKTCSWVV
FT                   GKLVENELLKPCKRINKINNFALHLYGLPSPYWGQEQIVTGLLTGQDLIKGLRGKELGD
FT                   ELLIPSVMLRQGEKIFLDDMTLQELSLSLNVSVRIVHDAQDIVNKALGKA"
FT   gene            complement(163361..163558)
FT                   /locus_tag="NATL1_01691"
FT   CDS_pept        complement(163361..163558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01691"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74733"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZS3"
FT                   /protein_id="ABM74733.1"
FT                   /translation="MSLALTGRTFLDLWDWWDCLSKSELIKLSWFSAQPSMNLHSSRYP
FT                   YQTVFGIQIIKFLKKILKIA"
FT   gene            163558..164217
FT                   /locus_tag="NATL1_01701"
FT   CDS_pept        163558..164217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01701"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74734"
FT                   /db_xref="GOA:A2BZS4"
FT                   /db_xref="InterPro:IPR021468"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZS4"
FT                   /protein_id="ABM74734.1"
FT                   /translation="MQFWASTMVVLPVFVQAPWVHVFPFSAFLFSFIIFFLGFYLLKFC
FT                   SDRWSSIGSLLVGVSWSWLGGCLFWGWLRAHPVWHLPVESIALPIAVSLLQTRWKIGAS
FT                   FYLASLLGTAFTDVMIVLTGVMKAWPEVVDAPFSEASKMLSFTAEQLLEPLSLFAILIA
FT                   ALLIILIANWMHQKSKSEPLSSDAWLVSSSALTTTLWVDGLFFATTLIQPQLSGLI"
FT   gene            164231..165931
FT                   /gene="nadB"
FT                   /locus_tag="NATL1_01711"
FT   CDS_pept        164231..165931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="NATL1_01711"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="COG29 Aspartate oxidase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74735"
FT                   /db_xref="GOA:A2BZS5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZS5"
FT                   /protein_id="ABM74735.1"
FT                   /translation="MDLNTGFNKNDIYSTNWDVIVIGAGAAGLMSSLELPSNLKILLLN
FT                   RNTSKRSSSRWAQGGMAAVTRIEDSEDIHANDTIKAGAGLCDLEAVQMFVHSAPRLVDR
FT                   LLKLGMEFDRTSGKLSTTLEAAHTHRRVLHVKDRTGKALVDVLNEQVDQRGNVLHQRGI
FT                   RVTQIWVERGKCSGVQVLDGPALRWIKAKAVVLATGGGGHLFANTTNPTQAAGEGIALA
FT                   WRSGACIEDLEFFQFHPTALKLDNAPSFLISEAVRGEGAVLVDSFGESPVAHLEGKDLA
FT                   SRDQVSRALFQAMQKQKVDHIGLDVKSISVEDVEARFPSIFQRCRELGLEPLKEAIPVA
FT                   PSAHYWMGGVATNLKAQTNVKGLFAIGEVACTGLHGANRLASNSLMECLVFANQMRNIE
FT                   LNDFITSDISGNNLSFNKSDLRFSKEQGTSYLSKEIEKLRQLCWREAGVDRSRKGMNSA
FT                   LVKVKQDYQNLLTEPLLNLVFSQSKYEIHEFEELARRDLNLLLDLSNRQMSSLLMLEAC
FT                   LFREESRGGHFRDDFPTSVPFWQCHTRQMKGKNIHTRPIVDKAGFPKNL"
FT   gene            complement(165918..166859)
FT                   /locus_tag="NATL1_01721"
FT   CDS_pept        complement(165918..166859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01721"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4243 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74736"
FT                   /db_xref="GOA:A2BZS6"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZS6"
FT                   /protein_id="ABM74736.1"
FT                   /translation="MGPSRLKSRRRQDLGSKWARVAIAILSTVGVIDTGSITLNKWGII
FT                   GNLNCPGGLGGCDKVLNSPWGTFFQTNNFSIPLSLIGLISYLLILLMAIFPLTPILKNQ
FT                   KTNISKVAWWGSFYISTSTFIFSLILISVMIFKIKAFCFFCLLSFLISLSVLLLNIIGG
FT                   SWEDYGKLFFRGFLMSVAVLLAGLIWSSSVDPAIKEVSNNISGMPPAVIAISSPNKIKL
FT                   AEHLTEEGAVMYNAYWCPHCHDQKEMFGKEAAEKLNLVECAKDGFNNKRELCEAKGITG
FT                   FPSWEINGSIDSGVKSLEELADLTNYKDSKDF"
FT   gene            complement(167037..167129)
FT                   /locus_tag="NATL1_01731"
FT   CDS_pept        complement(167037..167129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01731"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74737"
FT                   /db_xref="GOA:A2BZS7"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZS7"
FT                   /protein_id="ABM74737.1"
FT                   /translation="MGILFYLVFVGAGLSAAFLIQKALKAIKLI"
FT   gene            complement(167192..167593)
FT                   /locus_tag="NATL1_01741"
FT   CDS_pept        complement(167192..167593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01741"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74738"
FT                   /db_xref="InterPro:IPR017260"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZS8"
FT                   /protein_id="ABM74738.1"
FT                   /translation="MNNLDLQEDLINSIKLLDAKLSKRQIKLDPKGYFLIKIEPKTNEL
FT                   ILEHYLNDIDQKGRAIDPKSGELIGCKTKSINQPNNIYRGKSAKQLGIQISEGHGPFPI
FT                   GHLDHAIYIGRELQRAEQCLITGKQYIQD"
FT   gene            complement(167675..167941)
FT                   /locus_tag="NATL1_01751"
FT   CDS_pept        complement(167675..167941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01751"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74739"
FT                   /db_xref="GOA:A2BZS9"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZS9"
FT                   /protein_id="ABM74739.1"
FT                   /translation="MTDNNLLDSPETNKSLSTEKDTVDSNEEKPFFAQGIFSYKDKGTQ
FT                   GVITLFGYELTAPAGLKNPGIVYLSFIFINLLIFLILKSFISG"
FT   gene            complement(167973..169154)
FT                   /locus_tag="NATL1_01761"
FT   CDS_pept        complement(167973..169154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01761"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3146 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74740"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZT0"
FT                   /protein_id="ABM74740.1"
FT                   /translation="MNNIKIKWHATIQEIPKIIWNNFLKGNSTPFYKWDWLNALERSKS
FT                   VSTKYGWQPLFLSAWSENNLIACAPLYLKSHSYGEFIFDNAFVQLAQDMGLQYYPKLIG
FT                   MSPLSPIEGYRFLFAEGVNDRDLTQILISEIDSFAKQNGILSCNFLYVDPKWMKVAESL
FT                   NCAKWVNQQSLLTLNEEKSFSDFLQKFNSNQRRNIKRERESIKKCGVKVEALSGSQIDV
FT                   MNLKKMHYFYQLHCSRWGVWGSKYLTESFFTELRSTELKENIVLFDAKEVGIDKTIGMS
FT                   LCVKNENMLWGRYWGAEKNIDNLHFEACYYSPIEWAIANKIKYFDPGAGGSHKKRRGFI
FT                   AKPNASLHRWYNLPMDSLIREWLPRANKLMLDQINATNNEVPFKFEEPKLSNT"
FT   gene            complement(169177..169854)
FT                   /locus_tag="NATL1_01771"
FT   CDS_pept        complement(169177..169854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01771"
FT                   /product="RibD/ribG C-terminal domain"
FT                   /EC_number="1.1.1.193"
FT                   /note="COG1985 Pyrimidine reductase, riboflavin
FT                   biosynthesis [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74741"
FT                   /db_xref="GOA:A2BZT1"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZT1"
FT                   /protein_id="ABM74741.1"
FT                   /translation="MKKKWVKLVLASSIDGRIAYPEGGKTQLGQSGDRLVLEESLAWSD
FT                   GILMGGQTLRDHQSICLIKNKSLLKKRTSKGKNEQPIALIASNQIDFPENWLFFQQPLQ
FT                   RWLLQMQDKKNEIMLPDGFDKRINLRITWRDSLDDLYQKGIAKIVLLGGANLISAFLLE
FT                   NLIDELQITITPHLIGGDYCWVSSELKNLNTIMNKKNNWILKESKKLGNNELLIRYFRN
FT                   HLS"
FT   gene            complement(169855..170781)
FT                   /locus_tag="NATL1_01781"
FT   CDS_pept        complement(169855..170781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01781"
FT                   /product="6-pyruvoyl tetrahydropterin synthase"
FT                   /EC_number="4.2.3.12"
FT                   /note="COG720 6-pyruvoyl-tetrahydropterin synthase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74742"
FT                   /db_xref="GOA:A2BZT2"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZT2"
FT                   /protein_id="ABM74742.1"
FT                   /translation="MEAITSNFPHGEGRTCVITRRACFSASHLYRLPELSDDDNSALFG
FT                   PCSIAPGHGHNYELIVTMEGDLNKYGMVLNLSDVKYAIKNEVTSQLDFRFLNDTWPEFD
FT                   LSKPEGCLPTTESLVRIIWERLKSHLPLKSLRLYENPKLWADYQGNAMDAYLTVQTHFS
FT                   AAHRLAREDLPQTENEKIFGKCARPNGHGHNYLVDITVKGKINPRTGMICDLSALNSLI
FT                   NDLVVEPFDHTFLNKDIPYFANCVPTAENIALHISDKLTNPINAIGANLYKIKLQESPN
FT                   NAAEVYANLPESTIDTKDSKNQVGLLR"
FT   gene            170834..171430
FT                   /gene="aroK"
FT                   /locus_tag="NATL1_01791"
FT   CDS_pept        170834..171430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="NATL1_01791"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="COG703 Shikimate kinase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74743"
FT                   /db_xref="GOA:A2BZT3"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZT3"
FT                   /protein_id="ABM74743.1"
FT                   /translation="MAVQSTPKTLKEKLGGRNIFLIGMMGSGKSQTGPVLAKMINYAFV
FT                   DTDDVIEKASKQSISSIFEKDGEKVFRDVEKKVLKEISQHHSLVIATGGGLVTLPENWG
FT                   ILHQGIVIWLDLDLRRSIKRLESDQKRRPLLLGDNLAENFSQIYESRKPIYLESDLRIE
FT                   VEDQSPYEVATMVAEHLPSILIDPETQAERHTTEL"
FT   gene            complement(171384..171647)
FT                   /locus_tag="NATL1_01801"
FT   CDS_pept        complement(171384..171647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74744"
FT                   /db_xref="InterPro:IPR021954"
FT                   /db_xref="InterPro:IPR038150"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZT4"
FT                   /protein_id="ABM74744.1"
FT                   /translation="MSDPLIREMDNYVVLVPGESEQFLDKEQTLLWLQSWLNKFDSLPL
FT                   DLDCKSSIAEAAQHLLDTACDLEIKTGFTIQWYAVRLESPGQ"
FT   gene            171646..172377
FT                   /locus_tag="NATL1_01811"
FT   CDS_pept        171646..172377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01811"
FT                   /product="possible POLO box duplicated region"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74745"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZT5"
FT                   /protein_id="ABM74745.1"
FT                   /translation="MRQKFFFFLISILIVFTYTVPTLAESSLEINNFQPSKLYERKSIW
FT                   PDWRLPSSIKRPGLKDDLIYPDWFEGVWDVTSEIESDQNQEPMIHSAKFIRNTSGDLIA
FT                   DREYNTKSYALSTKTGGFLSVKNDPKSPNRQFAKLTEDRYLETKIIGRLQEKIDNNIFI
FT                   TDELILQILHTPEFSRVSQVETLTEFKKCGSIQNNKINMSDFNICGEQFQAIYNQPGQN
FT                   LISLPIKTEKSKLILRKTNDD"
FT   gene            complement(172364..173083)
FT                   /locus_tag="NATL1_01821"
FT   CDS_pept        complement(172364..173083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01821"
FT                   /product="putative glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="COG625 Glutathione S-transferase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74746"
FT                   /db_xref="GOA:A2BZT6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZT6"
FT                   /protein_id="ABM74746.1"
FT                   /translation="MLELHQFRHSPYCLKVRMALAAKKLEYRTVEITPAIGQIDIFQKT
FT                   GQKKLPVLFDNETTIHDSSSIIRHLEKIEIEPKLIPEGLKEACQVQIIENWADTTLAKS
FT                   IKIVFLEELTKNPKLISSLFSNKISDSMQKPLFNIPTKIASQISGLINQKEKESLKLNL
FT                   ENLSNLINQENFLIGDKLSIADISVASHLSLLKFPNSSGENLTGQGCSIYLNDPSLQNL
FT                   FKWRDFIEDQLAIANHH"
FT   gene            complement(173095..173259)
FT                   /locus_tag="NATL1_01831"
FT   CDS_pept        complement(173095..173259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01831"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74747"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZT7"
FT                   /protein_id="ABM74747.1"
FT                   /translation="MIGLLPRLINGEIAAVKTPKTIVMRYFGYLETLEKNSPIVHHQKT
FT                   ELIATLLTI"
FT   gene            173144..173350
FT                   /locus_tag="NATL1_01841"
FT   CDS_pept        173144..173350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74748"
FT                   /db_xref="GOA:A2BZT8"
FT                   /db_xref="InterPro:IPR008470"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZT8"
FT                   /protein_id="ABM74748.1"
FT                   /translation="MGEFFSNVSRYPKYLITIVLGVFTAAISPLIKRGSNPITAIALVG
FT                   ALLSGLLTIVFLLKAMAFPTPIT"
FT   gene            173353..173724
FT                   /gene="rbfA"
FT                   /locus_tag="NATL1_01851"
FT   CDS_pept        173353..173724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="NATL1_01851"
FT                   /product="Ribosome-binding factor A"
FT                   /note="COG858 Ribosome-binding factor A [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74749"
FT                   /db_xref="GOA:A2BZT9"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZT9"
FT                   /protein_id="ABM74749.1"
FT                   /translation="MANSRRVEKLAALLKREISELLVNGIRDERIHQAMITITSVEVSG
FT                   DLQHARIFISLFGEEKKKDQVLVGLEEAKGFIRAELARRLQMRRSPELVFKIDKGMTKG
FT                   PEVLDLLNALELERKSKDL"
FT   gene            173742..175376
FT                   /locus_tag="NATL1_01861"
FT   CDS_pept        173742..175376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01861"
FT                   /product="Possible beta-N-acetylglucosaminidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="COG1472 Beta-glucosidase-related glycosidases
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74750"
FT                   /db_xref="GOA:A2BZU0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR041518"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZU0"
FT                   /protein_id="ABM74750.1"
FT                   /translation="MNKSDLRRQVAELFIVRASGFNLDSQRLYPNLEESNSNLKRLLEE
FT                   GVGGVIVLGGTVKELEIRCNILKKWSGKPLLLCADIEEGVGQRFYGGIKFVPPMGISQI
FT                   YKKDQTLAISIAEKIGYFTGKEAKKIGLNWLLAPVCDINNNPNNPVINLRAWGEEPETV
FT                   KSLTCAFQRGVSRSKMLTCAKHFPGHGNSEVDSHLDLPEIHNDLSKLEKFELIPFKSLI
FT                   NQGVNSVMIGHLLFPKIDPIFPATLSKRVVTDLLRIKFKYDGLVVSDALVMNAITNKYS
FT                   SGEAAVMAFDAGIDLIMMPKDIDEAIDSLADAFYSGKISLERLNISRERRKKQLDLVSN
FT                   EDDFKKEDLNNEDIKNEFLLDASKFSNSIIKSSIFVREESTIKAEFNDINLIQIDNFDQ
FT                   VPNKFIPALDIPKAVGFKNLIIHPLGISPWGKTNKKFLEMGQFSNSKILVQLFVRGKPF
FT                   IGLDYHNDHWIDALKSLEIEERLSGIIIYGCPYLFDKIKKSIHKNIPLAYSPSQTEEAQ
FT                   NQILSRILQSKTTQKEIDKESSIEFTD"
FT   gene            175478..176263
FT                   /gene="hemD"
FT                   /locus_tag="NATL1_01871"
FT   CDS_pept        175478..176263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="NATL1_01871"
FT                   /product="putative uroporphyrinogen III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="COG1587 Uroporphyrinogen-III synthase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74751"
FT                   /db_xref="GOA:A2BZU1"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZU1"
FT                   /protein_id="ABM74751.1"
FT                   /translation="MALTDKKIIITRALEQTSEAREIFRKNGAEVFDLPSLVIGPPDDW
FT                   EPLDGALKEITTFDWIIFSSANGVRNVDERMKEIGLSLSEISENIQIAAVGRKTASLLE
FT                   DMDVKVSFVPPSFVADSLVEYFPQNQKGLKLFIPRVQTGGRSILSDSFKLKGAEVTEVA
FT                   AYESSCPKDIPQKTIDALNSGQIDIIAFTSSKTVKNTVSLFTKHFGENWLKLIQKIQLV
FT                   SIGPQTTISCKNLIRKPDKEASPHDLEGLLQACLELNFN"
FT   gene            complement(176266..176718)
FT                   /locus_tag="NATL1_01881"
FT   CDS_pept        complement(176266..176718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01881"
FT                   /product="Predicted integral membrane protein"
FT                   /note="COG5637 Predicted integral membrane protein
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74752"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZU2"
FT                   /protein_id="ABM74752.1"
FT                   /translation="MGKWLDHTVISEIHAPVELVWKFWSDLDSMPLWMTWIESVKPVDK
FT                   KTSTLPDLTEWTLAANGFRFKWKAQITERVEAEKLEWKSVGGLPTKGSVRFYSEESSKT
FT                   VVKLKISYELPQVLANLMKANILGGMVTKELQKNLDGFKDLVEKSG"
FT   gene            complement(176722..178182)
FT                   /gene="crtQ"
FT                   /locus_tag="NATL1_01891"
FT   CDS_pept        complement(176722..178182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtQ"
FT                   /locus_tag="NATL1_01891"
FT                   /product="zeta-carotene desaturase"
FT                   /EC_number="1.3.5.6"
FT                   /note="COG3349 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74753"
FT                   /db_xref="GOA:A2BZU3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014103"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZU3"
FT                   /protein_id="ABM74753.1"
FT                   /translation="MKIAIIGAGLAGLTAAVDLVDEGHDVDLYEAKPFIGGKVGSWEDS
FT                   DGNHIEMGLHVFFFNYANLFSLMRKVGAFENLLPKDHTHLFVNKGGDIKSLDFRFFAGA
FT                   PFNGLKAFFTTPQLNLIDKLRNALALGTSPIVRGLIDYEGAMKTIRSLDSISFQKWFLN
FT                   HGGSLNSIERMWNPIAYALGFIDCEAISARCMLTIFMMFASKTEASKLNLLKGSPHKWL
FT                   TKPILDYIEQRGGKLHLENIVKEIHSEDSDHPSVTGITLQTPEGEQTIKADKYLAACDV
FT                   SGIKRIIPRSWRRFKEFDSLFKLDAVPVATVQLRYDGWVTEINNQQAQKNLESPSGLDN
FT                   LLYTADADFSCFADLALSSPEDYKKEGQGSLLQCVLTPGDPWITKSSDEIVKHTDLQVR
FT                   TLFPSSRGLKLLWSNVVKVSHSLYREAPGMEPYRPDQKTSFSNFFLAGSYTKQDYIDSM
FT                   EGATMSGHLAASAMLSKSVSLAKNSSVA"
FT   gene            178288..178677
FT                   /locus_tag="NATL1_01901"
FT   CDS_pept        178288..178677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01901"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG316 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74754"
FT                   /db_xref="GOA:A2BZU4"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZU4"
FT                   /protein_id="ABM74754.1"
FT                   /translation="MSESSAPPTTHKAQGGKGVLITTPALDQLSRLCKEQGSGKLLRVG
FT                   VRSGGCSGMSYTMDFVSDDDIQKDDEVYEYSVGSSSFKVICDPKSLLYIYGMQLDFSTD
FT                   LIGGGFNFTNPNASQTCGCGSSFAV"
FT   gene            178713..179132
FT                   /locus_tag="NATL1_01911"
FT   CDS_pept        178713..179132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01911"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74755"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZU5"
FT                   /protein_id="ABM74755.1"
FT                   /translation="MDQSEESLFEEALNRYKAGSQADELIEDFQKIVSTTPNNAAAWTC
FT                   LSWLQLLCNSPQEALRSARYAVKLNGQDPQSRINLSLALLETNSKGVRDHIDYVKRAML
FT                   VLPELEKELKESFEDGLSRKPNWKTLIKIKNWLDL"
FT   gene            complement(179159..180088)
FT                   /locus_tag="NATL1_01921"
FT   CDS_pept        complement(179159..180088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01921"
FT                   /product="putative cell division inhibitor"
FT                   /note="COG1090 Predicted nucleoside-diphosphate sugar
FT                   epimerase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74756"
FT                   /db_xref="GOA:A2BZU6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZU6"
FT                   /protein_id="ABM74756.1"
FT                   /translation="MKLLLTGCTGFIGRELIPLLINEGHSLTVISRQSQGKVQTIANDQ
FT                   NINFIQMNPAESSSWDKEEIQNSLKSCEGVINLAGEPIAEKRWTTDHCKEITNSRIETT
FT                   KNLIKSLRNLRKSPKVLINASAIGFYGSHPQTEFTEENIPGNDFLANLCKEWESIAKNK
FT                   PRATRLLIVRIGIVLAKDGGALGKMLPIFRAGLGGPIGDGKQWMSWIHRTDLCNLINAS
FT                   IKNSAWSGVVNGVAPNPVRMNEFSNSLGQVLGRPSLLAVPGPVLKLILGDGARVVLEGQ
FT                   NVKPQRLNKLKFKFSFPAINDAFQSILA"
FT   gene            180277..180540
FT                   /locus_tag="NATL1_01931"
FT   CDS_pept        180277..180540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01931"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74757"
FT                   /db_xref="GOA:A2BZU7"
FT                   /db_xref="InterPro:IPR020905"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZU7"
FT                   /protein_id="ABM74757.1"
FT                   /translation="MSEQTGKVDDSQSPPKVQKKLRKGDLVKVDREKYSNSLESKASDT
FT                   NLPEYIFQGPGEVLLIKGDYCQVRWRRPVPDVWMNSDHIVSY"
FT   gene            complement(180560..181213)
FT                   /locus_tag="NATL1_01941"
FT   CDS_pept        complement(180560..181213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01941"
FT                   /product="possible heat shock protein DnaJ"
FT                   /note="COG2214 DnaJ-class molecular chaperone
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74758"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZU8"
FT                   /protein_id="ABM74758.1"
FT                   /translation="MSKDPYQILKVYPSAKLEEIKKAYRKLVKIHHPDKGGDAAVMLEI
FT                   NSAWEILKKKHKDLNLNKVNNSKLYNQNEYKREANNHSKPEDLKKWFQNIYLPIDKLLG
FT                   QIINPLGAKIRDLSADPYDEILMDSFCLYLEQSKNKITKIKKIYTSFACPSIIRDFSLD
FT                   LYHCLSHVEDGINELERYTMGYVDNYLHDGKAMIAFAKKKRKFLQSNKKEWLHL"
FT   gene            complement(181234..182202)
FT                   /locus_tag="NATL1_01951"
FT   CDS_pept        complement(181234..182202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01951"
FT                   /product="O-acetylserine (thiol)-lyase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="COG31 Cysteine synthase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74759"
FT                   /db_xref="GOA:A2BZU9"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZU9"
FT                   /protein_id="ABM74759.1"
FT                   /translation="MPIANDITYLVGQTPLVKLNRLPNEFNCRAEIIAKLESFNPTASV
FT                   KDRIAGAMVKSAEKEGTIKPGHTVLVEPTSGNTGIALAMVAAAKGYRLILTMPDTMSTE
FT                   RRSMLRAFGAELQLTPGQDGIQGAIQLAKELVASVPNAYLLQQFDNLSNPEIHEKTTAE
FT                   EIWEDCEGKLDALIAGVGTGGTITGCARFLKQKNPKIKVFAVEPSSSPVLSGGNPGSHA
FT                   IQGIGAGFIPNVLDMNQIDEVIRINDNEAMDIGRRLAKEEGLLSGVSSGAAVAAALKVG
FT                   NQPEFANKRLIVILPSFGERYLSTTMFTSIPAKPVKGNEFL"
FT   gene            complement(182247..182366)
FT                   /locus_tag="NATL1_01961"
FT   CDS_pept        complement(182247..182366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01961"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74760"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZV0"
FT                   /protein_id="ABM74760.1"
FT                   /translation="MGNALGQYQRIIPPIYISKRPIKLLNNKFSSIIKKELNY"
FT   gene            182340..183911
FT                   /locus_tag="NATL1_01971"
FT   CDS_pept        182340..183911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01971"
FT                   /product="Hypothetical protein"
FT                   /note="COG1807 4-amino-4-deoxy-L-arabinose transferase and
FT                   related glycosyltransferases of PMT family [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74761"
FT                   /db_xref="GOA:A2BZV1"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZV1"
FT                   /protein_id="ABM74761.1"
FT                   /translation="MILTESISHNCRPPILWIFLFWTIACGIAFVSLGNLPLRDFDEAT
FT                   VARVALELNQKSGLERLLPSIWDKPYLNKPPGLHWIISFAIGISRSFQNNFDFLPSEFC
FT                   IRFFPALFSTFVVPLGGLIQWNLRPKDRIACITTSAILLTLLPIIRYGRMAMLDGTQLS
FT                   AIALLWFCLSSIKNNRPTNFNFLGAGFTCSFMLLLKAPVIIPALFASLLPLIWEYNSKK
FT                   YFNNFSWSWFFYGLIPGFAWHVWNFISYGSGAFWLWWGDGAGRVLFEKGSGSELGVLVP
FT                   IIEILEGGWPWILLWPIGFLWACLSLNTRWGVWALSTQIIILGSILPLKMQLPWYIHPF
FT                   WLPFALVCGPPVSWLIQREENGYIFARKILRKIPYIFSLIGLCILTFSLLLKLNIFNIG
FT                   EGYFYSIFFISLAWFIGGLLLSNSRKNIRKIGFIGLIVGSIIGLFFFVSSKFWLWEINE
FT                   NWDVRPVAEFIDGFPNQQIFIKNSFERPSLNWYAGKQIKSFDEEDKTKCKVIKKTNAWD
FT                   LYTCND"
FT   gene            183995..184255
FT                   /locus_tag="NATL1_01981"
FT   CDS_pept        183995..184255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01981"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein in cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74762"
FT                   /db_xref="InterPro:IPR020885"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZV2"
FT                   /protein_id="ABM74762.1"
FT                   /translation="MYCIELTIKLSPMPLVVQRKEHGEAKRLYSDVVESIKNGNPRLLE
FT                   LTCEKVEDKRITVLVSEITAVQIYEKTSSSTSKRPGFSLQN"
FT   gene            184279..184965
FT                   /locus_tag="NATL1_01991"
FT   CDS_pept        184279..184965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_01991"
FT                   /product="possible ABC transporter, ATP-binding component"
FT                   /EC_number="3.6.3.29"
FT                   /note="COG1122 ABC-type cobalt transport system, ATPase
FT                   component [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_01991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74763"
FT                   /db_xref="GOA:A2BZV3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZV3"
FT                   /protein_id="ABM74763.1"
FT                   /translation="MEPTTWSGYLEFDQVSFSWPNGVNVINQCSFSIVKPGLWMLVGEN
FT                   GSGKSTLFRLINGGIRPKSGKIFCSLRPSMVYQNPDHQLLMPTCKSELMLSVPKTIPQT
FT                   NLLDLIHSALEKVDLGEMLDRPIHTLSGGQKQRLALAGAIVSNSNLLLLDEPTALLDPQ
FT                   SQNSVLKVMKKLTSSSADPITAIWVTHRLEELYFCDGAAIVKNGAISNWNSGSKVFQEL
FT                   KSLALR"
FT   gene            184995..185066
FT                   /locus_tag="NATL1_tRNAAsnVIMSS1309217"
FT                   /note="tRNA-Asn"
FT   tRNA            184995..185066
FT                   /locus_tag="NATL1_tRNAAsnVIMSS1309217"
FT                   /product="tRNA-Asn"
FT   gene            185406..186203
FT                   /gene="rpaA"
FT                   /locus_tag="NATL1_02001"
FT   CDS_pept        185406..186203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpaA"
FT                   /locus_tag="NATL1_02001"
FT                   /product="two-component response regulator"
FT                   /note="COG745 Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74764"
FT                   /db_xref="GOA:A2BZV4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZV4"
FT                   /protein_id="ABM74764.1"
FT                   /translation="MKPCILLIEDDQDMRDLVAGHLEHTGFDVQKAEDGIKGQALALQY
FT                   APDLILLDLMLPKVDGLTLCQRLRRDERTSAIPILMITALGGIKDKVTGFNSGADDYIT
FT                   KPFDLEELQVRIKALLRRTNRAPLGSNNQQEILDYGPLTLVPERFEAIWFESPVRLTHL
FT                   EFELLHCLMQRHGQTVAPSLILKEVWGYEPDDDIETIRVHVRHLRTKLEPDPRKPRFIK
FT                   TVYGAGYCLELPTGDKISEIQPSMIQARETNSFKNNTDERVIA"
FT   gene            complement(186200..187159)
FT                   /gene="holB"
FT                   /locus_tag="NATL1_02011"
FT   CDS_pept        complement(186200..187159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="NATL1_02011"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74765"
FT                   /db_xref="GOA:A2BZV5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZV5"
FT                   /protein_id="ABM74765.1"
FT                   /translation="MDNFQNICGQDLAIKILKSAISKEHISHAYLFSGPEGVGRKKTAK
FT                   IFIKSILDQNQEKKSTKRKINNNNHPDLLWVEPSYIVQGQSISQTKAILDGISMKSPPQ
FT                   IRLNQIKEIIEFLGKKPFESERSIVIIEDIERINESAANALLKTLEETCTGLFILITQR
FT                   PEKLLSTIRSRCQIVPFIRLNDNQVNKIIEKSEVVQEIDDIPSEKIKELIDFSNGSPGR
FT                   CIVNLQFWLSFSTSLRQKLEIQLNNPIELLQLAKEITDELNIEQQLWLIDFQQNRAWIK
FT                   EKNSNIVVQLEELRKQLLKFVQPRLAWEVTLLEINFLN"
FT   gene            complement(187161..187796)
FT                   /gene="tmk"
FT                   /locus_tag="NATL1_02021"
FT   CDS_pept        complement(187161..187796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="NATL1_02021"
FT                   /product="Thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="COG125 Thymidylate kinase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74766"
FT                   /db_xref="GOA:A2BZV6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZV6"
FT                   /protein_id="ABM74766.1"
FT                   /translation="MKGKFIVFEGIDGSGKTTQINQLSKWLISTDLIPENNKLVITREP
FT                   GGTQLGKSIRSLLLDTSIEKSPDSITELLLYAADRSQHVNEIIRPTLDQGDWVISDRFC
FT                   GSTLAYQGYGRKLDITLIKDLEAIATQGIAPDITFLLDIPIEESIRRRRNRKDDRIEKE
FT                   GREFLSNVSLGFQALSEDSHWKKISAIDSKEKIISEIKSEIKKLIKNK"
FT   gene            complement(187793..190123)
FT                   /gene="zntA"
FT                   /locus_tag="NATL1_02031"
FT   CDS_pept        complement(187793..190123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zntA"
FT                   /locus_tag="NATL1_02031"
FT                   /product="putative P-type ATPase transporter for copper"
FT                   /EC_number="3.6.3.4"
FT                   /note="COG2217 Cation transport ATPase [Inorganic ion
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74767"
FT                   /db_xref="GOA:A2BZV7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZV7"
FT                   /protein_id="ABM74767.1"
FT                   /translation="MSNKKIAQSKKSILLDIDGMRCGSCVQAVEKILKNHPNINNASVN
FT                   LVTKTALVEIKEPNYPFADVIQTLTSKGFPTRERPDQTITKNTELERNENQNLWNKWRQ
FT                   LIIATSLLILSGLGHLIEGQQISFPLIGSLPFHAALATFALLGPGKSILNAGIKSAIML
FT                   TPTMDTLVSLGVMSAYIASIIALIWPTVGWPCFFNEPVMLLGFVLLGRFLEERARINTG
FT                   TALKELAKLQPETANLILDNNEIREIRIGALRPGEKIQLLAGDRIPVDGLVIKGNSAID
FT                   ISSLTGESLPLEAKPGVELPSGSLNLESTITLEVQKIGSETAIAKIISLVEEAQARKAP
FT                   IQGLADKVAGMFCYGVTTLSLITFLFWWRIGTRIWPEVLEVSNTGFMHSHNLHDHLMNT
FT                   PQTPIGLSFQLSIAVLVVACPCALGLATPTVITVASGEAAKRGWLFKGGDVIEMASKIS
FT                   QIIFDKTGTLTIGRPLVVGCWKNNESERNFMLKLAASIELESRHPLAQAIIQEAHKKEI
FT                   KLEKVSSSTTYPGKGLAGKINNLEGLIRVGTPEWIKSEGIEWNEMIENNFKLSKRKAQS
FT                   IVAVALDNKLLGFFLIDDQIRKDAFLSINKLRSRGFSLSLFSGDRDSAVLSIGEKLGFS
FT                   AKQVTWQMLPSDKLNKLNLLKNNGLVAMIGDGINDAPALAAADLGVAIGTGTQIAQDSA
FT                   DLVLLGENLEALPNAFNLSKQAMLKIKQNLAWAFGYNLIALPIAAGLLLPSSGLLLSPP
FT                   LAALLMALSSISVVLNALSLKSK"
FT   gene            190286..190807
FT                   /locus_tag="NATL1_02041"
FT   CDS_pept        190286..190807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02041"
FT                   /product="cyanobacterial conserved hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74768"
FT                   /db_xref="GOA:A2BZV8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022818"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZV8"
FT                   /protein_id="ABM74768.1"
FT                   /translation="MPRSQNKDNFLDKAFTKMAEGIVKVMPIDSKEKEAYLYYRKGLAA
FT                   QNDGDYSEALEYYEESLKLEDNQVDRGETLKNMAIIYMSNGDEERALNTYKKALGQNPK
FT                   QPSCLKNMGLIYEKRGRMAQRNGNQDECDIWFDQAAEVWSKAVRLYPGGYLDIENWLKT
FT                   TGRGNVDVYL"
FT   gene            complement(190824..192203)
FT                   /gene="sms"
FT                   /locus_tag="NATL1_02051"
FT   CDS_pept        complement(190824..192203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sms"
FT                   /locus_tag="NATL1_02051"
FT                   /product="putative DNA repair protein RadA"
FT                   /note="COG1066 Predicted ATP-dependent serine protease
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74769"
FT                   /db_xref="GOA:A2BZV9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZV9"
FT                   /protein_id="ABM74769.1"
FT                   /translation="MSRSVSIYVCQSCGAQTRQFFGRCNNCGEWNSIIEEKINQKSDKS
FT                   IYTKINSPKEKSPYRSELISQTKNQLIERISSGYKELDRVLGGGLVPGSLVLIGGDPGI
FT                   GKSTLILQSATEMAHHRSVLYVAAEESAQQVKLRWNRIEDAESNLHLLAETDLEMVIKE
FT                   LDHLKPEVAVIDSIQALHDQNLSSSPGSVAQVRECSAALQQIAKRQNISLLIIGHVTKD
FT                   GMLAGPKVLEHLVDAVLTFEGDRFASHRLLRGVKNRFGATSELGVFEMQADGLSEVPNP
FT                   SELFLSKTSAPGISTIVTCEGTRPLAIDIQALLNPTSYASPRRTTTGIEINRLHQILAV
FT                   LEKNMNLSLSRYDCYLAVAGGLEVEEPGADLGIAAAIVSSFKDIELEEGVVFIGEIGLA
FT                   GQLRLVRQMQQRINEVIRLGYKTLIIPDGIDTSEFETNQKLKILKASNINQALIYALDN
FT                   N"
FT   gene            192311..193057
FT                   /locus_tag="NATL1_02061"
FT   CDS_pept        192311..193057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02061"
FT                   /product="two-component response regulator"
FT                   /EC_number="3.1.1.61"
FT                   /note="COG745 Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74770"
FT                   /db_xref="GOA:A2BZW0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZW0"
FT                   /protein_id="ABM74770.1"
FT                   /translation="MTATSPSKETILVADDEASIRRILETRLSMIGYQVVTACDGNEAL
FT                   DLFRNCEPDLVVLDVMMPKLDGYGVCQELRKESDVPIVMLTALGDVADRITGLELGADD
FT                   YVVKPFSPKELEARIRCLLRRVEKEQIAGLPNSGVIAVMNLKIDTNKRQVYRNDERIRL
FT                   TGMEFSLLELLVSRSGEPFSRGEILKEVWGYTPERHVDTRVVDVHISRLRSKLEDDPAN
FT                   PELILTARGTGYLFQRIVDSMIPEGS"
FT   gene            193062..194387
FT                   /gene="plsX"
FT                   /locus_tag="NATL1_02071"
FT   CDS_pept        193062..194387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="NATL1_02071"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="COG416 Fatty acid/phospholipid biosynthesis enzyme
FT                   [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74771"
FT                   /db_xref="GOA:A2BZW1"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZW1"
FT                   /protein_id="ABM74771.1"
FT                   /translation="MEKNHLNNKTNRSKAIRRLVIWYRRNSAVTSLVDTATSSATAASN
FT                   VAGTVVSNAGSVVTNAGSIARSTLEPFVFDPLRRLQGGESTGEKNTIEDSDRIWVAVDG
FT                   MGGDYAPGAILDGCLKSLSLLPLKIKFVGEVEKVEKAAIEFGLKESLDKAMEDGKFQLI
FT                   SSGLSVGMDEEATAVRKKKDASINIAMKLVREGKAMGVYSAGNSGAMMASAIFKLGRLK
FT                   GIDRPAIGALFPTKDPGQPVLVLDVGANMDCKPTYLHQFALLGNIYSRDVLQVDKPRIG
FT                   LLNIGEESCKGNDLSLATYKLLNEEERFCFSGNCEGRDVLSGDFDVVVCDGFTGNVLLK
FT                   FLESVGSVLLGVLRAELPRGRRGKVGSAFLRNNLKRIKKRLDHAEHGGALLLGINGICV
FT                   IGHGGSKALSVLSALRVMHSAASHGVMDDLADLNKPDVLRSD"
FT   gene            194476..195453
FT                   /gene="fabH"
FT                   /locus_tag="NATL1_02081"
FT   CDS_pept        194476..195453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="NATL1_02081"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="COG332 3-oxoacyl-[acyl-carrier-protein]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74772"
FT                   /db_xref="GOA:A2BZW2"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZW2"
FT                   /protein_id="ABM74772.1"
FT                   /translation="MGCGSATPQKVVSNHQLGQRVDTSDEWIQSRTGIGERRVIGDHES
FT                   LIDLATDAALNAVEMANWDVKTIDLIILATSTPEDLFGSAPKIQSNMGASNAFAFDLTA
FT                   ACSGFLFALVTASQYLASGSVKRAVVIGADQLSKWVDWDDRKTCVLFGDGAGAVALESS
FT                   GDKSGLIGYDLKSDGSKGGCLNLAQSNIFLDLVQGVSHQKGEYLPIKMEGKEVYKFAVK
FT                   EVPIILGEILEKYQIKSENIDWLLLHQANQRILDAVASRFSIPKAKVLSNLKHYGNTSA
FT                   ATIPLMLDEAVRDHRIKSGDLIACSGFGAGLSWGAALFFWHGPH"
FT   gene            195481..196377
FT                   /gene="fabD"
FT                   /locus_tag="NATL1_02091"
FT   CDS_pept        195481..196377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="NATL1_02091"
FT                   /product="Malonyl coenzyme A-acyl carrier protein
FT                   transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="COG331 (acyl-carrier-protein) S-malonyltransferase
FT                   [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74773"
FT                   /db_xref="GOA:A2BZW3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZW3"
FT                   /protein_id="ABM74773.1"
FT                   /translation="MTIAWVFPGQGSQKLGMANSLLDLPGSRDRFELASQILRRDLWKI
FT                   CCGEGLPNEEIYDLNDTRNTQPALFVVESLLVDDLKRQERETKIIAGHSLGEIVGLYSA
FT                   DVLDAKTALLLLKKRSELMAAAGGGAMIAVLGFDRNELDDLIRETEGAAIANDNSESQV
FT                   VLSGSPEAVRKVADNLKCKRAIPLQVSGAFHSKFMTEASQSFAEELDQVTFQDAQIPVL
FT                   SNVDPTPAVNGDILKDRLKKQMTTGVRWRETMHKMQNEGITTMVEIGPGNVLSGLAKRS
FT                   MKGVLTSQISNSSDLGY"
FT   gene            196380..197066
FT                   /locus_tag="NATL1_02101"
FT   CDS_pept        196380..197066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02101"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="COG204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74774"
FT                   /db_xref="GOA:A2BZW4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZW4"
FT                   /protein_id="ABM74774.1"
FT                   /translation="MEQFRVVTGVEKIYKNRPRQSFVYGCVSYLFVFPIFRFLFRGKTI
FT                   GISNLPKTGGVVVVSNHGSHLDPPILGHALGRPVAFMAKAELFKVPILSFIISCCGAYP
FT                   VKRGAGDREAIRNASNRLIEGWATGVFLDGTRQKNGRVNDPKAGAALLAARTGSPILPV
FT                   AIINSHRAFPKGSLLPRLVSIHLRVGELIQPPQTKKREDLKSTTKEIQISINSMLDEGL
FT                   IQNTCN"
FT   gene            complement(197109..197828)
FT                   /locus_tag="NATL1_02111"
FT   CDS_pept        complement(197109..197828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02111"
FT                   /product="putative molecular chaperone"
FT                   /note="Inactive homolog of metal-dependent proteases;
FT                   COG1214 Inactive homolog of metal-dependent proteases,
FT                   putative molecular chaperone [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74775"
FT                   /db_xref="GOA:A2BZW5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZW5"
FT                   /protein_id="ABM74775.1"
FT                   /translation="MEQAASWRRNSKIIVIINKLQNFYTSKSKYLLALHSTSESFGIAV
FT                   KDIEEKETIIKSEVFNIGRALSNKLFSCIETILPRKFWKQIIRISVAKGPGSYTSTRLT
FT                   ISMARTIAQQINCSLDSISSFHIMAPRLYKYLDQNQNFNPFWIKDILPRRGIVAGKYKL
FT                   IKIHQESDFYEFSEIISPQLISNDKEINPSIKASNNIEKDIISLINFSEYCQKSNFHSN
FT                   WRRILPIYPTSPIDNQK"
FT   gene            complement(197789..198040)
FT                   /gene="ycf34"
FT                   /locus_tag="NATL1_02121"
FT   CDS_pept        complement(197789..198040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf34"
FT                   /locus_tag="NATL1_02121"
FT                   /product="putative Ycf34"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74776"
FT                   /db_xref="InterPro:IPR019656"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZW6"
FT                   /protein_id="ABM74776.1"
FT                   /translation="MCICVDCAWVDSCKTYYTVEENHGVRHLSENPDFQGNNPKIHINI
FT                   FDMPEREIGIEWDVRGCDSFKLDQGKWSRLRPGEEIPK"
FT   gene            198070..199257
FT                   /locus_tag="NATL1_02131"
FT   CDS_pept        198070..199257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02131"
FT                   /product="Poly A polymerase family"
FT                   /EC_number="2.7.7.19"
FT                   /note="COG617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74777"
FT                   /db_xref="GOA:A2BZW7"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZW7"
FT                   /protein_id="ABM74777.1"
FT                   /translation="MIIQHTLLSNDLFGDLNPKDWPISIADLPPGSALVGGSVRDGLLK
FT                   KLSPKPDLDFVIPVNAIEFSENLSKKIHATFIKLDEKRDIARLVINGWTLDFARQVGEN
FT                   LKDDLLRRDFRINAIALKLREKPEIFDPMGGMDDLKNNKIVAISEKNLLDDPLRLLRGF
FT                   RLMCELDFELEQKTKRFLKNNVEKLNNVAPERIKMEVLKIAHSKWNSSVWQTYSELQLL
FT                   KRWNDDNLNDRELKRKDIASNNSLFGSFLAKLIFLLSDEGLSRLMFSKNEIKRCKNLRF
FT                   WVHKINHLDDLSEDERFQLHIDLEQDLPSFILFLQERDSNSWLKRWKDPSDPLFHPSPP
FT                   VNGHLLQKVFQLPPGPFLGELIRYLSKEKAYGRFFTDAEALEVARKWTLENSPFL"
FT   gene            199324..199755
FT                   /locus_tag="NATL1_02141"
FT   CDS_pept        199324..199755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02141"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74778"
FT                   /db_xref="GOA:A2BZW8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZW8"
FT                   /protein_id="ABM74778.1"
FT                   /translation="MSVRLYIGNLPQNVNVKELEALLTSIGDGIKFKAVFDRDTKACRG
FT                   FGFANVKDENVSNELIEKLNGYEFNGNKLRVERSERKDSNSSNSRRGASSNNGNKGSNR
FT                   KDVKKVVHSDAPIKEAPDPRWAGELSKLKDLLANQKTPA"
FT   gene            complement(199760..200698)
FT                   /gene="crtB"
FT                   /gene_synonym="pys"
FT                   /locus_tag="NATL1_02151"
FT   CDS_pept        complement(199760..200698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtB"
FT                   /gene_synonym="pys"
FT                   /locus_tag="NATL1_02151"
FT                   /product="Squalene and phytoene synthases"
FT                   /EC_number="2.5.1.32"
FT                   /note="COG1562 Phytoene/squalene synthetase [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74779"
FT                   /db_xref="GOA:A2BZW9"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZW9"
FT                   /protein_id="ABM74779.1"
FT                   /translation="MAQPYLNLEDAYEACRKETAQWAKTFYLGTMLLPPAKRRAIWAIY
FT                   VWCRRTDELMDSTEAQKKSRNELSDRLNQWEDKTKNIFAGNTQDDLDAVLADTLQKFPQ
FT                   SIQPYIDMIEGQRMDLDKTRYKTFEELELYCYRVAGTVGLMTQGVIGIDAAYTRNPNLP
FT                   PPDTSRAAIALGIANQLTNILRDVGEDRGRGRIYLPLEDLKKFNYSEEDLFKGTINENW
FT                   KALMAFQLARARDWFQKSEEGIKWLSIDARWPIWTSLRLYSGILNSIEKIDYDVFSNRA
FT                   YVKGWVKAVNLPISYLITINDEKYKLRTLIN"
FT   gene            complement(200780..202168)
FT                   /gene="pds"
FT                   /locus_tag="NATL1_02161"
FT   CDS_pept        complement(200780..202168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pds"
FT                   /locus_tag="NATL1_02161"
FT                   /product="phytoene desaturase"
FT                   /EC_number="1.3.5.6"
FT                   /note="COG3349 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74780"
FT                   /db_xref="GOA:A2BZX0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014102"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZX0"
FT                   /protein_id="ABM74780.1"
FT                   /translation="MRVAIAGAGLAGLSCAKYLADAGHTPFVYEARNVLGGKVAAWKDD
FT                   DGDWYETGLHIFFGAYPNMLQLFKELDIEDRLQWKSHSMIFNQPEEPGTYSRFDFPDLP
FT                   APINGVAAILSNNDMLSWPEKISFGLGLVPAMLRGQNYVEDCDKYSWTEWLKKQNIPER
FT                   VNDEVFIAMSKALNFIGPDEISSTVLLTALNRFLQEKNGSKMAFLDGAPPERLCQPIVD
FT                   HIRALGGDVFLNSPLKKINLQQDGSVENFLIGSAKEPQGKEIQADAYVSAMPVDIFKTI
FT                   LPNEWASQDIFRKLEGLKGVPVINIHLWFDRKLTNIDHLLFSRSPLLSVYADMSITCKE
FT                   YEDPNRSMLELVFAPAKDWIGRKDEEIIDATMQELKKLFPMHFSGENQAKLRKYKVIKT
FT                   PKSVYKAVPGCQDLRPDQKTPIRNFFLTGDYTMQKYLASMEGAVLSGKICAEKIQISTD
FT                   IGSS"
FT   gene            202273..202620
FT                   /locus_tag="NATL1_02171"
FT   CDS_pept        202273..202620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02171"
FT                   /product="NADH dehydrogenase I subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74781"
FT                   /db_xref="GOA:A2BZX1"
FT                   /db_xref="InterPro:IPR018922"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZX1"
FT                   /protein_id="ABM74781.1"
FT                   /translation="MSDTILKCTTRHVRIFTAVVENNDLILDNGHLTLDIDPDNEFSWS
FT                   DQSIKKVQDYFRELVELQADNELSDYTLRKIGSLLEDFIRKLLKDGELSYNPNSRVMNY
FT                   SMGLPRTQELL"
FT   gene            202617..203276
FT                   /locus_tag="NATL1_02181"
FT   CDS_pept        202617..203276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74782"
FT                   /db_xref="GOA:A2BZX2"
FT                   /db_xref="InterPro:IPR021511"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZX2"
FT                   /protein_id="ABM74782.1"
FT                   /translation="MNQGPYNRRPSSRRRSDLARRQEGNRFNSRKDSNVRDQYELRGSR
FT                   FESSGPSGGGGGGIKINSNSIAILAGVLVIGVGIGSLITSTTSGGQGNIASQQQLDMAV
FT                   PDPDFCRQYGASAFVIDVEMYTTLNPSTSFVTQPALQPGCVIRRENWTVLQKQGAINNE
FT                   DVRECKQRMNTFAYIGSIRDQPIVRCVYQADVNENKFIIRGAEEDAVGINKEAIQF"
FT   gene            complement(203273..204223)
FT                   /gene="rbcR"
FT                   /locus_tag="NATL1_02191"
FT   CDS_pept        complement(203273..204223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcR"
FT                   /locus_tag="NATL1_02191"
FT                   /product="putative Rubisco transcriptional regulator"
FT                   /note="COG583 Transcriptional regulator [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74783"
FT                   /db_xref="GOA:A2BZX3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZX3"
FT                   /protein_id="ABM74783.1"
FT                   /translation="MAEIPFTLDQLRILKAIVDEGSFKKAADSLFVTQPAVSLQVQNLE
FT                   KQLDIAIFDRGGRKAQLTEAGKLLLNYCEKILGECLETCKAVEDLNNLKGGSIIIGASQ
FT                   TTGTYLMPRMIGVFRQKYPEVSVQLQIHSTRRTGWSVANGQIDIAIIGGQLPLELNELL
FT                   EVIPFATDELALVLPTNHPLAKSKELTKEDLYSLRFITLDNQSTTRKVVDQLLSSSGLD
FT                   VQRLHIEMELNSLEAIKNAVQSNLGAAFLPVVSIERELSGGSIHRPIVADLEVKRELKV
FT                   ITNPGRYSSRAAEAFTRDILPLFASSFSPLFNPQN"
FT   gene            204332..205078
FT                   /locus_tag="NATL1_02201"
FT   CDS_pept        204332..205078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02201"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4094 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74784"
FT                   /db_xref="GOA:A2BZX4"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZX4"
FT                   /protein_id="ABM74784.1"
FT                   /translation="MTLSDTHGSSFVMILLLFCFAVIHSGGAALRVKAESVIGARAWRL
FT                   IFAFASIPSAVILVGYFIAHRYDGVRFWNFQGISELIPVIWILSAISFLFLYPATYNLL
FT                   EIPAVLKPKVRIYASGIIRVTRHPQAIGQIIWCFAHLLWIGTSFTLVTCVGLIAHHLFA
FT                   IWHGDRRLTLRFGKEFDEIKKKTSVVPFLAVLDGRQKLQIKEFLRPSQMGILIAIFFFW
FT                   WSHKFISVGAQRFLSFDLTELLARIA"
FT   gene            205104..207110
FT                   /gene="ndhF"
FT                   /locus_tag="NATL1_02211"
FT   CDS_pept        205104..207110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /locus_tag="NATL1_02211"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 5)"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1009 NADH:ubiquinone oxidoreductase subunit 5
FT                   (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit
FT                   [Energy production and conversion / Inorganic ion transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74785"
FT                   /db_xref="GOA:A2BZX5"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR002128"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZX5"
FT                   /protein_id="ABM74785.1"
FT                   /translation="MHSAADFAWLIPLLPLCGAVLIGLGLISFNDLFNRSRKPVAITLL
FT                   TSVGASAFISYAVLAEQLSGKPPVEHLFIWASAGSFELPMGYVIDPLAAVMLALVTTIA
FT                   FLVMIYSHGYMAHDPGYVRFFTYLALFSSSMLGLIVSPNLLEIYVFWELVGMCSYLLVG
FT                   FWYDRDGAAHAAQKAFIVNRVGDFGLLLGILGLFWATGSFDFHGIADGLSVAVGSGNVP
FT                   MWAALTLCILVFMGPMAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGVFLVARLD
FT                   PLFSQFPFVGLFIALIGTITCFLGASIALTQMDLKKGLAYSTVSQLGYMMLAMGCGAPV
FT                   AGMFHLVTHACFKAMLFLGSGSVIHAMEEVVGHEPILAQDMRLMGGLRKKMPITAITFF
FT                   IGCIAISGIPPLAGFWSKDEILGQAFNSFPILWFIGFLTAGMTAFYMFRLYFLTFEGDF
FT                   RGENKEMQLSLLSLAGKDKDEEHEDHEIGKIHESAWPMTFPLAVLAIPSVLIGFIGVPW
FT                   NSIFANLLDPVEAIEAAEKFSWGEFLPLATASVAISSAGILLAVLTYYLKRFDLGVSLS
FT                   KKYPQINSFLQNKWYLDDINEKIFVKGSRKLAREVLEVDAKVVDGVVNLTGLLTLGSGE
FT                   GLKYFETGRAQFYALIVFGGVIALVALFGVVGA"
FT   gene            207250..208866
FT                   /locus_tag="NATL1_02221"
FT   CDS_pept        207250..208866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02221"
FT                   /product="putative NADH dehydrogenase subunit (chain 4)"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1008 NADH:ubiquinone oxidoreductase subunit 4
FT                   (chain M) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74786"
FT                   /db_xref="GOA:A2BZX6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZX6"
FT                   /protein_id="ABM74786.1"
FT                   /translation="MLIPEPIQADFPWLSLSILFPIVGALIVPFIPDKGEGKEVRWYAL
FT                   IISLITFLITVAAYFKGFDPSLEGLQLYEKVSWLPDLGLTWSVGADGLSMPLILLTSFI
FT                   TSLAVLAAWPVSYKPKLFFFLILAMDGGQIAVFAVQDMLLFFLAWELELFPVYLFLAIW
FT                   GGKKRQYAATKFIIYTAGSSLFILLAGLAMGFFQGGGVPDFGYTHLAQQNFGRGFQLLC
FT                   YSGLLIAFGVKLPIVPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNAQLLPDA
FT                   HAQFAPLLIVLGVVNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSSLGTSGA
FT                   MLQMVSHGLIGASLFFLVGATYDRTHTLQLDEMGGIGQNMRIMFALWTACAFASLALPG
FT                   MSGFISELMVFVGFVTDEVYTLPFRIVVASLAAIGVILTPIYLLSMLREIFFGKENAKL
FT                   ISKAKLVDAEPREIYIIACLLVPIIGIGLYPKIMTDTYISSIDGLVKRDLLAVERIRSD
FT                   RATIMSNTSLSIGTIEAPLLD"
FT   gene            208931..209824
FT                   /locus_tag="NATL1_02231"
FT   CDS_pept        208931..209824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02231"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG1354 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74787"
FT                   /db_xref="GOA:A2BZX7"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZX7"
FT                   /protein_id="ABM74787.1"
FT                   /translation="MPVDFLTQSADSGARLAIRLLQDAAQRGDIDPWDVDVIPVVDGFL
FT                   DQLKQRIEIPKKISQHFSQNGGSYEVDLAQSSEAFLAASVLVGLKAEVLEAEMFSVDMG
FT                   NEDDSELDFGEQGWLDESFQLPLRPERHLFRRPVAPPPFRRPVTLGELINQLETIAESL
FT                   KNDDLNNRRKLRQKKLSNREVIAQVSSLAHREKLPETTAALAIFINKWEKALHWVDFEL
FT                   LVKSWKENSASNDLDTDRVGVFWALLFLCSQGKVEIDQKGSLFSPISLKRLLQPGMVAQ
FT                   LPLASLDVTDVSPAAA"
FT   gene            209881..211059
FT                   /locus_tag="NATL1_02241"
FT   CDS_pept        209881..211059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02241"
FT                   /product="Putative sugar-phosphate nucleotidyl transferase"
FT                   /EC_number="2.7.7.13"
FT                   /note="COG1208 Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B,
FT                   gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell
FT                   envelope biogenesis, outer membrane / Translation,
FT                   ribosomal structure an"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74788"
FT                   /db_xref="GOA:A2BZX8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037538"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZX8"
FT                   /protein_id="ABM74788.1"
FT                   /translation="MKAMILAAGKGTRVQPITHVIPKPMIPILQKPVMEFLLELLKEHG
FT                   FTEVMVNVSHLAEEIENYFRDGQRFGVEIAYSFEGRIEDGELIGDALGSAGGLKKIQDF
FT                   QKFFDDTFVVLCGDALIDLDLSEAVKRHKEKGALASLITKRVSKDQVSSYGVVVTDEED
FT                   RVKAFQEKPSIDNALGDTINTGIYLFEPEIFNYIPSGKPFDIGSDLFPKLVEEGAPFYA
FT                   LPMDFEWVDIGKVPDYWRAIRNVLKGDVRQVEIPGKQVRPGIYTGLNVAANWDKINVKG
FT                   PIYVGGMTRIEDGVTIVGPSMIGPSCCICEGATIDNSIIFDYSLIGPGVQLVEKLVFGR
FT                   YCVGKEGDHFDLQEAALDWLITDARRQDLGEPSPQQKAMAELLGTDLIGSSN"
FT   gene            complement(211052..211933)
FT                   /gene="metF"
FT                   /locus_tag="NATL1_02251"
FT   CDS_pept        complement(211052..211933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="NATL1_02251"
FT                   /product="Methylenetetrahydrofolate reductase"
FT                   /note="COG685 5,10-methylenetetrahydrofolate reductase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74789"
FT                   /db_xref="GOA:A2BZX9"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZX9"
FT                   /protein_id="ABM74789.1"
FT                   /translation="MKSKLQKRLESGLSAITAEIMPPRGGNTTSAISKAIKLKDLVHGF
FT                   NVTDGSRAIMRMSSLALCKLLLEANLEPVLQLSCRDRNRIALQAELLGAHALGIKNILC
FT                   LTGDPVRVGDQSQAKSVQDLNSIELIRQVTSLNKGIDPVSDLLPDGPTNLFAGAAADPN
FT                   CRGFDGLRRRIELKKNAGANFLQTQMVMDPKVLERFCKEITEPMKIPVLAGVFLLKSAK
FT                   NAQFINRVVPGACIPESIISRLESSSNPIDEGISIAADQVKSFLGIAQGVHLMAVKAEQ
FT                   QIPIILDRANIN"
FT   gene            212018..212290
FT                   /gene="csgD"
FT                   /locus_tag="NATL1_02261"
FT   CDS_pept        212018..212290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgD"
FT                   /locus_tag="NATL1_02261"
FT                   /product="Bacterial regulatory protein, LuxR family"
FT                   /note="COG2771 DNA-binding HTH domain-containing proteins
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74790"
FT                   /db_xref="GOA:A2BZY0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZY0"
FT                   /protein_id="ABM74790.1"
FT                   /translation="MFTGEIANSSHMGLSAREMEIIGLVADGLTNQEIAERLTISKRTV
FT                   DNHVSNMFTKTGSKNRVALLNWAMDHGKICRDGFNCCSLPDETDT"
FT   gene            complement(212296..212445)
FT                   /locus_tag="NATL1_02271"
FT   CDS_pept        complement(212296..212445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02271"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74791"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZY1"
FT                   /protein_id="ABM74791.1"
FT                   /translation="MFGLYDTEGILRFTCSDKEACIAYAKLFELSSIEFSLMPLSDVAE
FT                   IENN"
FT   gene            complement(212532..213032)
FT                   /locus_tag="NATL1_02281"
FT   CDS_pept        complement(212532..213032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02281"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG2954 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74792"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZY2"
FT                   /protein_id="ABM74792.1"
FT                   /translation="MGIEIERRFLVENNDWKNQVILSESFSQAYLNSSIDEWATRVRII
FT                   DNNKGYITLKSSLNGLVNYEFEYSIPRKDAIKLIQLSKYQITKIRYQLKINKKNWVVDV
FT                   FEKSNSGLKIAEIELNSESEEIRVPSWCGQEITGIKSLSNASLAKAPISELSVEDRIKI
FT                   KSL"
FT   gene            complement(213039..213944)
FT                   /locus_tag="NATL1_02291"
FT   CDS_pept        complement(213039..213944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02291"
FT                   /product="predicted inorganic polyphosphate / ATP-NAD+
FT                   kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="COG61 Predicted sugar kinase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74793"
FT                   /db_xref="GOA:A2BZY3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZY3"
FT                   /protein_id="ABM74793.1"
FT                   /translation="MTTNLIWILYRSDSDTAYKETLNCKKIIEGYGKKVLFSEISNETN
FT                   NINQLFLKSEVLPEITIVLGGDGTVLRAARYLSPKNIPILSFNVGGNLGFLTHDRQILK
FT                   QETFWERVSKNRFNIQKRMMLEATVFKEKNKNETTIKKSFFALNDFYLRSCTDEIAPTC
FT                   SLALEIDGEAVDRYKGDGLIFSTPTGSTAYSMAAGGPIIHPSLDAIIVSAICPMSLASR
FT                   PIVVPPESQLVIKPIRGMKQKIKLWLDGSSGCLIEAEDTCLIKKSNHSTSIIILDENHS
FT                   YYKTITQKLHWASSLNDPNK"
FT   gene            complement(213954..214283)
FT                   /gene="ndhE"
FT                   /locus_tag="NATL1_02301"
FT   CDS_pept        complement(213954..214283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhE"
FT                   /locus_tag="NATL1_02301"
FT                   /product="putative NADH Dehydrogenase subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG713 NADH:ubiquinone oxidoreductase subunit 11 or
FT                   4L (chain K) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74794"
FT                   /db_xref="GOA:A2BZY4"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZY4"
FT                   /protein_id="ABM74794.1"
FT                   /translation="MLENTIGPVPLQAYLIVAAFLFCTGVWGLINSRNAVRVLMSIELM
FT                   LNAVNINLMSFSSYVDGSVIRGQVFSIFVITVAAAEAAVGLAILLSLYRNRVTIDMESF
FT                   NLLKW"
FT   gene            complement(214318..214920)
FT                   /gene="ndhG"
FT                   /locus_tag="NATL1_02311"
FT   CDS_pept        complement(214318..214920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhG"
FT                   /locus_tag="NATL1_02311"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 6)"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG839 NADH:ubiquinone oxidoreductase subunit 6
FT                   (chain J) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74795"
FT                   /db_xref="GOA:A2BZY5"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZY5"
FT                   /protein_id="ABM74795.1"
FT                   /translation="MNIAYSTELICFLILSAIIVSGSLAVVLLENIVYSAFLLGGVFMA
FT                   VAGLYLLLNASFVAAAQILVYVGAVNVLILFAIMLVNNKEKLKPIKGLRTRKLISGGVC
FT                   GGLLILLLRVSITTKWNLPGPTSIGEEATEIIGEHLFTDYLLPFELASILLLMAMIGAI
FT                   VLARRDVSISTADINDLKNQNSLSDRKVPLLSENSIK"
FT   gene            complement(214917..215573)
FT                   /gene="ndhI"
FT                   /locus_tag="NATL1_02321"
FT   CDS_pept        complement(214917..215573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhI"
FT                   /locus_tag="NATL1_02321"
FT                   /product="putative NADH Dehydrogenase subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74796"
FT                   /db_xref="GOA:A2BZY6"
FT                   /db_xref="InterPro:IPR004497"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZY6"
FT                   /protein_id="ABM74796.1"
FT                   /translation="MLGFLEKVADYTKEAVSAAKYLVDGLGVTFDHMRRRPVTVQYPYE
FT                   KLIPSERYRGRIHYEFDKCIACEVCVRVCPINLPVVDWVMNKETKKKELRNYSIDFGAC
FT                   IFCGNCVEYCPTNCLSMTEEYELSAFDRHSLNYDNVALGRLPTSVTSDPSVRPLRELPY
FT                   LPKGIMDPHELPANQQRAGKLPSQIIKELQAEKSEEKGNNNSSDIVPNKLNSTNK"
FT   gene            complement(215682..216800)
FT                   /gene="ndhA"
FT                   /locus_tag="NATL1_02331"
FT   CDS_pept        complement(215682..216800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhA"
FT                   /locus_tag="NATL1_02331"
FT                   /product="putative respiratory-chain NADH dehydrogenase
FT                   subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1005 NADH:ubiquinone oxidoreductase subunit 1
FT                   (chain H) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74797"
FT                   /db_xref="GOA:A2BZY7"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZY7"
FT                   /protein_id="ABM74797.1"
FT                   /translation="MNSGIDLEMSFTQGVQNLGLSHELAHLLWIPLPMLLVLVSAVIGV
FT                   LVTVWLERKISAAAQQRIGPEYAGALGILQPMADGLKLLVKEDIIPARADSVLFTVGPI
FT                   LVLVPVILSWLIVPFGQNLLISNVGIGIFLWIALSSIQPIGLLMSGYSSNNKYSLLGGL
FT                   RAAAQSISYEIPLALAVLAIVMMSNSLSTVDIVEQQNTAGLLSWNIWRQPVGFIIFWIC
FT                   ALAECERLPFDLPEAEEELVAGYQTEYSGMKFALFYLAGYINLVLSALLVSVLYLGGWG
FT                   FPISIDWFSSLIGLSIDNPLVQIIAASLGIVMTILKAYLLVFLAILLRWTTPRVRIDQL
FT                   LDLGWKFLLPISLVNLLVTASLKLAFPITFGG"
FT   gene            complement(216876..218003)
FT                   /gene="gltA"
FT                   /locus_tag="NATL1_02341"
FT   CDS_pept        complement(216876..218003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="NATL1_02341"
FT                   /product="Citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="COG372 Citrate synthase [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74798"
FT                   /db_xref="GOA:A2BZY8"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZY8"
FT                   /protein_id="ABM74798.1"
FT                   /translation="MVLKPGLEGVPVTKSGICEINGTEGRLSYRGYPISELAQKSSFLE
FT                   TAFLLIWGELPTENELEKFEKDVQMHRRVSFRIRDMLKCFPESGHPMDALQASAASLGL
FT                   FYSRRAIDDPKYIYDAVVRLIAKIPTMVAAFEQIRKGDDPIQPQDDLPYSSNFLYMLTE
FT                   REPNPLAARVFDRCLILHAEHSLNASTFSARVTASTLTDPYAVVASAVGTLAGPLHGGA
FT                   NEDVIAMLEEIGRPDEASSFLNDAIAKKRKIMGFGHREYRVKDPRATILQAFAEELFSE
FT                   FGKDEMYEVAKALEEEAISKLGPKGIFPNVDFYSGLVYRKLGIPRDLFTPVFAISRVAG
FT                   WLAHWREQLGANRIFRPSQIYEGAKMRNWKPLESR"
FT   gene            217963..218130
FT                   /locus_tag="NATL1_02351"
FT   CDS_pept        217963..218130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02351"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74799"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZY9"
FT                   /protein_id="ABM74799.1"
FT                   /translation="MVTGTPSKPGFRTKLVVFFSLSMALAPAKQFSVQLKNFQLELYFI
FT                   ELNYIFNIAL"
FT   gene            complement(218139..219725)
FT                   /locus_tag="NATL1_02361"
FT   CDS_pept        complement(218139..219725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74800"
FT                   /db_xref="GOA:A2BZZ0"
FT                   /db_xref="InterPro:IPR021787"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZZ0"
FT                   /protein_id="ABM74800.1"
FT                   /translation="MKSLQSYFLISAIVILSILTGIFIWRNKHLTQIPKFNEESFNAPV
FT                   SSKYIPKNTDLVFHWKLNPGLLPKYIENYQDKVSKHAINKKVSFIRDSSFQLIGFNFAK
FT                   DISKWVGDYGSFAVFDSNKKTINDWLMVLAIKEDVNIKQELESILGSKVVDESTTQSNK
FT                   ISTSKTEIISKQINSNNSIYFANDEDNLLISSNPNIIQSSIEELDSNIINTKKMYKNIQ
FT                   LKDNLKDGLLLLEMSPKKILNLIGQEEDLLNINKVDNLLSSVNVDKNKLNLEGILAYNV
FT                   KTKMPVKDINSNLIDIKKESELPENYILVDNPKQYFQKDSVHPYQKLIASIIKESTTSD
FT                   YSELLKIILENSQGNLIWINDKDWLILTRKSDTKKTEIDDILKKENFLNSNLDFKSRKL
FT                   EIWSKISTNENNTYELKDNIEAIVEEDDKTYIWSQNLSSISNFDNTNYLKNYSDNEQNT
FT                   NEFNDFDDILKIHLGKEKTKAILNSFYPYILLKTMLGNTLNPPQDIDIAIAVPTINYPD
FT                   FIKVKINLKTS"
FT   gene            219802..220158
FT                   /gene="pspE"
FT                   /locus_tag="NATL1_02371"
FT   CDS_pept        219802..220158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspE"
FT                   /locus_tag="NATL1_02371"
FT                   /product="Rhodanese-like protein"
FT                   /note="COG607 Rhodanese-related sulfurtransferase
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74801"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZZ1"
FT                   /protein_id="ABM74801.1"
FT                   /translation="MNQNIPLNISPKELNKILEDDSSEKPFIVDVREDNEIAIASFSFS
FT                   VLHLPLSKAANWSDKIGELLPKDQPVVVICHAGVRSLNFGIWLLEQGIAKSVWNLVGGI
FT                   DAWSTDVDQSVPRY"
FT   gene            complement(220171..221424)
FT                   /gene="trpB"
FT                   /locus_tag="NATL1_02381"
FT   CDS_pept        complement(220171..221424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="NATL1_02381"
FT                   /product="Tryptophan synthase subunit beta"
FT                   /EC_number="4.2.1.20"
FT                   /note="COG133 Tryptophan synthase beta chain [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74802"
FT                   /db_xref="GOA:A2BZZ2"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2BZZ2"
FT                   /protein_id="ABM74802.1"
FT                   /translation="MTGTLPTQFKDSDLSPLTRPNALGRFGKYGGQYVPETLIPALIEL
FT                   EQAAKEAWKDSSFNSELNHLLKTYVGRSTPLYEATRLTEHYRKNTLKGPRIWLKREDLN
FT                   HTGAHKINNALGQALLAIRMGKKRIIAETGAGQHGVATATVCARFGLECIIYMGKEDMR
FT                   RQALNVFRMQLLGASVRPVTSGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPM
FT                   LVRDFHAVIGEETKQQCKQAFGRSPDVLLACVGGGSNAMGLFHSFVEDKSVRMIGVEAA
FT                   GDGVETGRHAATITEGRVGVLHGAMSLLLQDKDGQVEEAHSISAGLDYPGVGPEHSYLK
FT                   EIGRAEYAAVTDTEAIEALQLVSKLEGIIPALETAHAFAYLEKLCPTLNHNSEIVINCS
FT                   GRGDKDVNTVAEKLGSEI"
FT   gene            221464..221787
FT                   /gene="sui1"
FT                   /locus_tag="NATL1_02391"
FT   CDS_pept        221464..221787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sui1"
FT                   /locus_tag="NATL1_02391"
FT                   /product="Translation initiation factor SUI1"
FT                   /note="COG23 Translation initiation factor 1 (eIF-1/SUI1)
FT                   and related proteins [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74803"
FT                   /db_xref="GOA:A2BZZ3"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZZ3"
FT                   /protein_id="ABM74803.1"
FT                   /translation="MSKGGWSEFNDPLKTIGSNTQNSVTPKGKRQVRLERTRSGKKGKL
FT                   VTVIKGLELEQVEAKKILKNLKIACGTGGAVKGDFLELQGDQISKAQNFLLKEGFRPKQ
FT                   SGG"
FT   gene            221840..222478
FT                   /gene="cysC"
FT                   /locus_tag="NATL1_02401"
FT   CDS_pept        221840..222478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="NATL1_02401"
FT                   /product="Adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="COG529 Adenylylsulfate kinase and related kinases
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74804"
FT                   /db_xref="GOA:A2BZZ4"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZZ4"
FT                   /protein_id="ABM74804.1"
FT                   /translation="MEQNSKSPLSKATNIVWHQSSVDREARSQQRGHRSAILWFTGLSG
FT                   SGKSTLANAVNVALHKDGYSTYVLDGDNIRHGLCKDLGFSDLDREENIRRIGEVSKLFL
FT                   DAGIIVLTAFVSPFRVDRDNARSLVGENDFIEIYCSADLGVCETRDTKGLYAKARNGDI
FT                   KDFTGISSPYEEPQSPELKIDTGNLEIDQCVDIVTNLLVERKIISKISK"
FT   gene            complement(222503..223039)
FT                   /gene="purE"
FT                   /locus_tag="NATL1_02411"
FT   CDS_pept        complement(222503..223039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="NATL1_02411"
FT                   /product="Phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /note="COG41 Phosphoribosylcarboxyaminoimidazole (NCAIR)
FT                   mutase [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74805"
FT                   /db_xref="GOA:A2BZZ5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZZ5"
FT                   /protein_id="ABM74805.1"
FT                   /translation="MSLTEANTFKQVAVVMGSDSDLKTLKPAVAILDQFGISNEVRILS
FT                   AHRTPKEMMDFAQMAESNGFGVIIAGAGGAAHLPGMIASLTTLPVIGVPVKSKALSGID
FT                   SMYSILQMPSGIPVATVAIEGGLNAGLLATQILAINNTELKNKLNAYRCELHDLVVKKD
FT                   HTLKEIGAITYLEKM"
FT   gene            223118..224278
FT                   /gene="nagA"
FT                   /locus_tag="NATL1_02421"
FT   CDS_pept        223118..224278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="NATL1_02421"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="COG1820 N-acetylglucosamine-6-phosphate deacetylase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74806"
FT                   /db_xref="GOA:A2BZZ6"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZZ6"
FT                   /protein_id="ABM74806.1"
FT                   /translation="MRKITNIKVPQPEKSEDEKNLFSLVLDEHGIILSIDKTCKKESSY
FT                   DEDWHGDWLSPRAIDLQMNGGLGISFTDLNFNKIPKLLTLLDQLWLDGVEGICPTFVSC
FT                   SLDQFQLGMEVLKETKKYTSTNRCRLLGAHMEGPFLCETYSGAHDTGSICRPSISALNE
FT                   RIKGFEDDIALMTLAPELKGSLDVISRLRELNIVVSLGHSSADFDSAIKAFNNGVSMIT
FT                   HTFNAMKGLHHRAIGPIGAAARRDDIFLGLIGDGVHVHSDMIRLLKILAPKQIVLVSDA
FT                   ISAYGLGDGSFNWDKRLITVENGLCRLPNETIAGSTLPLLDACKKIANWINDPSAAIWM
FT                   ATLAPRMVLSQNKMTAKSFFIGKNIKSLLRWKMNSCNHQLSWQLAA"
FT   gene            224307..225008
FT                   /gene="chlM"
FT                   /locus_tag="NATL1_02431"
FT   CDS_pept        224307..225008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlM"
FT                   /locus_tag="NATL1_02431"
FT                   /product="Mg-protoporphyrin IX methyltransferase"
FT                   /EC_number="2.1.1.1"
FT                   /EC_number="2.1.1.11"
FT                   /note="COG2227
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol
FT                   methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74807"
FT                   /db_xref="GOA:A2BZZ7"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR010251"
FT                   /db_xref="InterPro:IPR010940"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZZ7"
FT                   /protein_id="ABM74807.1"
FT                   /translation="MTTQIEKNEKAEVTEYFNGTGFDRWNRIYSESDDVNKVQKNIRIG
FT                   HQKTVDDVISWLKEYDNIKDKSFCDAGCGVGSLSIPLAKLGAKSIHLSDISEAMINETK
FT                   SRAKEEGLDFNKLNFRTSDLENLKGSFNTVVCLDVFIHYPQQKAEAMVKHLCELSDERL
FT                   IVSFAPYTPLLALLKGIGQLFPGPSKTTRAYTLRESGIIEAAKQSGFKVVKSKLNQAPF
FT                   YFSKLIEFVKS"
FT   gene            complement(225041..225769)
FT                   /locus_tag="NATL1_02441"
FT   CDS_pept        complement(225041..225769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02441"
FT                   /product="two-component response regulator"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain [Signal
FT                   transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74808"
FT                   /db_xref="GOA:A2BZZ8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZZ8"
FT                   /protein_id="ABM74808.1"
FT                   /translation="MSDPNPSTQEVSQTPRILLVDDEPGLRTAVQAYLEDEGFQVTTAV
FT                   DGEEGWEKAQKMIPDVIISDVMMPRCDGYGLLKKIREDERLGGTPVIFLTAKGMTADRT
FT                   QGYQAGVDDYMPKPFDPDELVARVKNVVQRQERLLTEAARFANADVGQMAKQITEIKSM
FT                   LSHGDKHHSRKDDSIPNFTPREASVLQLVAEGLMNKEIARQLETSIRNVEKYVSRLFIK
FT                   TGTSSRTELVRYALENHLVT"
FT   gene            225846..226994
FT                   /locus_tag="NATL1_02451"
FT   CDS_pept        225846..226994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02451"
FT                   /product="NifS-like aminotransferase class-V"
FT                   /EC_number="2.8.1.7"
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74809"
FT                   /db_xref="GOA:A2BZZ9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A2BZZ9"
FT                   /protein_id="ABM74809.1"
FT                   /translation="MDNNHLIFDFQSSTPCCTKVVEEMAPYWNELWGNPSNTNNRSGVF
FT                   ASAAVEVSREKIASYLNINPKRLIFTSGATEANNLGLVGHARAKAQLIGKPGHIITVST
FT                   EHHAVLDPLRQLQREGFRLTELQPNKEGLINIEQLSEAFEKDTFLVSVMAANNEIGVLQ
FT                   PIGDIGSFCKRKGIAFHSDAAQAFGYLDLDPDKFRIDLMSLSAHKIYGPKGIGALVIRE
FT                   GFPLEPSQYGGGQELGLRSGTLPVPLIVGFAKAVEITKNDQDERNKRLLFFRNLLLSGL
FT                   KKNISGLIVNGSIDQRLPHNLNITFPGVKGSQLHGQLRRFIFCTSGSACSNGEASHVLQ
FT                   EIGLSKKDAEASIRMSIGRNTTEKDIHKAINIITNIVINLRQ"
FT   gene            complement(227002..227916)
FT                   /locus_tag="NATL1_02461"
FT   CDS_pept        complement(227002..227916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02461"
FT                   /product="Predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="COG275 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis
FT                   [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74810"
FT                   /db_xref="GOA:A2C000"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C000"
FT                   /protein_id="ABM74810.1"
FT                   /translation="MKEGPISSSSNFNHVPVMGKEIIQSLKELPSELTKQGLIIDATIG
FT                   GGGHSAQILENFPGIKIIGLDQDPMAREAASKKLIKFGTRIKIISTNFADFSLDEQAIC
FT                   VLADLGVSSHQLDEPSRGFSFRLNGPIDMRMNPKEGSSAAELIETLSEQNLADLIYELG
FT                   EEKRSRRIARKIKNDLAENGPYSGTQDLSYAIAGCFPPKQRYGRIHPSTRTFQALRIAV
FT                   NNELGSLESLLLKAPNWLLENGLFMVMSFHSLEDRRVKSSFKTDNRLKVLSKKPIRASP
FT                   EEIELNPRSKSAKLRISAKKFLT"
FT   gene            227958..229142
FT                   /gene="ndhH"
FT                   /locus_tag="NATL1_02471"
FT   CDS_pept        227958..229142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhH"
FT                   /locus_tag="NATL1_02471"
FT                   /product="putative NADH dehydrogenase subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG649 NADH:ubiquinone oxidoreductase 49 kD subunit
FT                   7 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74811"
FT                   /db_xref="GOA:A2C001"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C001"
FT                   /protein_id="ABM74811.1"
FT                   /translation="MAQLETRTEPMVVNFGPHHPSMHGVLRLVVTLDGEDVVDCEPVIG
FT                   YLHRGMEKIAENRTNVMFVPYVSRMDYAAGMFYEAIVVNAPERLANIKVPKRASYIRAI
FT                   MLELNRIANHLLWLGPFLADVGAQTPFFYIFREREMIYDLWEAATGQRLINNNYFRIGG
FT                   VACDLPWGWLEKCKDFCDWFGPKIDEYEKLITNNPIFRRRIEGLGVIGKEQAINWSLSG
FT                   PMLRAAGVPWDLRKVDHYECYDDFEWDIAWEKEGDCYARYRVRIEEMRQSLKILRQACE
FT                   MIPGGPTENLEAQRTVEGKKGDLSGFDYQYVAKKVAPTFKIPNGELYTRLESGKGEIGV
FT                   FIQGNNDVTPWRFKIRAADSNNLQILPHILKGAKVADIMAILGSIDVIMGSVDR"
FT   gene            229148..229600
FT                   /locus_tag="NATL1_02481"
FT   CDS_pept        229148..229600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02481"
FT                   /product="Predicted thioesterase"
FT                   /note="COG824 Predicted thioesterase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74812"
FT                   /db_xref="GOA:A2C002"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR022829"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C002"
FT                   /protein_id="ABM74812.1"
FT                   /translation="MEKRNPREWLCLNRTVRFGETDAAGVVHFVELFRWCHETWEESLE
FT                   KFGIVLKEIFPSTQINTSQLDVALPVVHCEANYFQPLYVGDTINIELYPEKINESSFVL
FT                   LFKFKKNGEQIGTTNIKHVSINPITREKCALSKQINLWLHESGLNF"
FT   gene            complement(229597..230832)
FT                   /gene="menE"
FT                   /locus_tag="NATL1_02491"
FT   CDS_pept        complement(229597..230832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="NATL1_02491"
FT                   /product="probable O-succinylbenzoic acid--CoA ligase
FT                   (OSB-CoA synthetase)"
FT                   /EC_number="6.2.1.26"
FT                   /note="COG318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II [Lipid metabolism / Secondary metabolites
FT                   biosynthesis, transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74813"
FT                   /db_xref="GOA:A2C003"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2C003"
FT                   /protein_id="ABM74813.1"
FT                   /translation="MTKIAVVECIPEKNLDCSKEILKNFEKHNWVYLAPPKDQTKIPTS
FT                   STLPEGEGIIISSGGSLGGPNLCFQSLKNLTNSALATGKWLKNHGLKPNECIILNSLPL
FT                   HHISGFMPWWRHQTWGSGYYWISNSIMHKPLQLKQFSEALTNKHRRPLITSLVPTQLLS
FT                   LIDDPDGLEWLQSLAIIWVGGSMLPTDLADKARRKSIKLAPCYGSTETVAMVTCLSPQD
FT                   FLKGSNSVGFPLEDVEIEINKRNSLKIKTSRIATSKWKNDKFESIAESNGWWEAGDLAQ
FT                   YITLDNRTAIQILGRRDSAINSGGETIFPEDIEMELMKIISKHQIPIKDIFVLGVSDKK
FT                   WGQRLIVLTKFKEKGIHRYPIIKLLTDLIKDWQPSKKPLKWYDCPKLSRNINKKWEVKK
FT                   WQDWVALNSPIS"
FT   gene            complement(230829..231800)
FT                   /gene="menC"
FT                   /locus_tag="NATL1_02501"
FT   CDS_pept        complement(230829..231800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="NATL1_02501"
FT                   /product="putative O-succinylbenzoate synthase"
FT                   /EC_number="6.2.1.26"
FT                   /note="COG4948 L-alanine-DL-glutamate epimerase and related
FT                   enzymes of enolase superfamily [Cell envelope biogenesis,
FT                   outer membrane / General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74814"
FT                   /db_xref="GOA:A2C004"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A2C004"
FT                   /protein_id="ABM74814.1"
FT                   /translation="MKLIINIKPFSFQLTRKLITSQGIIHNKVGLLLQIKDSNGNYGWG
FT                   EVSPIEKKELEKSIESLDFIGKQTTKDSIENYLFELPGALAFGLGSCLADLESLTQRKL
FT                   NLEGFDVAKSAYLLPTDIDPLESIRKYVDESNEKKSSCTIKWKVSHLENNFKEEKTLQK
FT                   ILDILPNNFKLRIDPNGGWSRQKAQEWSNELKNEPRLEWIEQPLPSKDIEGLFSLATQI
FT                   PIALDESLVEFPYLRKTWKSWQIRRPALDGDPRLLLKEIEQEDSQTVISTAFETGIGRR
FT                   WVNHLAARQVKGGNPCSPGLAPGWCPKGPLFNNNPKLVWEAV"
FT   gene            complement(231820..232809)
FT                   /gene="menA"
FT                   /locus_tag="NATL1_02511"
FT   CDS_pept        complement(231820..232809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="NATL1_02511"
FT                   /product="1,4-dihydroxy-2-naphthoate (DHNA)
FT                   octaprenyltransferase; UbiA prenyltranferase family"
FT                   /note="COG1575 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74815"
FT                   /db_xref="GOA:A2C005"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR011937"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A2C005"
FT                   /protein_id="ABM74815.1"
FT                   /translation="MHELLPSLKGYTKKQTGRISLSVKSSTTERKHLWQAAIKWPLYSV
FT                   AIMPVIVSAGWELGNSGNIRLGQFIGFLIASILILLWENLTNDLFDDETGVDKYKFHSV
FT                   VALTGSKSTVSRVAYFSLLLGLFIIFILALKSKITVLFLVIICCFLGYLYQGPPFRLGY
FT                   KGLGEPLCWIAFGPLATAAALIVISPKSNFDTIPWGTALIVGAGPAMATTLVLFCSHFH
FT                   QINQDAAVGKKSPLVILGTHRAAEFLPWFVGLILLLELLPVLLGIWPITTLICLISLPS
FT                   GLDLIKLIKRHHNQPERIKNSKFLALRFQTINGLCLSIGFAISSFFYN"
FT   gene            232843..234243
FT                   /gene="menF"
FT                   /locus_tag="NATL1_02521"
FT   CDS_pept        232843..234243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="NATL1_02521"
FT                   /product="Isochorismate synthase"
FT                   /EC_number="5.4.4.2"
FT                   /note="COG1169 Isochorismate synthase [Coenzyme metabolism
FT                   / Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74816"
FT                   /db_xref="GOA:A2C006"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:A2C006"
FT                   /protein_id="ABM74816.1"
FT                   /translation="MNLEPVFSELLVSSLQKWSVRKVDECILSISVPVSQTDPLTTLPL
FT                   IAEKHQFRFLWDLSPGLCLSAGGHCQSLDLSGPKRFENAQRFSDEIFTRLIEISPSPAF
FT                   SASRILFSFSFFDQIKSNEKSIDDKFSLQAVLPKWQLTAKDGLTWLRLNSVAQNPSDVR
FT                   EAIERLWSIREKINKSPVRIVNDEKENFLVDNFSDDWKSQYRDALAKGIELINAGDLDK
FT                   LVLATRQHLSLRKPLDPLHLLARLRVQQTNSCRFLWQKNHDESFFGASPERLISLNQNQ
FT                   LLIDALAGTAKKGDDGRELLASSKDLREHHFVVNSIVEQLLKRGIKASYPSQPKLMTQD
FT                   HLIHLHTLIQASVKEKSPLDLVEALHPTPAVAGLPLNKSLSWLRALEPFDRKTYASPIG
FT                   WIDKNQNSEFRVAIRYGQLKANELKLFAGAGLVKGSTVEGEMQEVALKFEVLRNQLNLD
FT                   RVNCSNDL"
FT   gene            complement(234221..235150)
FT                   /gene="gshB"
FT                   /locus_tag="NATL1_02531"
FT   CDS_pept        complement(234221..235150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="NATL1_02531"
FT                   /product="putative Glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="COG189 Glutathione synthase/Ribosomal protein S6
FT                   modification enzyme (glutaminyl transferase) [Coenzyme
FT                   metabolism / Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74817"
FT                   /db_xref="GOA:A2C007"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A2C007"
FT                   /protein_id="ABM74817.1"
FT                   /translation="MKQLFVLDPIENINPKKDSSAALMQAASRANIDVWICTPSDLQAR
FT                   GDDAWVVSNKVNCEPWINVQSPRSLPLRDFSCIWMRKDPPVDEAFLYATHLLEVAERDG
FT                   VNVINKPASLRAWNEKLGALRFSDLMAPTLVASRVEQLITFAKEYGEVVLKPLGGKGGQ
FT                   GVIRIAKDAPGLEALLELVTSQEHLPVMMQQFLPEVINGDKRILLVNGEPLGAINRRPK
FT                   EGDFRSNLALGGKAETTKLTPKEIEICNQIKPALQEEGLFFVGIDVIGGMLSEINVTSP
FT                   TGIREVENLMNVPLADQVIDYLIDHLNN"
FT   gene            complement(235154..235444)
FT                   /gene="grxC"
FT                   /locus_tag="NATL1_02541"
FT   CDS_pept        complement(235154..235444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="NATL1_02541"
FT                   /product="Glutaredoxin"
FT                   /EC_number="1.20.4.1"
FT                   /note="COG695 Glutaredoxin and related proteins
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74818"
FT                   /db_xref="GOA:A2C008"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2C008"
FT                   /protein_id="ABM74818.1"
FT                   /translation="MNRSIPDSGITTVEIYTWRFCPFCLRAKALLNEKGVQFTEYSIDG
FT                   DDGARTKMSERAGGRRTVPQIFINGKSIGGCDELYELERNNELNELIGIRN"
FT   gene            235416..235580
FT                   /locus_tag="NATL1_02551"
FT   CDS_pept        235416..235580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02551"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74819"
FT                   /db_xref="GOA:A2C009"
FT                   /db_xref="UniProtKB/TrEMBL:A2C009"
FT                   /protein_id="ABM74819.1"
FT                   /translation="MPESGIDLFIYSFWVDMLIAFNVLILLLRLQDLTDFKRDLSLLTS
FT                   RLGTAQDCL"
FT   gene            235672..236613
FT                   /gene="prfB"
FT                   /locus_tag="NATL1_02561"
FT   CDS_pept        235672..236613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="NATL1_02561"
FT                   /product="peptide chain release factor RF-2"
FT                   /note="COG1186 Protein chain release factor B [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74820"
FT                   /db_xref="GOA:A2C010"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A2C010"
FT                   /protein_id="ABM74820.1"
FT                   /translation="MRQLDEVKAQLEKLITWRGAIEDANLSLELYELDLDEEILSEAHN
FT                   GLEKLKQELDRWETERLLSGIYDKEGAVLSINAGAGGTDAQDWAQMLLRMYTRWADNNG
FT                   MKVIINELSEGEEAGIKSVTIEIEGVYAYGFLQNEKGTHRLVRISPFNANGKRQTSFAG
FT                   VEVMPKLDEEVELEIPEKDLEITTSRSGGAGGQNVNKVETAVRILHVPTGIAVRCTQER
FT                   SQLQNKDKAMALLKSKLMVIALEQRAAEIADIRGDIVEAAWGNQIRNYVFHPYQMVKDL
FT                   RTEQETTDVDSVMNGEIDIFIQSLLRQNIEES"
FT   gene            236625..236816
FT                   /locus_tag="NATL1_02571"
FT   CDS_pept        236625..236816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74821"
FT                   /db_xref="GOA:A2C011"
FT                   /db_xref="InterPro:IPR021702"
FT                   /db_xref="UniProtKB/TrEMBL:A2C011"
FT                   /protein_id="ABM74821.1"
FT                   /translation="MNNKIISDDVTKKATPPPSFVKLAMKNMVRKGSQSLSHFGLTALG
FT                   FLGFILLVAVLGKPHIPQ"
FT   gene            236821..237375
FT                   /locus_tag="NATL1_02581"
FT   CDS_pept        236821..237375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02581"
FT                   /product="Predicted metal-dependent hydrolase"
FT                   /note="COG319 Predicted metal-dependent hydrolase [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74822"
FT                   /db_xref="GOA:A2C012"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:A2C012"
FT                   /protein_id="ABM74822.1"
FT                   /translation="MGNSSTSSDKLDIDLCFTPFPVQDLDVFVNSDTLELMKNPSKWIE
FT                   EIGSWIRFIQVNSALKCPEIVLNSSQFSLGLELTNDKKILDLNHAWLGQSKTTDVLSFP
FT                   IIDETFFGVSNECIELGDIVISVPTAIRQAKDNNADLFRELRWLATHGLLHLLGWDHSD
FT                   EESLNKMLLIQEQLLDIRGIL"
FT   gene            237401..237859
FT                   /gene="dgkA"
FT                   /locus_tag="NATL1_02591"
FT   CDS_pept        237401..237859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="NATL1_02591"
FT                   /product="Prokaryotic diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /note="COG818 Diacylglycerol kinase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74823"
FT                   /db_xref="GOA:A2C013"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:A2C013"
FT                   /protein_id="ABM74823.1"
FT                   /translation="MVPEISNDSKREVRDMSKTLQRANKRSSWKIAKDLPTSFLYAAKG
FT                   LKYAFSTQRNFRIHVGFALGAFGLSFFLGLNKSDLAIMALTATSVLVVELLNTAIESVV
FT                   DLAIGKRFHPLAQIAKDCSAGAVLVASISSVLIAVLLLFPPLLKQLGV"
FT   gene            237873..238469
FT                   /gene="pabA"
FT                   /locus_tag="NATL1_02601"
FT   CDS_pept        237873..238469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="NATL1_02601"
FT                   /product="para-aminobenzoate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /EC_number="2.6.1.85"
FT                   /note="COG512 Anthranilate/para-aminobenzoate synthases
FT                   component II [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74824"
FT                   /db_xref="GOA:A2C014"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A2C014"
FT                   /protein_id="ABM74824.1"
FT                   /translation="MFLVIDNYDSFTYNLVQYLGELSSQHPIASEVRVERNDALTISEI
FT                   KDLNPDAILLSPGPGDPNQSGVCLDILSELSIEIPTLGVCLGHQAITQAFGGKIIRAKE
FT                   LMHGKTSNVLHRGTGIFKDLPNPLVATRYHSLIAERESFPECLEVIAWLEDETIMGISH
FT                   KDYPHIYGVQFHPESVLTEAGHKLLSNFLDIAKAT"
FT   gene            complement(238509..239624)
FT                   /locus_tag="NATL1_02611"
FT   CDS_pept        complement(238509..239624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02611"
FT                   /product="Aminotransferases class-I"
FT                   /EC_number="2.6.1.9"
FT                   /note="COG79 Histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74825"
FT                   /db_xref="GOA:A2C015"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2C015"
FT                   /protein_id="ABM74825.1"
FT                   /translation="MENIENSFVDLPNPRKDIEDLQPYSAPLEGRRNLLRLDFNENTIG
FT                   PSPLVLKSLREISRDEISVYPEYSGLKEKVVESLIKKNSNVNINSSEVGIFNGVDAAIN
FT                   AIFHAYGNFDDLMLTTSPTFGYYTPCAQMRGMQIKAIPYEGGGFQYPFDSICEFLTQNN
FT                   PKILLICNPNNPTGTRLSPERIIEISKLSSKTLVVVDELYEAFTGDSVLPFVNFQTTPN
FT                   LVVLRSLSKTAGLASLRIGFAIGHSKVINIVNRVTGPYDVNSFAVIAAFAALKDQSYID
FT                   SYVQEVLEARNWIKDQFEKHHVKHHIDGGNYFLLWPKSKPQQVEQKLKSSGILIRNMDK
FT                   KKNLKGSIRVSIGTIDQMKRFWSAFRIVDEV"
FT   gene            complement(239624..241447)
FT                   /gene="argS"
FT                   /locus_tag="NATL1_02621"
FT   CDS_pept        complement(239624..241447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="NATL1_02621"
FT                   /product="Arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COG18 Arginyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74826"
FT                   /db_xref="GOA:A2C016"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C016"
FT                   /protein_id="ABM74826.1"
FT                   /translation="MLEISARLEEALNRAFTKVFPQEDRSSKTSSILTGSNLVPASKPE
FT                   FGDFQINCALSLAKEINRPPRDIAQQIAKQLQQDNDFVRICNPPLIAGPGFINLSINSK
FT                   TLISEIHFRLNDKRLGVPLKKFNTDKIEEEKSNNRVIIDFSSPNIAKEMHVGHLRSTII
FT                   GDSLARVLEFCGYEVLRLNHVGDWGTQFGMLITHLKEVVPEVLHTKDVVEISDLVNFYR
FT                   QAKKRFDEDQIFQNKSRSEVVNLQAGDKESLIAWQLLCNQSRKEFQKIYDRLDIKLTER
FT                   GESFYNKFLVDVINDLKNKKLLINDQGAQCIFLDGLVGKDGKPQPIIIQKSDGGFNYAT
FT                   TDLAAIKYRLTIPPHGDGACRLIYVTDAGQASHFSGVFQIAKLANWIPTDCQIEHVPFG
FT                   LVQGEDGKKLKTRSGETIRLVDLLDEAIQRARDDLKNRLNTESRSENENFIDKVSTTVG
FT                   IASIKYADLSQNRISNYQFSFDKMLSLQGNTAPYLLYALVRIAGISRKGGDLNVSSQNI
FT                   QFNESQEWDLIRKLLQLDSIIAEVEKELLPNRLCGYLFELSQTFNRFYDQVPILKASEP
FT                   SRASRLVLCSITADTLKLGMSLLGIPTLERM"
FT   gene            complement(241515..242378)
FT                   /gene="nadC"
FT                   /locus_tag="NATL1_02631"
FT   CDS_pept        complement(241515..242378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="NATL1_02631"
FT                   /product="Nicotinate-nucleotide
FT                   pyrophosphorylase:Quinolinate phosphoriobsyl transferase"
FT                   /EC_number="2.4.2.19"
FT                   /note="COG157 Nicotinate-nucleotide pyrophosphorylase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74827"
FT                   /db_xref="GOA:A2C017"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A2C017"
FT                   /protein_id="ABM74827.1"
FT                   /translation="MDLRSPKLHKILDTWIEEDLGDGDLTRFVLSDRSASAHWVAKEDG
FT                   TFCGGDLVKLIFRKIDPKVDIQLLIEDGQKFEKNQRLLELKGSSSSLVAGERVSLNVAM
FT                   HLSGIATSTALLVTKLSGSKVKLADTRKTTPGMRVFEKYAFHCGGGINHRLGLDDAAML
FT                   KENHIEWSQGISESIKILKNTIPWTKKIIVEAETPSQAKEAVEAGADGVLLDEMSVQAI
FT                   EKLVPELRQLSKNSKSKYVSQNIVIEVSGINPNNVSDYILTGIDLISTSAPITKSKWID
FT                   FSMRFD"
FT   gene            complement(242683..244077)
FT                   /gene="thdF"
FT                   /locus_tag="NATL1_02641"
FT   CDS_pept        complement(242683..244077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thdF"
FT                   /locus_tag="NATL1_02641"
FT                   /product="putative thiophen / furan oxidation protein"
FT                   /note="COG486 Predicted GTPase [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74828"
FT                   /db_xref="GOA:A2C018"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C018"
FT                   /protein_id="ABM74828.1"
FT                   /translation="MNSFSPTEDTIAAIATAVSPGQGSIAAIRISGSSAIETSKNIVDV
FT                   PGIQDWSTHKVLYGHVTEENRKKYIDEVLILVMKGPRSFTGEDVVEIHCHGGIIPVQKI
FT                   LERILAFPSVRRAEPGEFSQRAVLNGRLSLTQAESISELVSARSRKAAELAINGIEGNI
FT                   QTTIQSIRKRLIEQLTEIEARIDFEEDLPLLDEKHVKNEIVAIKKDLNELIDNAKRGSW
FT                   VRSGLKVALAGKPNVGKSSLMNRLSKQEKAIVTDLPGTTRDILESEIVLEGIPVTFIDT
FT                   AGLRDTKDIIEKIGISRTKKTLIHADLIILIFDYSSGWTNEDESILKQLPVNIPLLIVG
FT                   NKSDLMNDQSFEKVPKYILKKENLVILSAKTGNGEDDLINYLLKKCGSSQTHGLDIALN
FT                   ERQLDLAKSTTESLENINKVFDEKLPWDFWTIDLRQAINYLGELTGEDLTENLLDNIFS
FT                   KFCIGK"
FT   gene            243995..244087
FT                   /locus_tag="NATL1_02651"
FT   CDS_pept        243995..244087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02651"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74829"
FT                   /db_xref="UniProtKB/TrEMBL:A2C019"
FT                   /protein_id="ABM74829.1"
FT                   /translation="MAAILPWPGETAVAIAAIVSSVGENEFINQ"
FT   gene            244148..244603
FT                   /locus_tag="NATL1_02661"
FT   CDS_pept        244148..244603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02661"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3216 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74830"
FT                   /db_xref="GOA:A2C020"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:A2C020"
FT                   /protein_id="ABM74830.1"
FT                   /translation="MKKIFLNLIQRIRKFISWLWNQEGSPSQRALGLGVGIFSGCFPFF
FT                   GLQTLMGVFLAKIFKGNSILAAVGTWISNPFTYVPLYYFNYRLGSLILNKNKNIVDIGH
FT                   ITTNELWFQGWYLSSRLIMGSICMGLFAGIVGGLGLYFLLKKPYHKM"
FT   gene            complement(244655..246991)
FT                   /gene="spoT"
FT                   /locus_tag="NATL1_02671"
FT   CDS_pept        complement(244655..246991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="NATL1_02671"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-diphosphatase, (ppGpp)ase"
FT                   /EC_number="2.7.6.5"
FT                   /EC_number="3.1.7.2"
FT                   /note="COG317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases [Signal transduction
FT                   mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74831"
FT                   /db_xref="GOA:A2C021"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A2C021"
FT                   /protein_id="ABM74831.1"
FT                   /translation="MPKVTSAQNSNQTNTVCDEFFDGQPRLRTHQIKHIDDYEIILPEW
FT                   LKNCIENIPPGIGASCPRDSEALLVAAFDLAYQLHKGQFRKSGEPYITHPVAVADLLRE
FT                   IGASASVIAAGFLHDVVEDTDITPEQLEGYFGSEVRYLVEGVTKLGGIHFNNRTEAQAE
FT                   NLRKMFLAMSSDIRVVLVKLADRLHNMRTISYLGEEKQIRIARETREIYAPLANRLGIG
FT                   RLKWELEDLAFKLLEPDPFREIQQQIASKRSEREERLNTTVQLLKDRLNSAGLHQCEVS
FT                   GRPKHLYGIWSKMQRQKKEFHEIFDVAALRIIVLDVETCYRALAVVHDTFRPIPGRFKD
FT                   YIGLPKPNGYQSLHTAVIGRHRPIEVQIRTPEMHRVSEFGIAAHWKYKEGGSPANPDSE
FT                   KFNWLRQLVEWQQEDGVNDHNDYLASIKEDLFDEEVFVFTPKGDVLGLRNRSTAIDFAY
FT                   RIHSEVGNHCNGARINDRLCVLSTPLENGDFVEILTHKSSHPSLDWLNYVATPTARNRI
FT                   RQWYKKSHRQETISRGKELLEQEFGRKGIDNLLKGHAITKVAERCNLKSTEDLLAALGF
FT                   GALTLHQVINRFREEIKILNQVPETELSDLELATQIGTQANLASNKSKASQTKYSPIVG
FT                   LEGLDYRLGGCCSPLPGEAILGTVALGNHGITIHRTNCVNIESIPNSRRLSVQWNTNAR
FT                   IKEEKFPIQLRIEVIDRVGVLKDILMRLSDRGINVIDARVQTSQGKPACIDLKVELESV
FT                   NQLEITINQIRSMVDVLDIARTSFN"
FT   gene            247047..248651
FT                   /locus_tag="NATL1_02681"
FT   CDS_pept        247047..248651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02681"
FT                   /product="ABC transporter, ATP binding component, possibly
FT                   for oligopeptides"
FT                   /note="COG1123 ATPase components of various ABC-type
FT                   transport systems, contain duplicated ATPase [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74832"
FT                   /db_xref="GOA:A2C022"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C022"
FT                   /protein_id="ABM74832.1"
FT                   /translation="MNNCSKEVLKINKLNAIYPNSTTYVINGLNLKMNRGDRLALVGSS
FT                   GCGKSTVAKAIMQLLPDGSTCYGEIFLNGKNVLKLDEDSLPTIRGKEVGLIFQDPMSRL
FT                   NPLMTVGDHIVDTFKAHDNSEPIYNLVKKAKSLLEKVGIDPLRFNSFPHEFSGGMRQRV
FT                   AIALAICLRPPLIIADEPTTSLDTIVADQIMSELSLLCDEIGTALLLISHDLSMAYKWC
FT                   NKIAILDCGKIVESGNIKQIIGDPKTNIAQKLVESGRLLEGSERKLINKSTVLLSVNRL
FT                   RCWHDLGFWPFNSFWLKAVNEVTFSLYEGETLGIVGPSGCGKSTLCRALTGLLPTRGGS
FT                   VLFLGKNISIINRKSLKQLRKYIQIIFQDPSASLNPKMSVLDAIIDPILIHKLLSRSQA
FT                   REKARNLLDLVGLVPTAMYEQRLPSQLSGGQQQRVAIARALALSPKILICDESVSMLDA
FT                   EIQAEVLELLRSLQEKLKLSMLFITHDLSVAAGFCHRVLVLDKGKIIEENFGKNLLNDP
FT                   QKYLTKKMVKACPRLPN"
FT   gene            complement(248635..249615)
FT                   /gene="rluD"
FT                   /locus_tag="NATL1_02691"
FT   CDS_pept        complement(248635..249615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="NATL1_02691"
FT                   /product="putative pseudouridylate synthase specific to
FT                   ribosomal large subunit"
FT                   /EC_number="4.2.1.70"
FT                   /note="COG564 Pseudouridylate synthases, 23S RNA-specific
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74833"
FT                   /db_xref="GOA:A2C023"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A2C023"
FT                   /protein_id="ABM74833.1"
FT                   /translation="MDKEIKHGFGQGPGELFEGKYKKPLPMRLDRWLVSQRAEQSRAHV
FT                   QKFIEAGFARVNGKTGKAKTPVRPGDIIQLWVPPPEPLPYLKPEEIDLDILYEDDHLIV
FT                   INKTAGMAVHPAPGNKSGTLVNGLIHHCPDLPGIGGKLRPGIVHRLDKDTTGCIVVAKT
FT                   QEALVKLQIQIQKRVASRNYIAVVHGAIKDNEGMIVGSIGRHPKDRKKYAVVDEESGRY
FT                   ACTHWKLIENLGNFSLLKFKLDTGRTHQIRVHSAHIGHPIIGDQTYSRCKKLPIKLGGQ
FT                   ALHAIELGLIHPITLEKMKFTAPLPEDFERLLKVLQAKNNINSEV"
FT   gene            complement(249615..250478)
FT                   /locus_tag="NATL1_02701"
FT   CDS_pept        complement(249615..250478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02701"
FT                   /product="Predicted GTPases"
FT                   /note="COG1161 Predicted GTPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74834"
FT                   /db_xref="GOA:A2C024"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C024"
FT                   /protein_id="ABM74834.1"
FT                   /translation="MNKQIIQWYPGHIAKAEKQLKENLRKVDLVFEVRDARIPLATSHP
FT                   YLQKWLKGKKQILVLNRKDMINIDAYQAWDKKLRSEGKVPWWCDAKAGTGVLQIKNAAI
FT                   RAGQELNQRRLDRGMKNRAIRVLTLGFPNVGKSALINRLVKKKVVSSSRKPGVTRSLRW
FT                   VRLGQDLDLLDAPGVLPPRFEDQNAALKLAICDDIGQAAYDTEQVAISFMKLLETLENI
FT                   QEAGIKSMCLQNRYGIFVNETIKDKYSWLLSAAERHTSGDTQRMSQRLLDDFRKNLLGN
FT                   ISLELP"
FT   gene            250960..252165
FT                   /gene="pgk"
FT                   /locus_tag="NATL1_02711"
FT   CDS_pept        250960..252165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="NATL1_02711"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="COG126 3-phosphoglycerate kinase [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74835"
FT                   /db_xref="GOA:A2C025"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C025"
FT                   /protein_id="ABM74835.1"
FT                   /translation="MSKRSLSSLGAEDLCGKRVLVRVDFNVPLGDEGQITDDTRIRAAL
FT                   PTINDLLDKSARVILSAHFGRPKGEVNETMRLTAVAQRLSELLGKTVVKTESCIGAEAK
FT                   SKVDAMSNGDVVLLENVRFISGEEKNDTEFAKELASLAEVYVNDAFGAAHRAHASTEGV
FT                   TKFLSPCVAGYLMEKELKYLQGAIDQPKSPLAAIVGGSKVSSKIGVLESLIDKCDKIIV
FT                   GGGMIFTFYKARGLSVGNSLVEEDKLELASALEKKAKEKGVEFLLPTDVVLADNFSPDA
FT                   NSKLSKVDAISEGWMGLDIGSESVELFQNALKDCKTVIWNGPMGVFEFEKFANGTNAIA
FT                   NTLAELSAQGCCTIIGGGDSVAAVEKAGLAKNMSHISTGGGASLELLEGKVLPGVSALD
FT                   DA"
FT   gene            complement(252204..252923)
FT                   /locus_tag="NATL1_02721"
FT   CDS_pept        complement(252204..252923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74836"
FT                   /db_xref="UniProtKB/TrEMBL:A2C026"
FT                   /protein_id="ABM74836.1"
FT                   /translation="MRHSLTTKLIGFLFLYPLLINSALSKNINNQFLSNQLEQILNERK
FT                   DDLVKDLFSKQSFYKFNKQSLAFRNKYKDSKWSIKMIRNDPKKSLLDVKIKSTRTIGNQ
FT                   TYNLYTKQTVEIETYKNKIKSYQVIDEESILNSQQSPLIVKIISPDKVLTGERYEINLI
FT                   IERPLDNLLTASGMIVLKNNEKMILSNDLFGIKPNQSGGLFKYIQAPSEPGSQTISAII
FT                   THPEGIYSFTKKIKVGL"
FT   gene            252979..254037
FT                   /gene="murG"
FT                   /locus_tag="NATL1_02731"
FT   CDS_pept        252979..254037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="NATL1_02731"
FT                   /product="Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc
FT                   GlcNAc transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="COG707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase [Cell envelope biogenesis,
FT                   outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74837"
FT                   /db_xref="GOA:A2C027"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C027"
FT                   /protein_id="ABM74837.1"
FT                   /translation="MPRLLIAASGTGGHIYPALSFADSLSNSWEIVWLGVPNRLEVELV
FT                   PEKYNLIKLKVGGLQGNIFRKLFDLCKLLFASVQVSVLLRQKKINVIFTTGGYISAPCI
FT                   LGAKMAGIPVLLHESNAIPGKVTRLLGRFCDHVALGIPSASEYLQRCRTSFTGTPVRTE
FT                   FLFEKSLPSWVPLGEGVLIVVMGGSQGAIKMNEMVRKILPCLIEKGCRVVHLTGKNDCF
FT                   YRNRDQEKSHPNLVVRDFSDEMPALLRNADLAISRSGAGAICELMVTKTPSILIPFPSS
FT                   TDQHQELNAAYMARFGGAIIVNQHDPEKNILKNIVSNLLDSNSLREMKLNMNNHDYSYP
FT                   EKKIFEIIHSIS"
FT   gene            complement(254030..255112)
FT                   /locus_tag="NATL1_02741"
FT   CDS_pept        complement(254030..255112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02741"
FT                   /product="Aminotransferases class-I"
FT                   /EC_number="2.6.1.9"
FT                   /EC_number="4.1.1.81"
FT                   /note="COG79 Histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74838"
FT                   /db_xref="GOA:A2C028"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2C028"
FT                   /protein_id="ABM74838.1"
FT                   /translation="MNINFENHGGNIEKEARKLGLSTENIIDASASIVPFKLPNKLNNY
FT                   LINSIKNRSIRSYPDRSYFEVRNAISKWHNIEPSMILPGNGASELFTWAARDASLNGIS
FT                   SLPSPGFGDYQRALKCWNAPYVHNPLPLSWTNNNPQSFPIEPKANVLWITNPHNPTGQL
FT                   WSRSSIENLLANYKLVICDEAFISLVPGGESQSIIDLTNIYKNLIVIRSLTKFLGIAGL
FT                   RVGYAVTNSDRLLKWKEIRDPWPVNTLAINATKMIMKDSKMHKKRLNKIHRWVEKEGKW
FT                   LYQSLSSFSTIKPLPSTTNFQLIKSESSILNLLENLKKRGIILRDCRSFINLDEKWFRI
FT                   SLLKREQNIQIINTLKDYIN"
FT   gene            complement(255182..256339)
FT                   /gene="pyrD"
FT                   /locus_tag="NATL1_02751"
FT   CDS_pept        complement(255182..256339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="NATL1_02751"
FT                   /product="Dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="COG167 Dihydroorotate dehydrogenase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74839"
FT                   /db_xref="GOA:A2C029"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2C029"
FT                   /protein_id="ABM74839.1"
FT                   /translation="MPTTKKNDLYNILLGQLLSQDEGIDAEILTNSALNAIKFASLNRN
FT                   FPLISNILLKASNDFQRNNSSLNQIVFGSHFKNPVGLAAGFDKNGVGAGLWNYFGFGFA
FT                   ELGTITWHAQEGNPKPRLFRIAKEKAALNRMGFNNQGAENFLKTIEKQKILAPGNRPCV
FT                   LGINLGKSKITPLDEAHIDYSLSLKLLAPLSDYAVINVSSPNTPGLRSLQGTKQIKKLI
FT                   ITLKDLPNCPPLLVKIAPDLSNEAIDEIARVAMENGIDGIIAINTSLDRFDLKNLKIKT
FT                   GNTLGQENGGLSGLPLQKRGLEVIRRLRRSTDNDLPLIGVGGIHSARAAWERITAGASL
FT                   VQIYTGWIFEGPNLVPDILDGLIQQMEKHGFRNIKEAIGSEEPWK"
FT   gene            complement(256326..256811)
FT                   /gene="rnhA"
FT                   /locus_tag="NATL1_02761"
FT   CDS_pept        complement(256326..256811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="NATL1_02761"
FT                   /product="Ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="COG328 Ribonuclease HI [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74840"
FT                   /db_xref="GOA:A2C030"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C030"
FT                   /protein_id="ABM74840.1"
FT                   /translation="MSKEEKLAIAAATDGACSGNPGPGGWGALIRFQDGSEIEFGGNSP
FT                   ETTNNRMELQAALFILEKLKNIEFAPSLTIKTDSKYLIDGMEKWMPNWKKKGWKTASGK
FT                   PVLNQDLWKALDHPELPKIKLQYVKGHSGEKDNDRVDAIAVAFSKGRKIQLKDFANN"
FT   gene            complement(256879..257274)
FT                   /gene="rplL"
FT                   /locus_tag="NATL1_02771"
FT   CDS_pept        complement(256879..257274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="NATL1_02771"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="COG222 Ribosomal protein L7/L12 [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74841"
FT                   /db_xref="GOA:A2C031"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C031"
FT                   /protein_id="ABM74841.1"
FT                   /translation="MSAKTDEILDSLKSLSLLEASELVKQIEEAFGVSAAASAGVVMAA
FT                   PGAAAGGDGADAAEEKTEFEVVLESFDASSKIKVLKEVRNATGLGLGEAKALVEAAPKT
FT                   IKEGATKEDAEALKKAIEAVGGKVTLK"
FT   gene            complement(257327..257854)
FT                   /gene="rplJ"
FT                   /locus_tag="NATL1_02781"
FT   CDS_pept        complement(257327..257854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="NATL1_02781"
FT                   /product="50S ribosomal protein L10"
FT                   /note="COG244 Ribosomal protein L10 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74842"
FT                   /db_xref="GOA:A2C032"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C032"
FT                   /protein_id="ABM74842.1"
FT                   /translation="MGRTLESKKQIVKKIEDLLDNSEMALVLDYKGLSTKEMSDLRSRL
FT                   QQSDGVCKVTKNTLMRQAIKGKNSWTGLDSLLTGTNAFVLIKGDVGSAVKAVQAFQKET
FT                   QKSETKGGLFEGKLLSQDEIKAIAKLPSKEALMGQIAGALNSITSKIAIGINEVPSGLA
FT                   RSLKQHSESGES"
FT   gene            complement(258078..258785)
FT                   /gene="rplA"
FT                   /locus_tag="NATL1_02791"
FT   CDS_pept        complement(258078..258785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="NATL1_02791"
FT                   /product="50S ribosomal protein L1"
FT                   /note="COG81 Ribosomal protein L1 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74843"
FT                   /db_xref="GOA:A2C033"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C033"
FT                   /protein_id="ABM74843.1"
FT                   /translation="MKNFSKRMTTLLSKVEERSYSPIEAIKLVKENANAKFDETIEAHI
FT                   RLGIDPKYTDQQLRTTVALPSGTGQKIRIAVVTRGEKVNEATKAGADLAGEEDLVDSIN
FT                   KGEMNFDLLISTPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLEGAIKEFKAGKLEFR
FT                   ADKAGIVHVRFGKASFSEEALLENLKTLQTTIEKNKPSGAKGKFWRSFFITSTMGPSVE
FT                   VDINELQDLQKEK"
FT   gene            complement(258856..259281)
FT                   /gene="rplK"
FT                   /locus_tag="NATL1_02801"
FT   CDS_pept        complement(258856..259281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="NATL1_02801"
FT                   /product="50S ribosomal protein L11"
FT                   /note="COG80 Ribosomal protein L11 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74844"
FT                   /db_xref="GOA:A2C034"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C034"
FT                   /protein_id="ABM74844.1"
FT                   /translation="MAKKVVALIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNSR
FT                   TQDKAGFVIPVEISVFEDRSFSFITKTPPASVLITKAAGIAKGSGESAKGSAGSISTSQ
FT                   LEEIAKTKLPDLNCSSIESAMKVIEGTAKNMGVSIKD"
FT   gene            complement(259385..260053)
FT                   /gene="nusG"
FT                   /locus_tag="NATL1_02811"
FT   CDS_pept        complement(259385..260053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="NATL1_02811"
FT                   /product="transcription antitermination protein, NusG"
FT                   /note="COG250 Transcription antiterminator [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74845"
FT                   /db_xref="GOA:A2C035"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A2C035"
FT                   /protein_id="ABM74845.1"
FT                   /translation="MSEIETTPAKDSKIIDRSEAIEDDQSFLANQSIKTNIARWYAIQV
FT                   ASSCEKKVKATLEQRAITLGVSDRIIEIEIPQTPAVKLKKDGSRQTTEEKVFPGYVLVR
FT                   MVLDEDTMMAVRSTPNVINFVGAEDRRATGKARGHIKPRPLSRQEVNRIFKRAAEKKTV
FT                   VKLDVEEGDQIVVTAGPFKDFQGEVIEVSGERNKLKALLSIFGRETPVELEFSQITKQN
FT                   "
FT   gene            complement(260096..260236)
FT                   /locus_tag="NATL1_02821"
FT   CDS_pept        complement(260096..260236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02821"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74846"
FT                   /db_xref="GOA:A2C036"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A2C036"
FT                   /protein_id="ABM74846.1"
FT                   /translation="MKLVVWPSRQQLFSESVAVILMVTLSAVSIAAVSRFYGWASTQIF
FT                   R"
FT   gene            complement(260411..263206)
FT                   /gene="clpB2"
FT                   /locus_tag="NATL1_02831"
FT   CDS_pept        complement(260411..263206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB2"
FT                   /locus_tag="NATL1_02831"
FT                   /product="putative ATP-dependent Clp protease, Hsp 100,
FT                   ATP-binding subunit ClpB"
FT                   /EC_number="3.4.21.92"
FT                   /note="COG714 MoxR-like ATPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74847"
FT                   /db_xref="GOA:A2C037"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A2C037"
FT                   /protein_id="ABM74847.1"
FT                   /translation="MTTLNQKSSKMNGSLTTEPDSFSDEAWSLLLIAEQSARRWRHKNL
FT                   DVEHLIEVLFRNKKYQKYTNSLPINHKELNEILENFIAELPINNQPDLFIGEDLEILLE
FT                   VADDFRSRWGSNQIEISHILIAIGRDNRLGEDLFYQAGLPSEILEAELRRLPAPKSFKQ
FT                   SKRNQNKPITNRPQKDSQSFMPTETTAKDPKPEPLPPLSKEEITSKQEPLSLNEAPSAL
FT                   DLYCKDLTTEAENGTLDPVIGRESEIKAITKVLSRRGKNNPVLIGAPGVGKTAIAELLA
FT                   QKIVDNELPESLQGLRLISLDIGALIAGAKFRGQFEERFRSLLSEINNSEKGVILFIDE
FT                   LHTIVSKDRSNTDAGSLLKPLLASGDLRCIGATTPDNYRRTIEKDLALNRRFQQVSIKE
FT                   PSLDLSLEILKGLKENYEVHHGVIITDEALITANRLAYRYISDRCLPDKAIDLIDEASA
FT                   QVRIESASKPKIIEEKESQVNHLESSIINADKDTTLETINNLQEKKELLLFELAEIKQK
FT                   WQDQIDKSAELQELKISLKELKNLIREVEISGDMEEVEKLKYDQLYQLQERIEEIEVSI
FT                   REDNEYGNSLLKDKVNPEDIADVVSRWTGIPVRKVVSGERQKLLKLEQDLGKKVIGQLN
FT                   AVQAVSAAIRRARAGMQDIKRPIGSFLFLGPTGVGKTELAKSLASSLFDEEDALLRLDM
FT                   SEYMERNAVSRLLGAPPGYVGYEEGGQLTEAIRKRPYAVLLLDEIEKAHQEVFNILLQV
FT                   LDDGRLTDSQGRTVDFRNTVIVMTSNLASKAILNNSLQLQSENSNKNILLQELDQKINE
FT                   ALTKHFRPEFLNRIDEVIKFNPLKPDSLEQIVRLQLDELKKLLKHQGLDLYVDENTIKI
FT                   LAEEGYEPEYGARPLRRVIRRRLENPLATQILEEAFQGAKSIRVETKEDDSEKLLFLID
FT                   N"
FT   gene            263364..264665
FT                   /gene="eno"
FT                   /locus_tag="NATL1_02841"
FT   CDS_pept        263364..264665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="NATL1_02841"
FT                   /product="Enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="COG148 Enolase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74848"
FT                   /db_xref="GOA:A2C038"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C038"
FT                   /protein_id="ABM74848.1"
FT                   /translation="MADSLELVIDTIMAREVLDSRGNPTVEAEVLLEGGAIGRSIVPSG
FT                   ASTGAHEAHELRDGGKRYLGKGVLKAVNHIEENIAPALCGLSSLDQATVDSVMKQLDDT
FT                   DNKSNLGANSILAVSMATARAAANGLGLPLYRYLGGPMSSLLPVPLMNVINGGEHAANN
FT                   LDFQEFMLVPHGAESFREALRMGAEVFHTLKDLLSQKGLSTAVGDEGGFAPNLESNKAA
FT                   GDLLMQAIEQAGFKPGEQVSLALDVASTEFYEEGQYCYGGNSYSSEQMVEELAGLVNSF
FT                   PIVSIEDGLAEDDWDGWSLLTKKLGKSVQLVGDDLFVTNTLRLQRGIDENIANSILIKV
FT                   NQIGSLTETLEAIELASRSSYTTVISHRSGETEDTTIADLSVATKSGQIKTGSLSRSER
FT                   VAKYNQLLRIEDELGSQATYAGLVGLGPRGSLKG"
FT   gene            complement(264676..266301)
FT                   /locus_tag="NATL1_02851"
FT   CDS_pept        complement(264676..266301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02851"
FT                   /product="possible kinase"
FT                   /note="COG661 Predicted unusual protein kinase [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74849"
FT                   /db_xref="GOA:A2C039"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A2C039"
FT                   /protein_id="ABM74849.1"
FT                   /translation="MILLGLLFYLWFDSKKWTYLKGYTTKKREKRTISRAKWITKELIN
FT                   LGSAFIKLGQLLSARADVIPSSWVNELTSLQDRVPPFAFEKVDEILRKQLGNLYNKIIS
FT                   IDKNPIGSASLAQVHKARLNNDKNVIFKVQRPDIEKFFRLDLDVMNQVAKVVQRIKSLS
FT                   RGNDWIGIAKESRRVLLRELDFRIEAQYAARFKQQFIDDSDILIPSVFWDLSTSKVLCL
FT                   EYLPGIKINDIKSLKSNDIDTSSIAKIGATSYLKQLVNYGFFHADPHPGNLAVSKSGSL
FT                   IYYDFGMMGFVSERIRGRLNSMIKAAALRDVSGLVKELQIAGLIEDDIEIGPVRRLIRI
FT                   MLNEALTPPFDSQIIEKLSGDISELAYGKPFRIPIELIFVFRALSTFEGVGRYLDPEFN
FT                   LIAIAKPFLLPLMTSKNPDSNDLFNELGRQVTEIGSKAVGLPKRLDENLERLEQGDLQL
FT                   QVRMGESDRQLRRMINAQQTLGNSVLLGSLAISSALLASNSKPHLFFIPLIPGFPIALN
FT                   WITLQFKMRNENRLDNFQGRRGSR"
FT   gene            complement(266352..266663)
FT                   /locus_tag="NATL1_02861"
FT   CDS_pept        complement(266352..266663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02861"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74850"
FT                   /db_xref="UniProtKB/TrEMBL:A2C040"
FT                   /protein_id="ABM74850.1"
FT                   /translation="MSDSEILLKAAINRISARITEKLINSAQEFTEIAEELPQKFKNEW
FT                   NSFKEEVIEESERLEKKTNESKEKTSEEQLSKEDSIQIQIDNLRSKVIDINKDIEGKN"
FT   gene            266720..266863
FT                   /locus_tag="NATL1_02871"
FT   CDS_pept        266720..266863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02871"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74851"
FT                   /db_xref="UniProtKB/TrEMBL:A2C041"
FT                   /protein_id="ABM74851.1"
FT                   /translation="MKLGMGRFALNQLNLFRRLVVIVHLKEFSLELDKLTFDLIWGKSL
FT                   IY"
FT   gene            266931..267887
FT                   /locus_tag="NATL1_02881"
FT   CDS_pept        266931..267887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02881"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="COG492 Thioredoxin reductase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74852"
FT                   /db_xref="GOA:A2C042"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2C042"
FT                   /protein_id="ABM74852.1"
FT                   /translation="METIETDVVIVGGGPAGCSCALYTSRADLRTVILDKNPDVGALAI
FT                   THQIANYPGVSSEMSGEALLKLMRDQATQYGADYRRAQVFGIDSSGDWKTIYTPEGTFK
FT                   AKALVVASGAMGRPASFKGEAEFLGRGVSYCATCDGAFYRDREVAVVGINKEAIEEANV
FT                   LTKFASKVHWITSNDPKSDDHHAQDLLSKPNVNHWSKTRLMQIEGNDGGVTGIKVKNRS
FT                   IDTLQDLALEGVFVYMSGSKPITDFLGEQVAFKEDGGVLVDDFMSTTVEGVWAIGDIRN
FT                   TPFKQAVVAASDGCIAAMAIDRYLNSRKSIRVDWVHA"
FT   gene            complement(267911..268192)
FT                   /locus_tag="NATL1_02891"
FT   CDS_pept        complement(267911..268192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02891"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74853"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A2C043"
FT                   /protein_id="ABM74853.1"
FT                   /translation="MKRLDLIFSERELDDVLSALEKAEVPGYTVMKHATGRGPERIITE
FT                   DMEFTGFGSNAHVIIFCEQVVIDKIRENIKSVLSYYGGVAYVSEATPL"
FT   gene            complement(268204..269196)
FT                   /locus_tag="NATL1_02901"
FT   CDS_pept        complement(268204..269196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02901"
FT                   /product="putative sodium-dependent bicarbonate
FT                   transporter"
FT                   /note="COG3329 Predicted permease [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74854"
FT                   /db_xref="GOA:A2C044"
FT                   /db_xref="InterPro:IPR010293"
FT                   /db_xref="UniProtKB/TrEMBL:A2C044"
FT                   /protein_id="ABM74854.1"
FT                   /translation="MGQNLFIQNALSPPILFFFLGAIAYALKSDFEIPAPLPKLFSLYL
FT                   LLAIGFRGGIELQRSGFSYPVLPTVVAAILMSLLIPLICFLILRLKFDVFNAAAISAAY
FT                   GSISAVTFITAESFLESQNIPFDGFMVAALALMESPAIIIGLLLVKFGATKNRPIKRKM
FT                   KWGSILHESMLNGSVYLLLGSLLIGFLTSAVDPSDIKKMEPFTGELFYGAECFFLLDMG
FT                   IVAAQRLARLNKTGAFLIMFSILMPIVNAVLGSVVARFLNLDPGNALLFVVLCASASYL
FT                   AVPTAMRMTVPEARPSYYISTTLGLTFPFNIIFGIPVYMSLVNTMIPQI"
FT   gene            complement(269243..270910)
FT                   /locus_tag="NATL1_02911"
FT   CDS_pept        complement(269243..270910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02911"
FT                   /product="putative sulfate transporter"
FT                   /note="COG659 Sulfate permease and related transporters
FT                   (MFS superfamily) [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74855"
FT                   /db_xref="GOA:A2C045"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A2C045"
FT                   /protein_id="ABM74855.1"
FT                   /translation="MALINGFHLKNIRGDVLGGLTAAVVALPLALAFGNAALGPGGAIY
FT                   GLYGAVVVGFLAALFGGTPAQVSGPTGPMSVTVAGVVASLAAVGVPRDLSAGEILPLVM
FT                   AAVVIGGLFQILFGLLRLGKYITLVPYSVVSGFMSGIGVIIITLQIGPLLGISTRGGVL
FT                   ESLSTLFNNFEPNGAAVAVAVMTLAIVFLTPRKISQWVPSPLLALLIVTPLSILLFGDS
FT                   SIDRIGAIPEGGLSLSLPDPSLGNFFPIILKAGLVLAVLGAIDSLLTSLVADNISQTRH
FT                   NSDRELIGQGIGNAVAGIFTGLPGAGATMRTVINVKSGGSTPISGMVHSVVLLFVLVGA
FT                   GPLAAQIPTALLAGILIKVGLDIIDWGFLLRAHKLSLKTASVMYGVLFMTVFWDLIWAV
FT                   LVGVFIANMLTIDSITETQLEGMEADNPFDSTSNNNAANAQLPSDEKALLDRCAGEVML
FT                   FRLKGPLSFGAAKGITERMMLVRNYKVLILDITDVPRLGVTATLAIEDMVQEALSNSRK
FT                   AYVAGATGRVKDRLAKFGVDVIGTRKEALVAAIDSLNG"
FT   gene            271054..271989
FT                   /locus_tag="NATL1_02921"
FT   CDS_pept        271054..271989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02921"
FT                   /product="DnaJ3 protein"
FT                   /note="COG2214 DnaJ-class molecular chaperone
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74856"
FT                   /db_xref="GOA:A2C046"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2C046"
FT                   /protein_id="ABM74856.1"
FT                   /translation="MELNGFKDYFKILGISRNATDQEIKSAFRKLARQFHPDLHPNDQK
FT                   AESEFKEINAAYEILSDEAKKKSYEQHLSYWFKKRAGKSRDFSTENNDNQFDEYLNFDD
FT                   FLSDLIGRFSEVSQDIYSNISSNKNAQSLNLDAEFNLQISFLEALNGTKKNLLVNDERI
FT                   EVTIPQGIETGSKIRIKNKGNIQSGKGKRGDLLIEVSVKSHPIWKVKGLDVYADLPLSL
FT                   DEFALGANIMVVSPQGDTYLSIPSGSLPEQKLRLQGQGLHNLDTQGDLFFTLKLKLPEN
FT                   WSADELRLLEKLRSVRIDEPRSSWFEKART"
FT   gene            272024..273022
FT                   /gene="hemB"
FT                   /locus_tag="NATL1_02931"
FT   CDS_pept        272024..273022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="NATL1_02931"
FT                   /product="Delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="COG113 Delta-aminolevulinic acid dehydratase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74857"
FT                   /db_xref="GOA:A2C047"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A2C047"
FT                   /protein_id="ABM74857.1"
FT                   /translation="MDLTYRPRRLRRTNSLREMVRENTVSASDFIYPLFVHEGSDTQEI
FT                   AAMPGTSRWPIDGLIDEVKRAWNLGIRCVVIFPKVPDEQKTEDGAECFNEKGLIPRTIE
FT                   RLKKEIPEMCVMTDVALDPYSCDGHDGIVSDDGIILNDATVNYLCKQAVVQARAGADLI
FT                   GPSDMMDGRVGAIREALDDEGFEHVGIISYTAKYSSAYYGPFREALDSAPRSISNKPIP
FT                   KNKNTYQMDPANAREAITEAQLDEQEGSDILMVKPGLAYLDIIYRLREESELPIAAYNV
FT                   SGEYSMVKAAAQRGWIDEREIVLETLLSFKRAGANLILTYHACDAAGWLKE"
FT   gene            273072..273476
FT                   /locus_tag="NATL1_02941"
FT   CDS_pept        273072..273476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02941"
FT                   /product="Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /note="COG346 Lactoylglutathione lyase and related lyases
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74858"
FT                   /db_xref="GOA:A2C048"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A2C048"
FT                   /protein_id="ABM74858.1"
FT                   /translation="MQKKQSELNIESVHRLGHVAIRVEDVNRAKSFYMTLGMKLIWDDT
FT                   DWCYLEAGDSKDGLALLGPSYKAAGPHFAFHFTNKDEIERIHDSLKKQGIKVGALHDHR
FT                   DGTSSFYLKDTEGNWLEMLYHPSTGIPTNQ"
FT   gene            273492..275906
FT                   /locus_tag="NATL1_02951"
FT   CDS_pept        273492..275906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02951"
FT                   /product="putative DNA mismatch repair protein MutS family"
FT                   /note="COG1193 Mismatch repair ATPase (MutS family) [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74859"
FT                   /db_xref="GOA:A2C049"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:A2C049"
FT                   /protein_id="ABM74859.1"
FT                   /translation="MGLTKNHDDSKKAQIISESLDLLEWPTVCSHLSTFALTQQGRKKC
FT                   ESFDLPRNLSLSQELLSQTLEIGSLDSSLNEGISFDGVHDLENILLICSKGGIAIGEDL
FT                   LKVADTLRAARKLRKLIFDQVIRPRLSELLKDVATLPDLQKLLEFGLDEGGRIADRASP
FT                   KLSELRRYRNSVRLQRKDILQDIIRKYGGLLQDNIISERYGRPVLAFKAGTSDQIKGMV
FT                   HDSSASGNTIYVEPQVVISIGNRLAKIDSEISDEERRLLADWSKEVGLNAIVIAHLVEI
FT                   LLQIEFALSRARYSKWLNGVPAILDQEEHSLFEIKDFRHPLLVWNDFHEKKNTVVPTSF
FT                   DVAPDLKVVAITGPNTGGKTVALKSIGLAVLMAKAGLLLPCTGSPRLPWCKNVFADIGD
FT                   EQSLQQNLSTFSGHILRISRILDAIDVFPGTTLVLLDEVGAGTDPTEGTALAMALLQVM
FT                   ANRARLTIATTHFGQLKALKYSDSRFENASVSFDSETIQPTFHLQWGIPGRSNAIEISK
FT                   RLGLDEQVIISAQKFINPERVDNVNQVIQGLEKQRERQQSAAEDAAALLAKTELLHEEL
FT                   LNSWQKQRQQSEEFNEQGRFKLESSIREGQKEVRHLIKRLRDQNASGETARIAGQRLRQ
FT                   IEKGYRNDKRINHTQSWTPKIGEKVRLSSIGKAGEIISFSDDGMQLTVLCGVFRSKVNL
FT                   TEVESLDGQKVEINQNVQVKTSQVRKNLSLVRTKKNTLDVRGLRVHEAEGVIEEKLRNC
FT                   SGALWVIHGIGSGKLKKGLRKWFDSLPYIEKVADAEPHDGGPGCSVVWMVD"
FT   gene            276006..276995
FT                   /gene="obg"
FT                   /locus_tag="NATL1_02961"
FT   CDS_pept        276006..276995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obg"
FT                   /locus_tag="NATL1_02961"
FT                   /product="GTP1/OBG family"
FT                   /note="COG536 Predicted GTPase [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74860"
FT                   /db_xref="GOA:A2C050"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C050"
FT                   /protein_id="ABM74860.1"
FT                   /translation="MQFIDQAIIDVKAGSGGDGISAFRREKYVPAGGPAGGDGGQGGNV
FT                   VLEADDNLQTLLDFKFQKLISAENGQRGGPNKCTGASGKDTVLKVPCGTEVRHLSTNII
FT                   LGDLTNKGQQLIVAFGGKGGFGNARYLSNSNRAPEKFTEGKVGEEWSLQLELKLLAEVG
FT                   IIGLPNAGKSTLISVLSSARPKIADYPFTTLIPNLGVVRRPSGDGTVFADIPGLISGAS
FT                   KGIGLGHDFLRHIERTKVLLHLIDSASTDPINDFKTINEELTSYGHGLISRPRIFVLNK
FT                   KELLNEHEIKKLLNKIEKLTMKKVHIISAVTKFGLDDLLSSIWYELGY"
FT   gene            277073..277255
FT                   /locus_tag="NATL1_02971"
FT   CDS_pept        277073..277255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02971"
FT                   /product="conserved hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74861"
FT                   /db_xref="UniProtKB/TrEMBL:A2C051"
FT                   /protein_id="ABM74861.1"
FT                   /translation="MDFYSCFDGQGEIIARCQTDQDINVLKKMGRPIAEVRHMKNEEAV
FT                   VCSLTGSPSDFNMDY"
FT   gene            complement(277325..277543)
FT                   /locus_tag="NATL1_02981"
FT   CDS_pept        complement(277325..277543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02981"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74862"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="UniProtKB/TrEMBL:A2C052"
FT                   /protein_id="ABM74862.1"
FT                   /translation="MKTIDEHIKKDESEIQEAKAQGNDSKLHHLEDELNSLKEYKEHHP
FT                   EDKHDPNALELFCDANPDEPECLVYDD"
FT   gene            complement(277712..278374)
FT                   /locus_tag="NATL1_02991"
FT   CDS_pept        complement(277712..278374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_02991"
FT                   /product="Uncharacterized integral membrane protein"
FT                   /note="COG5413 Uncharacterized integral membrane protein
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_02991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74863"
FT                   /db_xref="GOA:A2C053"
FT                   /db_xref="InterPro:IPR019275"
FT                   /db_xref="UniProtKB/TrEMBL:A2C053"
FT                   /protein_id="ABM74863.1"
FT                   /translation="MKEENSYFTSSNPIKGVYGDFIVTSNDKKEVLFYRLSILFCGLFF
FT                   SIGIAQWFFNGSNQIWIWLLCMAISIGLSLKWIHIYLIPLHRTLTIFWVLGCIGLLILL
FT                   YHFGVTNLIYGLRENPKSILLVGPLFASLTGIGFKEFFCFRRIEAIGITIFIPIALIGY
FT                   LTELANESFTFATLVLSSLLLLLMGIRKFNLPAEADIGDKSVFDYLESQRKLKVSDT"
FT   gene            complement(278384..279358)
FT                   /gene="ecm4"
FT                   /locus_tag="NATL1_03001"
FT   CDS_pept        complement(278384..279358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecm4"
FT                   /locus_tag="NATL1_03001"
FT                   /product="Glutathione S-transferase C terminus"
FT                   /note="COG435 Predicted glutathione S-transferase
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74864"
FT                   /db_xref="GOA:A2C054"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A2C054"
FT                   /protein_id="ABM74864.1"
FT                   /translation="MAIPPIFVKAARDIWSFEWKILMNGLAPSDSNGNYKRPINIQQQI
FT                   QIPTKEDLNNRASNQMPGLIIGRSCPWAHRAWIIHEIKGLKKSINLHIAQVDNEGGRWR
FT                   LDPPIKGCKTLQELYQKCGNYQSRRATVPMLFDPGKEPKSKLRLINNESAELVEILNNW
FT                   PIYDQEIDLNPSKYKKEIINWQNLIQENINNGVYKCGFARNQKAYEKASKNLFSTLNII
FT                   EEHLKSNGPWLCGKNLSIADIRLFPTLIRWEAIYYPLFKCSNKPIKSFPHIIKWRKKIF
FT                   NMYNIKKTCDVDAWRKDYFGALFPLNPSSIIPKGEDITTTINN"
FT   gene            279402..280319
FT                   /gene="aspA"
FT                   /locus_tag="NATL1_03011"
FT   CDS_pept        279402..280319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="NATL1_03011"
FT                   /product="putative aspartoacylase"
FT                   /note="COG2988 Succinylglutamate desuccinylase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74865"
FT                   /db_xref="GOA:A2C055"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C055"
FT                   /protein_id="ABM74865.1"
FT                   /translation="MKQLQVLLVAGTHGNEINGIWLFDEWKKSSFLINTHGIKTFQVIG
FT                   NPEAKKAGKRYIHHDLNRSFKEGSFIKINPLNCERTRASELVNLYGEAGENPCQIALDF
FT                   HTTTASMGSCIVVYGRRDADLALASLIQNQLGLPVYLHESDQKQTGFLVESWPCGLVVE
FT                   IGPIGQGLLNSRIISQTKLILETLMEQIHEVKNLNLFFPNKLIIHRHIKSIDFPRDEEG
FT                   NIDGYVHSLRQSKDWQELKKNDELFCKLNGEIIRFEEDEPYIPVFINEAAYVEKNIAMS
FT                   FTKRELWNFKKEWKQALIDLIHQK"
FT   gene            complement(280310..280444)
FT                   /locus_tag="NATL1_03021"
FT   CDS_pept        complement(280310..280444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03021"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74866"
FT                   /db_xref="UniProtKB/TrEMBL:A2C056"
FT                   /protein_id="ABM74866.1"
FT                   /translation="MVLIKWLINGHRLEERVPLSDARHRKYELEAQGAIIYWSERTYF"
FT   gene            280642..281724
FT                   /gene="psbA"
FT                   /locus_tag="NATL1_03031"
FT   CDS_pept        280642..281724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbA"
FT                   /locus_tag="NATL1_03031"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74867"
FT                   /db_xref="GOA:A2C057"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C057"
FT                   /protein_id="ABM74867.1"
FT                   /translation="MTTIQQQRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLAA
FT                   TTCFIVAFIAAPPVDIDGIREPVAGSFMYGNNIISGAVVPSSNAIGLHFYPIWEAATLD
FT                   EWLYNGGPYQLVIFHFLIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYP
FT                   FGQGSFSDGMPLGISGTFNFMFVFQAEHNILMHPFHMAGVAGMFGGALFSAMHGSLVTS
FT                   SLIRETTGLDSQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLASWPV
FT                   ICVWLTSMGICTMAFNLNGFNFNQSVVDTSGKVVPTWGDVLNRANLGMEVMHERNAHNF
FT                   PLDLAAAESTSVALVAPAIG"
FT   gene            281855..282940
FT                   /gene="aroC"
FT                   /locus_tag="NATL1_03041"
FT   CDS_pept        281855..282940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="NATL1_03041"
FT                   /product="Chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="COG82 Chorismate synthase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74868"
FT                   /db_xref="GOA:A2C058"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C058"
FT                   /protein_id="ABM74868.1"
FT                   /translation="MGSSFGKLFTISTFGESHGGGVGVIIDGCPPRLELDINEIQNDLN
FT                   RRRPGQSKITTPRNESDEVEILSGLLGNKTLGTPIAMVVRNKDHRPKDYSEIKKTFRPS
FT                   HADATYQKKYGIQASSGGGRASARETIGRVAAGSVAKQLLTKFAKTEILAWVKRIHDIE
FT                   AEIHPSEVTFDEIEKNIVRCPNQSAADLMIQRVEAFGKEGDSCGGVIECVVRNPPIGLG
FT                   MPVFDKLEADLAKALMSLPATKGFEVGSGFGGTYLKGSEHNDPFLPSDSNQLKTATNNS
FT                   GGIQGGISNGEDIVLRVGFKPTATIRKSQKTIDEDGNAITLKATGRHDPCVLPRAVPMV
FT                   EAMVALVLADHLLRQRGQCTD"
FT   gene            complement(283012..283647)
FT                   /gene="eda"
FT                   /locus_tag="NATL1_03051"
FT   CDS_pept        complement(283012..283647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="NATL1_03051"
FT                   /product="possible 2-keto-3-deoxy-6-phosphogluconate
FT                   aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="COG800 2-keto-3-deoxy-6-phosphogluconate aldolase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74869"
FT                   /db_xref="GOA:A2C059"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2C059"
FT                   /protein_id="ABM74869.1"
FT                   /translation="MEAKQNNLIKSLRIQPLIVVIRLEHNFFNLSKKKENLLSKIEKLS
FT                   NFGIKNIEIGWDSNPEWVNLILEIKKRFKSINIGVASISSRQSLESILSLDVNYSMSQF
FT                   FNKEIHIQAIEYNQLVIPGISNIENFKEAIDLGYKIVKIFPASKLGINFINELKDFKKK
FT                   DIFFIGAGGIKSKNLKKFLKSGYDALVIGRELRNQTPDKDLEIWLEDY"
FT   gene            complement(283664..285511)
FT                   /locus_tag="NATL1_03061"
FT   CDS_pept        complement(283664..285511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03061"
FT                   /product="cell division protein FtsH2"
FT                   /note="COG465 ATP-dependent Zn proteases [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74870"
FT                   /db_xref="GOA:A2C060"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A2C060"
FT                   /protein_id="ABM74870.1"
FT                   /translation="MNKRWRNIGLYVLIVVVVIFVGSAFFDKPSPTKSSRTLRYSDFIE
FT                   AVQEKQISRVLISPDKGTAQIVESDGNRALVNLAPDQQLLQLLTDNDVDIAVQPTTQAN
FT                   PLQQAATSLIFPILLLGGLFFLFRRAGSGGGGNPAMNFGKSKARLQMEPETKVTFGDVA
FT                   GIEGAKLELTEVVDFLKNPDRFTAVGAKIPKGVLLVGPPGTGKTLLAKAVAGEASVPFF
FT                   SISGSEFVEMFVGVGASRVRDLFEQAKKNAPCIVFIDEIDAVGRQRGAGLGGGNDEREQ
FT                   TLNQLLTEMDGFEGNSGIIIVAATNRPDVLDSALMRPGRFDRQVTVDRPDYSGRLQILH
FT                   VHAKSKTLSKAVDLDQVARRTPGFTGADLANLLNEAAILAARRELTEVSNDEVSDAIER
FT                   IMVGPEKKDSVISEKRKKLVAYHEAGHAVVGAVMPDYDPVQKISIIPRGGAGGLTFFTP
FT                   SEERMESGLYSRSYLQNQMAVALGGRVAEEIIYGEDEVTTGASNDLKQVASVARQMITK
FT                   FGMSDKLGPVALGRSQGGMFLGRDISAERDFSEDTAATIDSEVSVLVEIAYERAKKALN
FT                   DNRQVLEELTAMLMETETVDSLEFQDLLIRHEVKVAEYA"
FT   gene            complement(285555..286772)
FT                   /gene="met3"
FT                   /locus_tag="NATL1_03071"
FT   CDS_pept        complement(285555..286772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="met3"
FT                   /locus_tag="NATL1_03071"
FT                   /product="ATP-sulfurylase"
FT                   /EC_number="2.7.7.4"
FT                   /note="COG2046 ATP sulfurylase (sulfate
FT                   adenylyltransferase) [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74871"
FT                   /db_xref="GOA:A2C061"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:A2C061"
FT                   /protein_id="ABM74871.1"
FT                   /translation="MGPLSGRISRLLKEKMTSKQSSNKNLAGLIKPYGGELINLMASDQ
FT                   EAKELKKNSFKTLNCSDRNACDIELLLIGAFSPLNGFMSEKNYNSVVKQNRLESGLLFG
FT                   LPIVMDTDREDINPGDSVVLNYKDQELAILEIQEKWTPDKVIEAKFCYGTTSLEHPAVR
FT                   MISMERKKYYLGGSIKGLELPKRVFTCQTPAQVRKNLPSGEDVVAFQCRNPIHRAHYEL
FT                   FTRALEANNVSKNGVVLVHPTCGPTQEDDIPGSVRFQTYEKLASEVNNPKIRWSYLPYS
FT                   MHMAGPREALQHMIIRRNYGCTHFIIGRDMAGCKSSLNGEDFYGPYDAQNFANECCQEL
FT                   EMQTVPSLNLVFTEEEGYVTADYAKEKGLHIKKLSGTQFRKMLRSGEEIPEWFAFKSVV
FT                   DVLRAA"
FT   gene            complement(286857..287660)
FT                   /gene="psbO"
FT                   /locus_tag="NATL1_03081"
FT   CDS_pept        complement(286857..287660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbO"
FT                   /locus_tag="NATL1_03081"
FT                   /product="Photosystem II manganese-stabilizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74872"
FT                   /db_xref="GOA:A2C062"
FT                   /db_xref="InterPro:IPR002628"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A2C062"
FT                   /protein_id="ABM74872.1"
FT                   /translation="MRFRPLLALMLAFCLTFTTLPSSASAALKGREQGNARFGNVVNTG
FT                   QADACTVLPAGSSGSINADGQFKSLCLQPTEVSVKLPGNKRNKSDFAIAKIISPRFNTS
FT                   LDEVYGDLSGGKFTEKGGIDFSLITVLAPNGEEFPFAFSVKEMVAESKKGKSIEPGAEF
FT                   SGPTTTPSYRSADFLDPKSRAKSTGVEYAQALIARGGDDEDLARENVKDDLGGKGEITL
FT                   TVDSVDADTNEFGGQFVAIQPSDNDLGSKDPVDIKIKGIFYGRKA"
FT   gene            287778..287897
FT                   /locus_tag="NATL1_03091"
FT   CDS_pept        287778..287897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03091"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74873"
FT                   /db_xref="UniProtKB/TrEMBL:A2C063"
FT                   /protein_id="ABM74873.1"
FT                   /translation="MMDLKHRFHSKPFYSSLFWRLATDFRKKQIRKISINFLF"
FT   gene            complement(287889..289145)
FT                   /gene="dfp"
FT                   /locus_tag="NATL1_03101"
FT   CDS_pept        complement(287889..289145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="NATL1_03101"
FT                   /product="putative p-pantothenate cysteine ligase and
FT                   p-pantothenenoylcysteine decarboxylase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="COG452 Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74874"
FT                   /db_xref="GOA:A2C064"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A2C064"
FT                   /protein_id="ABM74874.1"
FT                   /translation="MINSTALSGKKILVAVTGSIAAVKAPILVSRLIKAGAEVKCVITQ
FT                   SATNLVSPLSLSTLSRNKCYQDKDQWADSQTKPLHIALAEWAELIIVAPLSATSLSKFT
FT                   SGSADGLLASILLASQSQIVMAAAMNTSMWENQSVKKNWNYVKTIDQVITLEPSAGLLA
FT                   CDRVGDGKMVNLDIIEMASESAFIFHAENKFLTKDLKDIRFLISAGPTVEALDAARQLT
FT                   NRSSGKMGVLIAQAAKLRGAEVDLVHGPVSVQQDLLEGLNTYPVRSSNEMGEKIDDLQP
FT                   SAQVIVMAAAVSDFKNNSPSEQKISKEFFLKSIFDDLEMTSDLIKNQTKKKLEHQIFLG
FT                   FAAETGSDNEIIEKGKKKMVSKGCDLLMANPIDRAGQGFDENFNSGFLLGPKNMVKKLS
FT                   FSTKLAISHELLDEIRNLK"
FT   gene            289353..289694
FT                   /locus_tag="NATL1_03111"
FT   CDS_pept        289353..289694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74875"
FT                   /db_xref="GOA:A2C065"
FT                   /db_xref="InterPro:IPR007572"
FT                   /db_xref="UniProtKB/TrEMBL:A2C065"
FT                   /protein_id="ABM74875.1"
FT                   /translation="MALRMQKTFLYKSSTKIVDRLANWAANPWRRYSLLAIIFLIGFLV
FT                   GSSLGMINGVLALMDPVGAFIALIFLELLIQARFVFLKSNKPIILVRVFDMFRIGLAYG
FT                   LFSEGLKLL"
FT   gene            complement(289712..290731)
FT                   /gene="pyrB"
FT                   /locus_tag="NATL1_03121"
FT   CDS_pept        complement(289712..290731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="NATL1_03121"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="COG540 Aspartate carbamoyltransferase, catalytic
FT                   chain [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74876"
FT                   /db_xref="GOA:A2C066"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C066"
FT                   /protein_id="ABM74876.1"
FT                   /translation="MNNWKHNHVLDLSTFSLEDYKTVLELTTRFKDVHKSSSKKLPALH
FT                   GRLIANLFFEPSTRTRTSFELAAKRLSADVQNFSVSSSSLSKGETPLDTILTYISMGAD
FT                   ILVIRHESTNVPAELANYVDINNINTSILNAGDGFHSHPSQGLLDLFTLATFFNPNEPS
FT                   TNSLLNKKITIVGDILHSRVARSNLWALTACGAEVTLCGPPSLLPEEFIDFVQNPRLGQ
FT                   NFDPINKRGSVFIKRSLKDALKNSDAVMTLRLQKERMKQNMLKDLDSYYAQYGITHESL
FT                   KWCEKKVPVLHPGPVNRGVEISNRLVEDNSINLISKQVENGIPTRMALLYLLGLNKKD"
FT   gene            complement(290728..291297)
FT                   /gene="mpg"
FT                   /locus_tag="NATL1_03131"
FT   CDS_pept        complement(290728..291297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpg"
FT                   /locus_tag="NATL1_03131"
FT                   /product="possible Methylpurine-DNA glycosylase (MPG)"
FT                   /note="COG2094 3-methyladenine DNA glycosylase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74877"
FT                   /db_xref="GOA:A2C067"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:A2C067"
FT                   /protein_id="ABM74877.1"
FT                   /translation="MVAPSLIGCFLIKRLSENSYLAGAIVETEAYSQEEASCHGFSGRT
FT                   QRNKTLFGEPGNFYIYLSYGINSCVNIVTGKKNWANGVLLRSIAIKGEHERIASGPGLL
FT                   AKRFGLNKNFDNLHLSPANDFWLSEGEDLTRMGNIVQTTRIGISQAKDIPWRWYLKSSR
FT                   SVSKRVRGDRIPPKNKCWEPSAFEGL"
FT   gene            291553..291840
FT                   /gene="gatC"
FT                   /locus_tag="NATL1_03141"
FT   CDS_pept        291553..291840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="NATL1_03141"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit C"
FT                   /EC_number="6.3.5.7"
FT                   /note="COG721 Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74878"
FT                   /db_xref="GOA:A2C068"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C068"
FT                   /protein_id="ABM74878.1"
FT                   /translation="MTKISSSDVRKVAQLARLELPEDQIETYTEQLEEILSYVDQLQEI
FT                   DTENIPPTTRAVEVVNSMRDDLVEVNCSREDLLNQAPHREGDFFRVPKIL"
FT   gene            complement(291853..292884)
FT                   /gene="crtR"
FT                   /locus_tag="NATL1_03151"
FT   CDS_pept        complement(291853..292884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtR"
FT                   /locus_tag="NATL1_03151"
FT                   /product="beta-carotene hydroxylase"
FT                   /note="COG3239 Fatty acid desaturase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74879"
FT                   /db_xref="GOA:A2C069"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A2C069"
FT                   /protein_id="ABM74879.1"
FT                   /translation="MTQCLSRSDKNKATKKLKSLRDWQNEIQEYLDPPKPLNVTLGLFF
FT                   GGYFLAIVSVWQWYQGNWPLPILVALAFLALHMEGTVIHDACHNAAHPNKWINQFMGHG
FT                   SAILLGFSFPVFTRVHLEHHKYVNDPKNDPDHIVSTFGPIWLIAPRFFYHEYFFFERKL
FT                   WRKFELMQWGIERGIFICIVIAGIKYNFMNVIYNLWFGPALMVGVTLGIFFDYLPHRPF
FT                   QSRNRWKNARVYPSKLMNLLIMGQNYHLVHHLWPSIPWFEYKPAYEATKPLLDQKGSPQ
FT                   RMGIFETKKDSLNFLYDVLLGIRSHKERRSKMRPLARILPKNNWRRKYIKLIHKTRIRT
FT                   ESK"
FT   gene            complement(292934..293016)
FT                   /locus_tag="NATL1_tRNALeuVIMSS1309184"
FT                   /note="tRNA-Leu"
FT   tRNA            complement(292934..293016)
FT                   /locus_tag="NATL1_tRNALeuVIMSS1309184"
FT                   /product="tRNA-Leu"
FT   gene            293220..293738
FT                   /locus_tag="NATL1_03161"
FT   CDS_pept        293220..293738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74880"
FT                   /db_xref="GOA:A2C070"
FT                   /db_xref="UniProtKB/TrEMBL:A2C070"
FT                   /protein_id="ABM74880.1"
FT                   /translation="MVISISGYLFLFVGLLILALPLMLVELSRPRDWLMGGLFLFLGLF
FT                   LLEENDLLRGSINLLVISMAILYGKMILEIIQNRWNQLSSEEKKRVGSFQRWFESFRQL
FT                   GQSFALLGAGFFNFFKGFTNKSEKPLKEKKWVHPELKEEVNKKVVEKAGSTDSNKIGNQ
FT                   EFAENEETS"
FT   gene            293790..296693
FT                   /gene="ileS"
FT                   /locus_tag="NATL1_03171"
FT   CDS_pept        293790..296693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="NATL1_03171"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="COG60 Isoleucyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74881"
FT                   /db_xref="GOA:A2C071"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C071"
FT                   /protein_id="ABM74881.1"
FT                   /translation="MNNINKNSQKDRPTYKDTLNLLQTNFGMRANATLREPELQAFWRE
FT                   KNIDFELGLNNTGETFTLHDGPPYANGTLHMGHALNKVLKDIINKFQTMKGKKVCYVPG
FT                   WDCHGLPIELKVLQAMDKSQRAELTPIKLRKKAAAYAKKQVSQQMDGFKRWGVWGDWDQ
FT                   PYLSLDKKFEASQIKLFGEMVFKGYIYRGLKPVHWSPSSQTALAEAELEYPTGHTSKSI
FT                   YVGFKVNQIPKRLTQEISKQAPDLINSEGKLKEVKLVIWTTTPWTIPANEAISVNQKLE
FT                   YVIAQSSDRSLIIIANDLLDEVSKSVGINYEKRVLIKGSILDGIIYKHPLFDKISPVVL
FT                   GGDYITTESGTGLVHTAPGHGVDDFNTGKKYNLSISCTVDAKGFLTKEAGKYEGLNVLK
FT                   DANSVIISDLINSGSLLKEIPYEHRYPYDWRTKKPTIFRATEQWFASVEGFRDKALSAI
FT                   EDVIWLPESGKNRINSMVRERGDWCISRQRTWGVPIPVFYEKNGQEILLNKETISHIAD
FT                   LFSVHGADIWWEYEVSELLPPSYLNQADRWQKGTDTMDVWFDSGSSWSSVISKKENLNY
FT                   PADLYLEGSDQHRGWFQSSLLTSVAVNEHAPFKKVLTHGFALDENGRKMSKSLGNIIDP
FT                   LVIINGGSNKKLDPAYGADVLRLWVSSVDYSADVPIGSNILKQISDVYRKVRNTSRYLL
FT                   GNLYDFDYKIDSIDIANLPLLDKWMLNRTAEVIDEISDAYNNFEFSKFFQTIQNFCVVD
FT                   LSNFYLDIAKDRLYVSSKSDFRRRSCQTVLSLVIEKISGLIAPVLCHMAEDIWQNIPYD
FT                   LEEASVFQRGWPNVPKSWRNSSFNCHVTELRKLRAVINRMLESCRNNQALGSSLEASVR
FT                   VDISDEKVQAAIEWLAESESNNVDVLRDWFLVSSLQIGGEPWAEVLVSEDNDYASVEIA
FT                   KARGFKCERCWHYEIEMSKNPQHTNICKRCEKVVLAI"
FT   gene            complement(296730..297341)
FT                   /locus_tag="NATL1_03181"
FT   CDS_pept        complement(296730..297341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74882"
FT                   /db_xref="GOA:A2C072"
FT                   /db_xref="InterPro:IPR021515"
FT                   /db_xref="UniProtKB/TrEMBL:A2C072"
FT                   /protein_id="ABM74882.1"
FT                   /translation="MTEPQFQILVWLSYRIAATFAFGLPLFILIWAKRLNASSIDRLLS
FT                   IYWKVSSIYAINLLFLSVESQLGQSISFIAPILMVSSIWFWSDLNEEIDEMPDYKPIAL
FT                   TTRIWRWTLTFWSLLNTGLHIFSWRCLNSINENYCDNWREIPFNSFMTTKTLIKFILGG
FT                   NWSTGFATFFAYLSLILYLIGLLQWLIIQLPKNGRFAGKF"
FT   gene            297616..298260
FT                   /locus_tag="NATL1_03191"
FT   CDS_pept        297616..298260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03191"
FT                   /product="Predicted SAM-dependent methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="COG220 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74883"
FT                   /db_xref="GOA:A2C073"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C073"
FT                   /protein_id="ABM74883.1"
FT                   /translation="MRQHVNPLSQFFQLPLSLPSKNILFEKSHYPIHLDIGSAKGEFLI
FT                   ELATKYPDWNFVGLEIREPLVSLCEKKRRKLELTNLKFLFCNVNVSLDEWLSDLDFGQL
FT                   KRVSIQFPDPWFKRKHFKRRVLNTNILNSIAKSMSKDGEIFIQSDILKLIEYMTNTIDE
FT                   NRYFTRKNVGDLRSIDKNPYDVMTDREIFSLKKNLLIYRVMYIRNSLLFTN"
FT   gene            298341..298910
FT                   /locus_tag="NATL1_03201"
FT   CDS_pept        298341..298910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03201"
FT                   /product="thioredoxin-like protein TxlA"
FT                   /note="COG526 Thiol-disulfide isomerase and thioredoxins
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones / Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74884"
FT                   /db_xref="GOA:A2C074"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2C074"
FT                   /protein_id="ABM74884.1"
FT                   /translation="MIDNSNSDTALGPRQKIFLVILSFFLVVSLFFFRTGFKANEMLDQ
FT                   LAKNSLEPEIALSNGKPTVFEFYADWCEACKEMAPEMVNAEKLNSNKIDIVLLNVDNSR
FT                   WFDLIDKYDVNGIPQLTFFDDQGDFKGFSLGVRKYSELNQIFLALINNSELPAFTKLSN
FT                   SSNLISKNNLKVLDNNIRSEGPRDHS"
FT   gene            complement(298907..299545)
FT                   /gene="thy1"
FT                   /locus_tag="NATL1_03211"
FT   CDS_pept        complement(298907..299545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thy1"
FT                   /locus_tag="NATL1_03211"
FT                   /product="possible Thy1"
FT                   /EC_number="2.1.1.148"
FT                   /note="COG1351 Predicted alternative thymidylate synthase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74885"
FT                   /db_xref="GOA:A2C075"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A2C075"
FT                   /protein_id="ABM74885.1"
FT                   /translation="MSRVQLITSTPNAEKSMAYIARVSNPKNQDNDDFTKLIGYCIKNE
FT                   HWSVFEQAYMTLQIETTRGIAAQILRHRSFTFQEFSQRYADSMQLGEIPIPELRRQDNK
FT                   NRQNSISDLPKEIINTFNKKIKHQFVQNKELYEEMLEAGIAKECARFVLPLATPTRIYM
FT                   TGSCRSWIHYINLRTGHGTQKEHMEIAQECKNIFSKEYPVVSSALNWLF"
FT   gene            complement(299548..300141)
FT                   /gene="dcd"
FT                   /locus_tag="NATL1_03221"
FT   CDS_pept        complement(299548..300141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="NATL1_03221"
FT                   /product="dCTP Deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="COG717 Deoxycytidine deaminase [Nucleotide transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74886"
FT                   /db_xref="GOA:A2C076"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A2C076"
FT                   /protein_id="ABM74886.1"
FT                   /translation="MLKNDLWIAEQASLGMLEPFQEKLIRHLEPESEKSPVLSFGCSSY
FT                   GYDLRLSSKEFLIFRHVPGTVMNPKKFNPANLEPTDLKEDEDGKYFILPAHSYGLGVAL
FT                   EKMKVPPNITVICLGKSTYARLGIIVNTTPAEASWEGHLTLEFSNSSGADCRIYADEGI
FT                   CQLLFFEGDPCETTYSDRKGKYQYQQEKVTLAKV"
FT   gene            complement(300142..300738)
FT                   /locus_tag="NATL1_03231"
FT   CDS_pept        complement(300142..300738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03231"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="COG2109 ATP:corrinoid adenosyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74887"
FT                   /db_xref="GOA:A2C077"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C077"
FT                   /protein_id="ABM74887.1"
FT                   /translation="MNARVSINAQQRGSSPSKETSLRPTPIRKPLQLVATQGQVQIHTS
FT                   TFRGSFSVVLSEAIRSAGLGSQVLIAQFLRGGVNQGPNGAINLCGRLEWLRPAIETCLQ
FT                   EKILEEHLSLKRKYYEKAIKELWEFCKSRLIEKKIDKIVLDEIGIAISLGFIEENDLIF
FT                   MINNRPSSTDIILTGPSIPPKVIEMADQITELRCN"
FT   gene            301052..301783
FT                   /gene="ntcA"
FT                   /locus_tag="NATL1_03241"
FT   CDS_pept        301052..301783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntcA"
FT                   /locus_tag="NATL1_03241"
FT                   /product="Global nitrogen regulatory protein, CRP family of
FT                   transcriptional regulators"
FT                   /note="COG664 cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases [Signal transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74888"
FT                   /db_xref="GOA:A2C078"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR022299"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2C078"
FT                   /protein_id="ABM74888.1"
FT                   /translation="MVTSYRGFTRFNQPKNSQMVGNSSTPLPPNKTLLDVIKSLEGVST
FT                   ETVDRSKTIFFPGDPAERVYLIRRGAVRLSRVYETGEEITVALLRENSLFGVLSLLTGH
FT                   RSDRFYHAVAFTRVELVSAPATSLRNAIEQDASVGLLLLQGLSSRVLQTETMIETLTHR
FT                   DMSSRLASFLLVLCRDFGVPGEKGVTIDLRLSHQAIAEAIGSTRVTITRLLGELKSSSL
FT                   LAIDRKKITIFDPIALAKRFN"
FT   gene            301839..302765
FT                   /locus_tag="NATL1_03251"
FT   CDS_pept        301839..302765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74889"
FT                   /db_xref="GOA:A2C079"
FT                   /db_xref="InterPro:IPR021435"
FT                   /db_xref="UniProtKB/TrEMBL:A2C079"
FT                   /protein_id="ABM74889.1"
FT                   /translation="MTAWLKILLVLILGGILSTLGDRLGTRVGKARLSIFKLRPKSTAV
FT                   LITVFTGSIISAISFATMVVFDRDLRVGLFQLEDIREKIIESEKELKKLEKNLYAFRSG
FT                   NVVISSGQTLVTKTIKLNKTNDIKKIIESILQQANFYAFNLVKTNQSEYRRILLVRKDD
FT                   IEKLENKIADNRSWVVRIKSAGNILRGENYVYAFPEVTLNKMITKKGEVIAIENVSLLK
FT                   SDSESISKKINLLMASTLAEVRRRGSLSSELKINANQINNLGKYLVSIKKGEFQIIARA
FT                   LEDSQSAEKVSVSLELKSLEKSISNKS"
FT   gene            302766..303203
FT                   /locus_tag="NATL1_03261"
FT   CDS_pept        302766..303203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74890"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A2C080"
FT                   /protein_id="ABM74890.1"
FT                   /translation="MSLYISIDPGMKKCGLLLADMQSGEVIEACVASLNKFSDLVSQWN
FT                   EDHEIIKIIIGNGTNCKYIENKLKRNNSFNINYVNERGSTLRARFRYWEIWPPNYFIRW
FT                   LPKEILFPPANLDAIVALILLEDFLKYRLIWPSKVNIKTWP"
FT   gene            complement(303187..303444)
FT                   /locus_tag="NATL1_03271"
FT   CDS_pept        complement(303187..303444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74891"
FT                   /db_xref="InterPro:IPR021492"
FT                   /db_xref="UniProtKB/TrEMBL:A2C081"
FT                   /protein_id="ABM74891.1"
FT                   /translation="MYNKPSTTAYLQIHKQCFNQKKVEGIVRAGNFEWSFTWAFNQGQL
FT                   LIEPPLGRALIKDALERYLVKADYKLESGGDYIFTVRAKF"
FT   gene            complement(303458..304066)
FT                   /gene="pth"
FT                   /locus_tag="NATL1_03281"
FT   CDS_pept        complement(303458..304066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="NATL1_03281"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="COG193 Peptidyl-tRNA hydrolase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74892"
FT                   /db_xref="GOA:A2C082"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C082"
FT                   /protein_id="ABM74892.1"
FT                   /translation="MLSDELKLLVGLGNPGTEYEKTRHNVGFMVLEEIARKNNCSFRES
FT                   KKIFGRTCEYGSGIEKTRLLMPNTYMNESGKSVRLAKDWFNFQNNQLIVLVDDMDLPLG
FT                   KIRVRSKGSSGGHNGLKSIINHLGTAEFKRLKIGIGAPSNDQQERKSKTVSHVLGRFSK
FT                   EEFIILNFIIQEIISCIESITSNNWEKISTRLNSYKPDN"
FT   gene            complement(304128..304343)
FT                   /locus_tag="NATL1_03291"
FT   CDS_pept        complement(304128..304343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03291"
FT                   /product="Hypothetical protein"
FT                   /note="COG1826 Sec-independent protein secretion pathway
FT                   components [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74893"
FT                   /db_xref="GOA:A2C083"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A2C083"
FT                   /protein_id="ABM74893.1"
FT                   /translation="MNIFGVGLPEIAVIAGLALVIFGPKRLPELGRTIGKTLKGLQSAS
FT                   TEFEREIKNAMTEEESANENIVDKEN"
FT   gene            complement(304381..304578)
FT                   /gene="psbH"
FT                   /locus_tag="NATL1_03301"
FT   CDS_pept        complement(304381..304578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbH"
FT                   /locus_tag="NATL1_03301"
FT                   /product="Photosystem II PsbH protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74894"
FT                   /db_xref="GOA:A2C084"
FT                   /db_xref="InterPro:IPR001056"
FT                   /db_xref="InterPro:IPR036863"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C084"
FT                   /protein_id="ABM74894.1"
FT                   /translation="MGQKTALGSLLKSIGNSGQGKVVPGWGAVPVMAFIGVLLLVFLVI
FT                   MLQIYNQSLLLQGFSVDWNG"
FT   gene            304935..305063
FT                   /gene="psbI"
FT                   /locus_tag="NATL1_03311"
FT   CDS_pept        304935..305063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbI"
FT                   /locus_tag="NATL1_03311"
FT                   /product="photosystem II reaction center PsbI protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74895"
FT                   /db_xref="GOA:A2C085"
FT                   /db_xref="InterPro:IPR003686"
FT                   /db_xref="InterPro:IPR037271"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C085"
FT                   /protein_id="ABM74895.1"
FT                   /translation="MLALKISVYTVVFFFVGIFLFGFLASDPTRTPNRKDLESPQD"
FT   gene            305207..307141
FT                   /locus_tag="NATL1_03321"
FT   CDS_pept        305207..307141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74896"
FT                   /db_xref="InterPro:IPR022244"
FT                   /db_xref="UniProtKB/TrEMBL:A2C086"
FT                   /protein_id="ABM74896.1"
FT                   /translation="MSLFETSIGKEHFLGKSVIDKHYNFSVGNLEENDKILSSRKLQQN
FT                   EVTSLTLKIFADKQYDYDQNIYLAEGNVKALINGGILRSDLLSYDKSTGILIAEGNIRF
FT                   RKGGQYFRAKEFKFDLLKKEGSIKDAYGILDLKNVLNDLKIDAISNQAKALHSTNDKEI
FT                   NTYDDGIEFSFGNIKLPDNKITRSNKSIGLINNWRFKSNSISIEEHGWKSNRIVFTNDP
FT                   LDPNQISFEGIDVIAEEEEDGRLLITSSKTNLILENRSKIFIGKRIFGQKKKKRSKFQL
FT                   ILDGKDRDGLVLVRRSNSTNIADNIKLELQPQFLISRAILGKTNSYKNNKDKNINFSDL
FT                   FGLNINLNASNPNWSFDSLNDLSTLNTSRLFNGLRHSSSFSIPILEESTFNIFTAYRSR
FT                   AWNGTIGETEIKSAFGGFIEKSQHFTTGSLKNNLNIRIGTGRYETEKFENSEMISHWRS
FT                   SIFSSLDSEYQIWKSNKKNLYQNHLTPLSPVLLNSELVLRTNIDSAYFNYLNDSDQGFL
FT                   KLSIGPEIRLGNLERDYFDYTKLSVMPGVKLKFGNSPFKFDKAIDLKTINISLIQQIYG
FT                   PLMFDVISNLNIDTTSKNYGEYYDTKLGILWHKRAYECGIYYHPNNDAGGLYFRINGFK
FT                   FGNSTKAVF"
FT   gene            complement(307138..307758)
FT                   /gene="leuD"
FT                   /locus_tag="NATL1_03331"
FT   CDS_pept        complement(307138..307758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="NATL1_03331"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="COG66 3-isopropylmalate dehydratase small subunit
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74897"
FT                   /db_xref="GOA:A2C087"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:A2C087"
FT                   /protein_id="ABM74897.1"
FT                   /translation="MNQKFPKGEIKSIQGRSFTMKGDDIDTDRIIPARFLKCVSFSALG
FT                   EQVFADDRKELKGNHPFDLDQNKGANILVVNDNFGCGSSREHAPQALMRWGIRLIIGES
FT                   FAEIFFGNCLALGIPCLTAAKEEIVNLQNLVEKNNNQIWDFNLKNLSISNQKETVKLFL
FT                   DEGPYNMLFSGKWDATSQLLDEEEKINKTFNNLPYLNNFKQKI"
FT   gene            complement(307783..309192)
FT                   /gene="leuC"
FT                   /locus_tag="NATL1_03341"
FT   CDS_pept        complement(307783..309192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="NATL1_03341"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="COG65 3-isopropylmalate dehydratase large subunit
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74898"
FT                   /db_xref="GOA:A2C088"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C088"
FT                   /protein_id="ABM74898.1"
FT                   /translation="MSSRTLYDKVWNFHQVKELPGGSTQLFIGLHLIHEVTSPQAFSAL
FT                   NEKKLGVKFPNLTVATVDHIVPTSNQQRPFSDPLAEEMLSTLEKNCKTHGIKFHGIGSN
FT                   SQGVVHVMAPELGLTQPGMTVACGDSHTSTHGAFGAIAFGIGTSQVRDVLASQSLAMNK
FT                   LKVRRIWVEGELQKGVYAKDLILHIIRHLGVKGGVGFAYEFAGPAIEKLSMEGRMTICN
FT                   MAIEGGARCGYINPDETTFKYLKGKEHAPKGQEWDKAISWWKSLASDSKATFDDEIQLD
FT                   GSSIEPTVTWGITPGQGISIKETIPNPEFLPKNEQQIAKDACKYMNLKPDEPIEGQSID
FT                   VCFIGSCTNGRLSDLQEASKIVKGNTVADGIRAFVVPGSQKVAKEAKEKGLDKIFLKAG
FT                   FEWREPGCSMCLAMNPDKLEGRQISASSSNRNFKGRQGSAKGRTLLMSPAMVAAAAING
FT                   RVTDVRKFLQE"
FT   gene            complement(309216..310508)
FT                   /gene="cinA"
FT                   /locus_tag="NATL1_03351"
FT   CDS_pept        complement(309216..310508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="NATL1_03351"
FT                   /product="Molybdenum cofactor biosynthesis protein"
FT                   /note="COG1058 Predicted nucleotide-utilizing enzyme
FT                   related to molybdopterin-biosynthesis enzyme MoeA [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74899"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C089"
FT                   /protein_id="ABM74899.1"
FT                   /translation="MKTSKEITINKKNKFGAEILCIGSEILLGNIVNTNSQWIAEQLAI
FT                   LGIPHFRQTVIGDNPARLEEAILEASNRSEILITTGGLGPTPDDITTKVIADTFKTPLE
FT                   QRNDILIDLRNKSKDKDSKLSDSQKKQSLVPKGAKIINNYSGTAPGIYWSPKENFTILT
FT                   FPGVPSELKEMWAKEASKLLISNNLSKEVISSKVLHFAGISESLLADKIPHLLISKNPT
FT                   VATYARTGEVKVRITAKGENSEETNRLIEPIKKELTQITGLKCFGIDNETLEEIVFKLL
FT                   LKRKETIAVAESCTGGGIGSKLTKIPGSSKIFHGGVIAYNNSIKQRLLGVPEEIINTHG
FT                   AVSKPVVESMARGVQIKFKVNWAISVSGIAGPTGGSKSKPVGLVNFCIKGPKTLITWEE
FT                   NFGSNKTREDIQKLSVLNALDRLRLSIIMAN"
FT   gene            complement(310495..311730)
FT                   /gene="glyA"
FT                   /locus_tag="NATL1_03361"
FT   CDS_pept        complement(310495..311730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="NATL1_03361"
FT                   /product="Serine hydroxymethyltransferase (SHMT)"
FT                   /EC_number="2.1.2.1"
FT                   /note="COG112 Glycine/serine hydroxymethyltransferase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74900"
FT                   /db_xref="GOA:A2C090"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C090"
FT                   /protein_id="ABM74900.1"
FT                   /translation="MKCDPSIAKLINNELSRQETHLELIASENFASKAVMEAQGSVLTN
FT                   KYAEGLPNKRYYGGCEYIDGIEQLAIDRAKNLFGANWANVQPHSGAQANFAVFLSLLKP
FT                   GDTIMGMDLSHGGHLTHGSPVNVSGKWFKTCHYEVDKKTEMLDMDAIRKKAIENQPKLI
FT                   ICGFSAYPRKIDFKAFRSIADEVNAYLLADIAHIAGLVASGLHPSPIPYCDVVTTTTHK
FT                   TLRGPRGGLILSKDEEIGKKLDKAVFPGTQGGPLEHVIAAKAVAFQEASAPEFKIYSQK
FT                   VISNAQVLSNQLQKRGISIVSKGTDNHIVLLDLRSIGMTGKVADQLVSDIKITANKNTV
FT                   PFDPESPFVTSGLRLGSAALTTRGFNEQAFEDVGNIIADRLLNPNDEDIKENSINKVSE
FT                   LCNKFPLYSENI"
FT   gene            complement(311855..311928)
FT                   /locus_tag="NATL1_tRNAArgVIMSS1309183"
FT                   /note="tRNA-Arg"
FT   tRNA            complement(311855..311928)
FT                   /locus_tag="NATL1_tRNAArgVIMSS1309183"
FT                   /product="tRNA-Arg"
FT   gene            311929..312408
FT                   /locus_tag="NATL1_03371"
FT   CDS_pept        311929..312408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03371"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74901"
FT                   /db_xref="InterPro:IPR021518"
FT                   /db_xref="UniProtKB/TrEMBL:A2C091"
FT                   /protein_id="ABM74901.1"
FT                   /translation="MKKQYQIVSQRIEKYVCIYALKIHCNNIENLKSCYSINFFNFDKS
FT                   NESLPKVINNRKTKGFMSTSIDSSQINELAMSIADRLFIQVGNWNLYLGDAGLAKDLAI
FT                   ECQANFDQGANVAARKGLEGIQVKLGGGITRLPLSKLIPPNQFFDLEEILEPYCR"
FT   gene            312449..312697
FT                   /locus_tag="NATL1_03381"
FT   CDS_pept        312449..312697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03381"
FT                   /product="possible Cytochrome c oxidase subunit Va"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74902"
FT                   /db_xref="UniProtKB/TrEMBL:A2C092"
FT                   /protein_id="ABM74902.1"
FT                   /translation="MTNAREVVRQRIGRLGERLIGKVADADAQVEKELMKEMEIAFQEF
FT                   GIEARILSVSGVKTDEMNCLEIPLKVRSEKDVFLKDE"
FT   gene            complement(312684..314291)
FT                   /gene="mviN"
FT                   /locus_tag="NATL1_03391"
FT   CDS_pept        complement(312684..314291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="NATL1_03391"
FT                   /product="Uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /note="COG728 Uncharacterized membrane protein, putative
FT                   virulence factor [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74903"
FT                   /db_xref="GOA:A2C093"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A2C093"
FT                   /protein_id="ABM74903.1"
FT                   /translation="MSKSIKEIAFVVSLGTLLSKFGGMARQLVIAGAFGISAAYDAYNY
FT                   AYIIPGFFLVLLGGINGPLHNSMVTLLADKNKVDSRLFISSINNILSIILLIISLFIFF
FT                   SSDFLINLVGPSLIPEIKEIASYQLKIMSPIIFLSGLIGLGFGSLNTKKEFFIPSISPL
FT                   ISSLIIIISISNFWINKGNTTDLDALNIRGGIILAKATFIGALSQYLIQIPFLIRKGIF
FT                   AISFSIQTKYSEIKRALQMIAPASLSSGMIQINVFTDLFFASKIVGAAAALSYANFLVQ
FT                   APLGIVSNSILIPLLPVFVSLRARENHLKLIKKIHQGLILSSTSMVFLGSLFISLSTPI
FT                   VVLIYGRGSFNENAIDVVSQLLIAYGIGMPFYLCRDLLVRVFYGIEDARTPFRISIIAI
FT                   LLNLFFDWFFIGGSSPWGELSPLNLGVNGLVFSTTFVNFFACTLLLFKLNNRLDNLNLS
FT                   NLLSQNLRIILIGLISGICSFFIFKIIFLPYSFINLLLKLIISSGISLIIFYCLAIILK
FT                   IDHINNLNKFLKEKFIRL"
FT   gene            314366..315127
FT                   /gene="sfsA"
FT                   /locus_tag="NATL1_03401"
FT   CDS_pept        314366..315127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="NATL1_03401"
FT                   /product="putative sugar fermentation stimulation protein"
FT                   /note="COG1489 DNA-binding protein, stimulates sugar
FT                   fermentation [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74904"
FT                   /db_xref="GOA:A2C094"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C094"
FT                   /protein_id="ABM74904.1"
FT                   /translation="MIEIGKTIIKFPPLIEGILIKRYKRFLADIELDDGEVVTAHCANT
FT                   GPMKGVLWPGGRVRLKYSPSPKRKLDWSWEQAEVPSHNEKKKCWVGINTSLPNKLIKHL
FT                   IEANCLERQFGQISSIKPEVVYGLERKSRIDLLLYPSIQNEDSRKIFVEVKNTTWCDDS
FT                   LALFPDTVTTRGQKHLKELMSVYPDSRAVLIPCISRSDMELFSPGEIADPEYGRLFREA
FT                   LTKGVEVIPCAFGFFIDHITWEGTRPLKSSR"
FT   gene            315399..316889
FT                   /gene="amtB"
FT                   /locus_tag="NATL1_03411"
FT   CDS_pept        315399..316889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="NATL1_03411"
FT                   /product="Ammonium transporter family"
FT                   /note="COG4 Ammonia permease [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74905"
FT                   /db_xref="GOA:A2C095"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A2C095"
FT                   /protein_id="ABM74905.1"
FT                   /translation="MTTALQSPPRRTTSRLQDASLLNGPMLLLRSIKGFRRSQSWAWLA
FT                   SIPLALLGLGVFTFSARAEVALSDLTGPQAASFLADNLWLFIATILVIFMNAGFAMVEA
FT                   GMCRQKNAVNILAKNLFVFALAVTAYWVIGYSLMYGGSVIDGWLYFQGLFVDPDPSGAL
FT                   ECAAAGDTGCLVPAVDFLFQSAFAGTAATIVSGLVAERVKFGEFVVFSIVLTAFIYPIA
FT                   GSWQWNGGWLAELGFIDFAGSSIVHSVGGWAGLVGAMLLGPRIGKFVDGKAQAMPGHNM
FT                   AIATLGALILWIGWYGFNPGSELAMDQYVAYVAVTTTLAAAGGAIAATVLSTITSGKPD
FT                   LTMIINGILAGLVSITAGCGNMTFAGSWLAGAVGGLIVVVAVAALDSAGIDDPVGAFSV
FT                   HGVCGVWGTVVIGLWGVDGMDPGAAGIGLLNGGGINQFFIQALGAAAYGIWTVVTCWIA
FT                   WQIIGGFFGGIRVSEAEETQGLDIGEHGMEAYPDFASS"
FT   gene            317009..318214
FT                   /gene="lytB"
FT                   /locus_tag="NATL1_03421"
FT   CDS_pept        317009..318214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="NATL1_03421"
FT                   /product="LytB"
FT                   /EC_number="1.17.1.2"
FT                   /note="COG761 Penicillin tolerance protein [Lipid
FT                   metabolism / Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74906"
FT                   /db_xref="GOA:A2C096"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C096"
FT                   /protein_id="ABM74906.1"
FT                   /translation="MDTQAFKQTLHKSDRYNRRGFGSANKRAQALAEAYQSGLIGSIRE
FT                   NGNLLEHGRLKVKLAEAFGFCWGVERSVAMAYETRKHYPNERIWITNEIIHNPSVNDHL
FT                   RKMNVLFISEEKGVKDFSVVKDGDVVILPAFGATVQDMKLLHDRGCHIIDTTCPWVSKV
FT                   WHTVEKHKKHTFTSIIHGKYKHEETLATSSFAGTYLVLFDLEEANYVSDYILGKGNRED
FT                   FLKRFSKASSAGFDPDKDLQKVGVANQTTMLKSETEEIGRLFEKTMLQRFGPAQLNEHF
FT                   LAINTICDATEERQGAMFSLVDEPLDLMVVIGGFNSSNTTHLQEIAISRGIRSFHIDTP
FT                   ERIGEETNTITHMPLEGGELLTEENFLQNGNISVGITSGASTPDRVVEDVIHKLMKIGE
FT                   NF"
FT   gene            318277..318810
FT                   /locus_tag="NATL1_03431"
FT   CDS_pept        318277..318810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03431"
FT                   /product="Predicted membrane protein"
FT                   /note="COG2259 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74907"
FT                   /db_xref="GOA:A2C097"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A2C097"
FT                   /protein_id="ABM74907.1"
FT                   /translation="MTQTNKSSLKDPDSQKVEVVVQSPEGEVNIFGELSIFVLRVSFSL
FT                   FMVHHGLEKLSDPGGFAEFVVGKYFSFLPGDPVIWTYLAAVTQIVCPIGLATGVLARLS
FT                   SLGLLSTMVFALYFHFIDTGLEGFPFAVVENHNYIFELSAIYAAISFYFLCAGPGRLSL
FT                   FRKSNKITYYPKGS"
FT   gene            complement(318872..320428)
FT                   /gene="purH"
FT                   /locus_tag="NATL1_03441"
FT   CDS_pept        complement(318872..320428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="NATL1_03441"
FT                   /product="AICARFT/IMPCHase bienzyme:Methylglyoxal
FT                   synthase-like domain"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="COG138 AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful) [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74908"
FT                   /db_xref="GOA:A2C098"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C098"
FT                   /protein_id="ABM74908.1"
FT                   /translation="MSPIALLSVSDKTGLIPLAKALVNELGFKIISSGGTAKLIESENL
FT                   PVTRVADYTGFPEILGGRVKTLNPKIHGGILARRDKQSHLDDLDKQNINPIDLVVVNLY
FT                   PFVKTISKENVSWEEAIENIDIGGPTMIRAAAKNHQDVLVVTDPSQYSNLIDAYKSKKI
FT                   TPELRKKYSQQAFEHTATYDLTISNWIANQSSSKKVSWLQSLPLKQELRYGENPHQKAS
FT                   WYGEPEKGWSGANQLQGKELSTNNLLDLEAALSTLREFGYKNTISNPSYQKAAVVIKHT
FT                   NPCGVAIGDSPSSALKRALDGDRVSAFGGIIAINCPVDEAAAKEIENIFIECVVAPYFD
FT                   ETAKEILSKKKNLRLLELKAESVQKADKNHIRSILGGLLIQDLDEPSIDQKKWKSVTEL
FT                   IPTDEEMNDLSFAWKIVKHIRSNAIAVASNQQSLGIGAGQMNRVGSAKLALEAAGTKSK
FT                   GAVLASDGFFPFDDTVKMASDYGISSIIQPGGSIRDEDSIKACNELGIKMILTGKRHFL
FT                   H"
FT   gene            320493..321098
FT                   /locus_tag="NATL1_03451"
FT   CDS_pept        320493..321098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03451"
FT                   /product="probable esterase"
FT                   /note="COG400 Predicted esterase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74909"
FT                   /db_xref="GOA:A2C099"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2C099"
FT                   /protein_id="ABM74909.1"
FT                   /translation="MTELISLNSDSATNRLILLHGWGADAHDLMPIGKLLTDGLKDPFE
FT                   IISVSAPQPHPSGSGRQWYPLYPHEWEQVPKAVLDLEKRLNNLCTKQIPLDKTLLLGFS
FT                   QGGAIALDISTRIKFQGVFALSSYPHPDWEPTKNMPPIFLCHGEMDEVVPKAASKKSFD
FT                   ILLKNGVKSELYFFDGGHEINNDLIGYCRGKIEQQFLS"
FT   gene            complement(321095..321463)
FT                   /locus_tag="NATL1_03461"
FT   CDS_pept        complement(321095..321463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74910"
FT                   /db_xref="InterPro:IPR021498"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0A0"
FT                   /protein_id="ABM74910.1"
FT                   /translation="MSKKRKRISRRRLAGQRVMSHVPIFHLGTGQHKPVTAARRFIAEE
FT                   GLYAPAILNVRRNEHTTDRFFWGEKGLFSAQYAEENHFLFPSLRVIVEFLGEDKIFAGL
FT                   ELTADDWEEIEEYEYAFV"
FT   gene            complement(321662..321787)
FT                   /locus_tag="NATL1_03471"
FT   CDS_pept        complement(321662..321787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03471"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74911"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0A1"
FT                   /protein_id="ABM74911.1"
FT                   /translation="MKSLCNFRQGKRNIQKLEKIEKSIKMLIKNLDCLTRRLSQI"
FT   gene            321778..322899
FT                   /locus_tag="NATL1_03481"
FT   CDS_pept        321778..322899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03481"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="COG642 Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74912"
FT                   /db_xref="GOA:A2C0A2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0A2"
FT                   /protein_id="ABM74912.1"
FT                   /translation="MTSTQYSERFLNFVQQQLMSFQADQELEHVVVYVARSGESGSPTL
FT                   EVVGQWPKSEKFLQPVETDTALRTPSSNRRWYPLQEGSILLGVIRAERFATEEEWRESL
FT                   DQRLQSMSILMANSLASELDRKRLLDQLDDQKEQISLMVHQLRNPLAALGTYAKLLLRK
FT                   IGPESENENLVKGLMNEQAQVNKYLSALDQLSQVKLPQADDGSNRLLLPPLLPSETCIS
FT                   VKSLIEPLIERAKARAILQGRKWYGPSKWPLWMEAKSISEGVIAEIVANLLENAFRYSP
FT                   PKASIGIEVIVEGICVWDEGTPIKEEEREKIFQKGFRGESGSKMSGSGIGLALARDLAR
FT                   QLGGDLQLLVDPSQFKNSLPESGNAFVFNLESK"
FT   gene            complement(322880..323461)
FT                   /gene="cobS"
FT                   /locus_tag="NATL1_03491"
FT   CDS_pept        complement(322880..323461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="NATL1_03491"
FT                   /product="Cobalamin-5-phosphate synthase CobS"
FT                   /EC_number="2.7.8.26"
FT                   /note="COG368 Cobalamin-5-phosphate synthase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74913"
FT                   /db_xref="GOA:A2C0A3"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0A3"
FT                   /protein_id="ABM74913.1"
FT                   /translation="MISIAISICITGGLHIDGLMDTADGIGAGPSKRIEAMKDSRVGAI
FT                   GVQSLVIILVLQIAAIIKLGFYAPFAFPIAAFWGRFSQIVAIENYEYILNKEFGSIHQK
FT                   YWRGISQEIRPSLIIICIGIILFLSTTNLNLSNTLLLIYCISSGLTTSILIPHFINKFL
FT                   GGHNGDSYGAGLVITETTNLLLLSIILIPN"
FT   gene            323737..324867
FT                   /gene="tgt"
FT                   /locus_tag="NATL1_03501"
FT   CDS_pept        323737..324867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="NATL1_03501"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /note="COG343 Queuine/archaeosine tRNA-ribosyltransferase
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74914"
FT                   /db_xref="GOA:A2C0A4"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0A4"
FT                   /protein_id="ABM74914.1"
FT                   /translation="MKKPLFDFQIKSRCKTTLARVCSFKTPNGIVNTPKFMPVGTLGTV
FT                   KGVTSQQLEKTGAEMILANTFHLHLQPGEKIVQDAGGLHKFMSWNKPILTDSGGFQVFS
FT                   LAKLNKIDDQGVSFQSPRDGKHIYLTPEKAIEIQMALGSDVAMAFDQCPPYPASESDVE
FT                   EACKRTHHWLERCLNAHKKNDQAVFGIVQGGCFPHLRELSAKIVSGFGLPGIAIGGVSV
FT                   GEPINQMHKIVRETCPLLPQDRPRYLMGIGTLKEMAIAVANGVDMFDCVIPTRLGRHGS
FT                   ALVNGETWNLRNSRFKDDYSPLDSTCTCEACTGYSRAYIHHLIRNKELLGLTLLSMHNL
FT                   THLIRFTGAMRQAITEGCFSEDFAPWQSDSKARHTW"
FT   gene            324902..325045
FT                   /gene="psbK"
FT                   /locus_tag="NATL1_03511"
FT   CDS_pept        324902..325045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbK"
FT                   /locus_tag="NATL1_03511"
FT                   /product="Photosystem II protein PsbK"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74915"
FT                   /db_xref="GOA:A2C0A5"
FT                   /db_xref="InterPro:IPR003687"
FT                   /db_xref="InterPro:IPR037270"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0A5"
FT                   /protein_id="ABM74915.1"
FT                   /translation="MALINFDLLAELPVAYQAFAPTVDVLPLIPLFFFLLVFVWQAAVG
FT                   FR"
FT   gene            complement(324912..325106)
FT                   /locus_tag="NATL1_03521"
FT   CDS_pept        complement(324912..325106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03521"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74916"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0A6"
FT                   /protein_id="ABM74916.1"
FT                   /translation="MLRISNRLVNFLKIQQKNFAFNESQLPLAKQKQAEKRKEVLAEVH
FT                   PLLVQKLGMQLEVQQASRN"
FT   gene            complement(325178..326200)
FT                   /locus_tag="NATL1_03531"
FT   CDS_pept        complement(325178..326200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03531"
FT                   /product="probable oxidoreductase"
FT                   /note="COG673 Predicted dehydrogenases and related proteins
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74917"
FT                   /db_xref="GOA:A2C0A7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0A7"
FT                   /protein_id="ABM74917.1"
FT                   /translation="MKKISKINENIIPVKVGVIGIGNMGWHHARVLSLLKDAELIGVAD
FT                   LDEERGKLAMEQFNCNWYGNYKDLLHQVEAVCIAVPTLFHHEVGLECLKSGKHVLIEKP
FT                   IAANKEEASSLINASNNAKKLLQVGHIERFNPAFRELTKVVANEEVVVLEARRHSPHPE
FT                   RANDVSVVLDLMIHDIDLVIELANSKVIRLAAVGGCSGDGPMDYVNATLGFQNGVVASL
FT                   TASKMSHKKIRSLSAHCKESLIETDFLNHNIHIHRKAHEWYSADHGELLYRNDGFIEEV
FT                   STTSIEPLYAELEHFLQCVRGKEKPAVDGLQASRALHLADLIEKAVSIPSEDILLSKGI
FT                   "
FT   gene            complement(326238..327506)
FT                   /locus_tag="NATL1_03541"
FT   CDS_pept        complement(326238..327506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03541"
FT                   /product="Hemolysins and related proteins containing CBS
FT                   domains"
FT                   /note="COG1253 Hemolysins and related proteins containing
FT                   CBS domains [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74918"
FT                   /db_xref="GOA:A2C0A8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0A8"
FT                   /protein_id="ABM74918.1"
FT                   /translation="MSLLLLCILLVIPAFFNAGQFAILRLRSTKVQRLVEDGLPGSNSI
FT                   IRLQKRLRRTLLIAELGITISLISIGWICKNFASQWWGNNASINYLLDLGLFITVVLLA
FT                   TLISGLLPKALVLNQPETSALKLSPLIEAAIKWMSPFLSLLEGLALLILRLVGLNTQSE
FT                   SLTTAAFSAGELEKLIETGGVTGLKPDERNILEGVFALRDTQVREVMVPRSGMVTLPRE
FT                   VSFTQMMEEVHKTRHARYLVIDDSLDNVLGVLDLRQLADPIAKGAMQANSSLEPYIKPV
FT                   VRVLETSTLAELLPLIKNGNPLLLVVDEYGGTEGLITSADLTGEIVGDEIQFDNKESEL
FT                   RSLDDLKKIWLTSGEIEVIELNRELNLKLPEADDHYTLAGFVLEKLQEIPSSGETFIHN
FT                   EIVFEIISMKGPRINKVKIILPK"
FT   gene            complement(327521..327593)
FT                   /locus_tag="NATL1_tRNAMetVIMSS1309182"
FT                   /note="tRNA-Met"
FT   tRNA            complement(327521..327593)
FT                   /locus_tag="NATL1_tRNAMetVIMSS1309182"
FT                   /product="tRNA-Met"
FT   gene            327703..328284
FT                   /gene="pyrE"
FT                   /locus_tag="NATL1_03551"
FT   CDS_pept        327703..328284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="NATL1_03551"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="COG461 Orotate phosphoribosyltransferase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74919"
FT                   /db_xref="GOA:A2C0A9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0A9"
FT                   /protein_id="ABM74919.1"
FT                   /translation="MNPLNPSSDGIKENLLTLLAQKAYRFGDFSLASGKKSSHYVNCKP
FT                   VSLSGPGLLSISSLFLKQINESDSGVAGLTLGADPLVSGVVILAAQSGIDLNGLIVRKE
FT                   AKGHGTGAWLEGPLPPKGSVITVLEDVVTTGGSSLKAVEQLRNQGYLVKQVLAIVDREE
FT                   GGLDAISKADLELNSLFFLKEIVERANSLQ"
FT   gene            328281..329129
FT                   /locus_tag="NATL1_03561"
FT   CDS_pept        328281..329129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03561"
FT                   /product="Predicted GcvT-like aminomethyltransferase"
FT                   /note="COG354 Predicted aminomethyltransferase related to
FT                   GcvT [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74920"
FT                   /db_xref="GOA:A2C0B0"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0B0"
FT                   /protein_id="ABM74920.1"
FT                   /translation="MTESQALIWDETFPSLLLKGQGTTSFLHGQTTADVFAQKELDRIF
FT                   MCCWLSTKGFLKALLEIRLSDDMAEIVIICGEINSIRDGFESVIFPADKVKLEVIDPIR
FT                   RRQEINNNNSWKESDFSWIDKNNFSIDGITKYKKATKEELEGWKIRQGIPSFDKEMNGE
FT                   TNPYELGLADTINLDKGCYLGQEAMAKFFRSKSLKYQLRYWEAYGANDNFQIGKKFFNT
FT                   NKNEGYKKNVGVVTSSIRVDDNFFNGLALIKKTFLDHDFCFSENGDSITIKKPISFTNP
FT                   F"
FT   gene            complement(329148..330599)
FT                   /locus_tag="NATL1_03571"
FT   CDS_pept        complement(329148..330599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03571"
FT                   /product="Predicted nuclease (RecB family)"
FT                   /note="COG2251 Predicted nuclease (RecB family) [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74921"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0B1"
FT                   /protein_id="ABM74921.1"
FT                   /translation="MKCNKSKPINDHLLRSWIRCRRKAWLDIYGDKQKKLWTAHSTLQL
FT                   NHQIDCFHNLSQKSYGIGIQACEEGKNIAYGVRIKYPLIKNRIIKANLPILRKTSGESI
FT                   WGNYAYQPILARQGKKITREHKLTLAMTSLLVNNLQKFQVQKGLILHKENKVLKVEKIK
FT                   LSDNINTDLIGSLLNLEKDIESRNPPPITSNRKKCTICSWRKDCDAVAIKEGRLSEVSG
FT                   IGEKRELLLNKIGINNIEELAKIKHYKLKEKLEVFGTQHGDISKQIILQSQSRSTNRAI
FT                   KLNPEIELNNLKKAKGLYIYDIESDPDIKHDFLHGFIRLPKNIKNEISLEQTKYSPLLN
FT                   LEKNTESFLWKRITKKLSINPDYPIIHYGETEPISLLKLGLRQGANPHEIEELKKRFID
FT                   IHLLIREYWCLPVRNYGLKSIAEWIGFEWKQSNADGARALLWWRQWKKSRKINKMYSRN
FT                   LNSIFEYNRDDCIATLMIAKWLIDH"
FT   gene            330652..332112
FT                   /locus_tag="NATL1_03581"
FT   CDS_pept        330652..332112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03581"
FT                   /product="Phosphotransferase superclass"
FT                   /EC_number="5.4.2.2"
FT                   /EC_number="5.4.2.8"
FT                   /note="COG1109 Phosphomannomutase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74922"
FT                   /db_xref="GOA:A2C0B2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0B2"
FT                   /protein_id="ABM74922.1"
FT                   /translation="MKKKKLNLTKERISFGTDGWRGILGVEFTLERLLKVAAAAAQELD
FT                   YVEEKNNNKIIIGYDRRFLAEEMAEAVASAVRGVDLVPLLASSALPTPSCSWGIVEENA
FT                   LGALVITASHNPCEWLGLKIKGPFGGSVDSSFTDSVQKRLDAGGISIPIEGVTEKVDFR
FT                   KQHLLGISQEFDMHLIADGLRKLGVKIFVDPMHGSAAGCMSELFGVDSEELIYEIRTER
FT                   DPSFGGNPPEPLKAYLSQLIQEVQDESQAGKLSMGLVFDGDGDRIAAIDEKGRYCNTQL
FT                   LMPVLIDHLARVRNMPGCVVKTVSGSDLMRLVAEDLGREVLEKPVGFKYIAEEMLSREV
FT                   LIGGEESGGVGFGHHLPERDALFTALLLMESIVADGKCLGEKIDSLHARFGKSHFERID
FT                   LTLKDMEMRRSLEDFLKQKTPSSIGHKSVLEVISTDGIKLILDKSHWLMFRFSGTEPLL
FT                   RIYCEAPSSAEVTSTLYYAKQLIDNSFG"
FT   gene            332105..332695
FT                   /locus_tag="NATL1_03591"
FT   CDS_pept        332105..332695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03591"
FT                   /product="Xanthosine triphosphate pyrophosphatase"
FT                   /EC_number="3.6.1.15"
FT                   /note="COG127 Xanthosine triphosphate pyrophosphatase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74923"
FT                   /db_xref="GOA:A2C0B3"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0B3"
FT                   /protein_id="ABM74923.1"
FT                   /translation="MDNVPLVIASGNKGKIGEFKKLLDDFPIDLLTQPVGFEIEETGST
FT                   FMENARIKAIAVSQATGNLSLADDSGLSVEALGGAPGIYSSRYASSDKQRIEKLLAELK
FT                   PFSNRKAKFECALCIASGEKVLIEVSGFCEGLITFFPKGQNGFGYDPIFEVSGLGETYA
FT                   EMDHEKKKHIGHRGNAFKLLIPKLKQLLGSMKK"
FT   gene            complement(332724..334217)
FT                   /locus_tag="NATL1_03601"
FT   CDS_pept        complement(332724..334217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03601"
FT                   /product="Retinal pigment epithelial membrane protein"
FT                   /EC_number="1.13.11.43"
FT                   /note="COG3670 Lignostilbene-alpha,beta-dioxygenase and
FT                   related enzymes [Secondary metabolites biosynthesis,
FT                   transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74924"
FT                   /db_xref="GOA:A2C0B4"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0B4"
FT                   /protein_id="ABM74924.1"
FT                   /translation="MAVSYLKRETSPKQTIFNKEDWSSAYCNVEKELDHVQLKLVKGSI
FT                   PEQISGTFYRNGPGRLERGGRWVHHPFDGDGMIAAFKFDNGKINLTNRFVRTKEWTEEE
FT                   KSQKFLYRGVFGTQKEGGVLANAFDVRLKNIANTHVIKLGDDLLALWEASSPYSLNPNT
FT                   LETKGLSNLKGVLKKGEAFSAHPRFDPGHHQSQRMVTFGVSTGPKSTIRLMEFSTKGEN
FT                   IGSLLSDRKDSFNGFAFLHDFAITPNWAIFLQNAISFNPLPFLLGQKGAAQCLASKSDG
FT                   TPKFLLIPRDSGKFAGQPPKSVDAPKGFVFHHLNAWEDNEKINIESIFYDDFPSIGPED
FT                   NFREIDFDLLPEGILKRSEINPIENTFTCSTISNQCCEFAMVNPHFEGLKARFSWMATA
FT                   EEKEGNGPLQAIKKIDLSNNKEISWSAAPRGFVSEPIFIPSQESKSEEDNGWVVALVWN
FT                   SIRSGTDLIILDSKDLTEKAILEVPISIPHGLHGSWVEN"
FT   gene            complement(334306..334917)
FT                   /locus_tag="NATL1_03611"
FT   CDS_pept        complement(334306..334917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03611"
FT                   /product="Imidazole glycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="COG131 Imidazole glycerol-phosphate dehydratase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74925"
FT                   /db_xref="GOA:A2C0B5"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0B5"
FT                   /protein_id="ABM74925.1"
FT                   /translation="MEKTREGEIRRETKETDVFVKIDLDGSGKCSANTGIGFLDHMIQQ
FT                   LSSHGLFDIEVRANGDTHIDDHHTNEDVGIAIGQALSKALGDRVGIKRFGHFLAPLDEA
FT                   LIQVVVDCSGRPHLSFSLDIPSQKVGTYDTELVKEFFGAVVSNGGLTLHIRQLAGNNTH
FT                   HIIEATFKSFARALRMATEIDPRRSSQIPSSKGVLEQAGQ"
FT   gene            complement(334949..335731)
FT                   /gene="fabI"
FT                   /locus_tag="NATL1_03621"
FT   CDS_pept        complement(334949..335731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="NATL1_03621"
FT                   /product="enoyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.3.1.10"
FT                   /EC_number="1.3.1.9"
FT                   /note="COG623 Enoyl-[acyl-carrier-protein]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74926"
FT                   /db_xref="GOA:A2C0B6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0B6"
FT                   /protein_id="ABM74926.1"
FT                   /translation="MLLDLSGKKILVTGIANNRSIAWGIAQQLKAAGAELGITYLPDEK
FT                   GRFEAKVKELTSPLNPSLFLPLNVQNSSQIEEVFEAIKNQWGQLDGLVHCLAFAGKEEL
FT                   VGNYSATSSEGFSRALEISAYSLAPLCKYAKPLFSKGAGVVTLTYLGAERAIPNYNVMG
FT                   VAKAALEASVRYLSEELGPENQVRVNAISAGPIRTLASSAIGGILDMIHNVEEKAPLRR
FT                   TVTQIEVGNTAAFLLSDLSSGISGQTVYVDAGYCINGM"
FT   gene            335852..336472
FT                   /locus_tag="NATL1_03631"
FT   CDS_pept        335852..336472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74927"
FT                   /db_xref="GOA:A2C0B7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0B7"
FT                   /protein_id="ABM74927.1"
FT                   /translation="MVRTASTMLPLGTQLPDFELGVVSGVNSAPDDPLKGLSHIRSVDL
FT                   TKRPLFLMVICAHCPFVKHVESGITNLFNSFGNDIQFLAISSNSLITHPQDAPEFLASQ
FT                   ANKLGWKFPYLFDSDQKLAKALRAACTPDFYVFWPSPDGNLTLRYRGQMDGSRPGNEIP
FT                   VSGDDIRLVFKSLLKGEVISANQKPSIGCNIKWHPGMEPEWFG"
FT   gene            336524..337693
FT                   /gene="degT"
FT                   /locus_tag="NATL1_03641"
FT   CDS_pept        336524..337693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degT"
FT                   /locus_tag="NATL1_03641"
FT                   /product="putative pleiotropic regulatory protein"
FT                   /note="COG399 Predicted pyridoxal phosphate-dependent
FT                   enzyme apparently involved in regulation of cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74928"
FT                   /db_xref="GOA:A2C0B8"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0B8"
FT                   /protein_id="ABM74928.1"
FT                   /translation="MQIPPFSLEAQISEIGDEIEEALIKVFRSGKYIGGEEVASFEKAF
FT                   ALAIETSYSVSCNSGTDALILALRALNIGQGDEVITSSFSFFATAEAITSVGARPVFVD
FT                   IDSKNYLMDLDLIEKAITPRTKAILPVHLFGHPLDMDKIIAIAESNNLKVVEDCAQAAG
FT                   AYWGGKPVGSYGDIGCFSFFPTKNLGAAGDGGAITTNDFDLAKTIRELAIHGMPKRYFH
FT                   TSIGYNSRLDSLQAAILNVKLIRLNKWIEQRKEIAINYINQLSSIDSIELPSNTFVNNS
FT                   GHSWNQFVIRIMDNSFIKNIKSNSDDVFDNLNRDLFKTELHRLGVNTIIYYPIPIHLQP
FT                   AYKNLEYKEGSLPVTEKVCSQVISLPIFPELKSIQQSYVIDKIKELFKK"
FT   gene            complement(337695..339209)
FT                   /gene="phrB"
FT                   /locus_tag="NATL1_03651"
FT   CDS_pept        complement(337695..339209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="NATL1_03651"
FT                   /product="putative DNA photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="COG415 Deoxyribodipyrimidine photolyase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74929"
FT                   /db_xref="GOA:A2C0B9"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0B9"
FT                   /protein_id="ABM74929.1"
FT                   /translation="MVQSMPTLEYKMTKFQSIFWHRRDLRFGDNIGLFEASKNSKSLIG
FT                   VYVLDPNLLDLNRTTSEAKNWFLGESLLELQKNWEIRGSLLLILNGDPIELISKLAELV
FT                   HAECIYWNENIEPYEINRDKQIAEKLSKEKRKVYTFLDQLIVNPSDIKTNNDEPYKVYG
FT                   PFYRKWIDIINRTKSSDNNLIQTSETAKKLTGLNERELSSIKNSDLNYCITKKSKSIYE
FT                   LLSSNRFSNTSLCPCKPGESESIKQLNSFIHSGVINSYNQARDIPSLENTSNLSAALSL
FT                   GTISCRAVWNGAQVSKSSTHDEYKINSIDTWIKELAWREFYQNALINFPELEKGPYREK
FT                   WLNFPWQNRPDWFEAWGDGLTGIPIIDAAMRQLKCSGWMHNRCRMIVASFLVKDLLIDW
FT                   RLGELFFMKSLVDGDLAANNGGWQWSASSGMDPKPMRIFNPFRQASKFDEDGEYIRKWI
FT                   PELSHISTPNLLSGEISSAERNSYPNPIINHKNQTSIFKELYSNIK"
FT   gene            complement(339173..339733)
FT                   /locus_tag="NATL1_03661"
FT   CDS_pept        complement(339173..339733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03661"
FT                   /product="NUDIX hydrolase"
FT                   /EC_number="3.6.1.13"
FT                   /note="COG494 NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes [DNA replication, recombination, and
FT                   repair / General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74930"
FT                   /db_xref="GOA:A2C0C0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0C0"
FT                   /protein_id="ABM74930.1"
FT                   /translation="MAIPGPEPSEIIETKACLDAKKIRFEINKFLLPNSMKGEFGIIRH
FT                   PGAALAVPITDSGEVVILRQYRFACSRRILEFPAGTLESGESPLESIKREVQEESGYSA
FT                   KRWDKLGEMLPCPGYSDETIHLFLARDLTKLEKKPEGDADEDIEVLKISPRKLNEIIAS
FT                   GEESLDGKTITAWFRACQLLNIR"
FT   gene            complement(339802..340383)
FT                   /gene="folK"
FT                   /locus_tag="NATL1_03671"
FT   CDS_pept        complement(339802..340383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="NATL1_03671"
FT                   /product="possible
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="COG801
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74931"
FT                   /db_xref="GOA:A2C0C1"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0C1"
FT                   /protein_id="ABM74931.1"
FT                   /translation="MTYAKQKPELKLVISIGSNIPGILGDPIRTIAAMRPHIEKSVIEW
FT                   NIALNHPKIDSQNFDKSLSFQWAPLFETDPLGGPIDQPRFINTVLVVEGEGFASVTPNE
FT                   KAAKCLMKKFLELEKIAGRERENTEIIWGPRSLDIDFISWGGLQINTDTLILPHPRLSE
FT                   RNFVLIPLAEVLSKTQGKPTRISSQNIWPE"
FT   gene            340429..342582
FT                   /gene="chlD"
FT                   /locus_tag="NATL1_03681"
FT   CDS_pept        340429..342582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlD"
FT                   /locus_tag="NATL1_03681"
FT                   /product="Protoporphyrin IX Magnesium chelatase, ChlD
FT                   subunit"
FT                   /EC_number="6.6.1.1"
FT                   /EC_number="6.6.1.2"
FT                   /note="COG1239 Mg-chelatase subunit ChlI [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74932"
FT                   /db_xref="GOA:A2C0C2"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011776"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0C2"
FT                   /protein_id="ABM74932.1"
FT                   /translation="MVSSGLNNNNMSSTSKDIAVKDRANLAFPLAAITGHGTLKLALML
FT                   AAVDPGLGGVIIAGGRGTGKSVLARGLHALLPPIEIIDLDELANTEDGDDSSIYPAGRN
FT                   LDPSFSGEWDDLTKKLFTKKIGSYENTDDLENIPTKVVSAPFIQVPLGVTEDRLVGAVD
FT                   VAASLSSGTPVFQPGLLAEAHRGVLYIDELNLLDDNIVNLLLASVGAGENRVEREGLSL
FT                   SHPCRPLLIATYNPEEGGLRDHLLDRFAIVLSADQLITNEQRVEITQSAISHGQSSEAF
FT                   SKKWSEDTESLSTQLLLARQWLPDVQISEDQIEYLVVEAIRGGVEGHRSELYAVRVAKA
FT                   HAALCGRDSVDAEDLKAAVRLVIAPRAMQMPSEEEMEPPAPEDQQPPPPPPEDSDDNND
FT                   QEEDQEEDQEEEQDEESSPPIPEEFMLDPEACAVDPDLLLFSSTKSKSGNSGSRSAVLS
FT                   DNRGRYVKPIIPRGPVRRIAVDATLRAAAPYQKARREREPNRKVIVEEGDLRAKLLQRK
FT                   AGALVIFLVDASGSMALNRMQSAKGAVIRLLTEAYENRDEVSLIPFRGDQAEVLLPPTR
FT                   SITAAKRRLEAMPCGGGSPLAHGLTQAARVGANALATGDLGQVVVVAITDGRGNVPLST
FT                   SLGQPILEGETPPDLKQEVLDVASRYRALGIKLLVIDTERKFIASGMGKDLAEASGGKY
FT                   VQLPKASDKAIASIAMDAINSVT"
FT   gene            complement(342594..343439)
FT                   /locus_tag="NATL1_03691"
FT   CDS_pept        complement(342594..343439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03691"
FT                   /product="possible ABC transporter"
FT                   /note="COG1463 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74933"
FT                   /db_xref="GOA:A2C0C3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR039342"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0C3"
FT                   /protein_id="ABM74933.1"
FT                   /translation="MRRSLRDAFVGFSLLGGLVIFSGAMLWLRDFRLGSKTWEISASFK
FT                   DASGLAKMSPVTYRGIIVGSVQKISFTPNTVETKIKLNNDNLILPKPVIAKIVTSSMLG
FT                   GDAQLSLISLGKSLNKNELIKVNKDCPRKRILCNGAEIKGVEMVSISSLTEGINGIINE
FT                   ADKQAIVNKVSESIQQFDRTQANLDELVLLSKSELIRVKPIISELTKASFHLNNILESL
FT                   DNPETLKDIQELASTSSSLTKKIDQMSSDMGNIMEDKELINALKKVTIGLSKLFDDIYP
FT                   "
FT   gene            complement(343444..344229)
FT                   /locus_tag="NATL1_03701"
FT   CDS_pept        complement(343444..344229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03701"
FT                   /product="possible ABC transporter, ATP binding component"
FT                   /EC_number="3.6.3.30"
FT                   /note="COG1127 ABC-type transport system involved in
FT                   resistance to organic solvents, ATPase component [Secondary
FT                   metabolites biosynthesis, transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74934"
FT                   /db_xref="GOA:A2C0C4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0C4"
FT                   /protein_id="ABM74934.1"
FT                   /translation="MPKNTQVMLMKDLSIELGSNKVLDSVNLAMMAGERLAIVGPSGSG
FT                   KSTILRLLAGLLLPSEGSLKISGIDQNYLRLDQNSPPDVRLVFQNPALLASLTVKENVG
FT                   FLLEKQKVLPEEIINKKVINCLQKVGLYDVADKFPNQLSGGMQKRVSFARALISDSKKG
FT                   KGSIPLLLYDEPTAGLDPIACTRIEDLIIKTTEAAEGCSIVVSHVSSTIERTANRVILL
FT                   YGGKFQWDGSIDQFKQSENTYVKQFRTGNLKGPMQPKDS"
FT   gene            344357..345754
FT                   /locus_tag="NATL1_03711"
FT   CDS_pept        344357..345754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03711"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG391 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74935"
FT                   /db_xref="GOA:A2C0C5"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0C5"
FT                   /protein_id="ABM74935.1"
FT                   /translation="MNKRRKRKSRRATLRKSLLASLSFHVYSRFKRAIRWLLPGLVVKR
FT                   WMMTSGLGLLIALIGASIWADLRPIYWVVEILFWFLGFITTFLPRTISGPLVFFIGISL
FT                   LIWGQGRSFESIRQALGSKKDTFLVDALRAKQKLNRGPNIVAIGGGTGLSSLLKGLKRY
FT                   SSRITAIVTVADDGGSSGVLRRELGVQPPGDIRNCLAALATEEPLIKGLFQYRFPSGSG
FT                   LEGHSFGNLFLSALTAITGSLETAITASSRVLAVQGQVVPATNVDVRLWAELENGDRID
FT                   GESAIGKAPLPIIRIGCYPSRPPALPRALEAIRNAEIILIGPGSLYTSILPNLLVPEIV
FT                   EAIEKSKAPKLYVCNLMTQPGETDGLDVTGHVRAIEAQLASRGISRKIFSSILAQDELK
FT                   PSPLVDYYKSKGAEPVKCNKIDLLSRGYNVYLASLQGSKVTPTLRHDPRSLALAIMRFY
FT                   RRYKKGK"
FT   gene            complement(345756..346277)
FT                   /gene="ndhJ"
FT                   /locus_tag="NATL1_03721"
FT   CDS_pept        complement(345756..346277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhJ"
FT                   /locus_tag="NATL1_03721"
FT                   /product="putative respiratory-chain NADH dehydrogenase
FT                   subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG852 NADH:ubiquinone oxidoreductase 27 kD subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74936"
FT                   /db_xref="GOA:A2C0C6"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0C6"
FT                   /protein_id="ABM74936.1"
FT                   /translation="MTNDSEIVVEEKISGPISDWLSNKGFENIPLKEDHLGIEVIKISP
FT                   NNLLSIVEALKNDGFNYLQCQGGYDEGPGLNIVCFYNLIEMNELKEDISPREVRLKVFL
FT                   DRNGDLTVPSLYSLFRGADWQERETFDMYGVNFKGHPHPKRLLMPEDWKGWPLRKDYVQ
FT                   PDFYEMQDAY"
FT   gene            complement(346294..347043)
FT                   /gene="ndhK"
FT                   /locus_tag="NATL1_03731"
FT   CDS_pept        complement(346294..347043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhK"
FT                   /locus_tag="NATL1_03731"
FT                   /product="putative respiratory-chain NADH dehydrogenase
FT                   subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG377 NADH:ubiquinone oxidoreductase 20 kD subunit
FT                   and related Fe-S oxidoreductases [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74937"
FT                   /db_xref="GOA:A2C0C7"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0C7"
FT                   /protein_id="ABM74937.1"
FT                   /translation="MELNPLKKSPSSEAVRNLREASCGPVGTPTVTNDLSENIILTSLE
FT                   DLHNWARLSSLWPLLYGTACCFIEFAALIGSRFDFDRFGLVPRSSPRQADLLIVAGTVT
FT                   MKMAPALVRLYEQMPDPKYVIAMGACTITGGMFSADSTTAVRGVDKLIPVDLYLPGCPP
FT                   RPEAIFDAVIKLRKKVANESISERSKITQTHRYLTIPHKMKRVEAKVNGQYLKAKTQLI
FT                   ALNPSLSEEFDQSLKEVQKISEELSSN"
FT   gene            complement(347034..347396)
FT                   /gene="ndhC"
FT                   /locus_tag="NATL1_03741"
FT   CDS_pept        complement(347034..347396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhC"
FT                   /locus_tag="NATL1_03741"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 3)"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG838 NADH:ubiquinone oxidoreductase subunit 3
FT                   (chain A) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74938"
FT                   /db_xref="GOA:A2C0C8"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0C8"
FT                   /protein_id="ABM74938.1"
FT                   /translation="MFSLQGYEYFLGFLLISGAVPILALTTNKLIAPKSKAGERQLTYE
FT                   SGMEPIGGAWIQFNIRYYMFALVFVIFDVETVFLYPWAVAFHKLGLLAFIEALVFITIL
FT                   VVALAYAWRKGALEWS"
FT   gene            347481..347906
FT                   /gene="rub"
FT                   /locus_tag="NATL1_03751"
FT   CDS_pept        347481..347906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rub"
FT                   /locus_tag="NATL1_03751"
FT                   /product="probable rubredoxin"
FT                   /note="COG1773 Rubredoxin [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74939"
FT                   /db_xref="GOA:A2C0C9"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0C9"
FT                   /protein_id="ABM74939.1"
FT                   /translation="MSEDKKTESNPLGDLNLDEKQNQVISFESKNSNEEFDPKGNRFEC
FT                   MSCGFIYDPDEGIKKLNIEPGTAFLDIDREKFRCPVCRVGFGGYKDIGPKSKPSGFEEN
FT                   LTYGFGFNKLPSGQKNVLIFGSLALAAACFLSLYSLK"
FT   gene            347903..348919
FT                   /locus_tag="NATL1_03761"
FT   CDS_pept        347903..348919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03761"
FT                   /product="Uncharacterized protein plant photosystem II
FT                   stability/assembly factor-like protein"
FT                   /note="COG4447 Uncharacterized protein related to plant
FT                   photosystem II stability/assembly factor [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74940"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016705"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0D0"
FT                   /protein_id="ABM74940.1"
FT                   /translation="MKRLFSNVINLTLVLIVGVALSGCTVSNASIGSSSPWSLVDLDTE
FT                   ANPLDVDFVDDKNGFLVGTNRLILETNDGGITWKERNLDIPSEGNFRLISVDFKGQEGW
FT                   IAGQPGLILHTTDGGKNWTRLDLGNKLPGDPYLITTIDTDTAELATTAGAIYKTTDAGT
FT                   NWEAIVVDTSGSGGIRELRRTNNGGYISVSSLGNFFSVLRPGEEIWSPHQRASSKRVQS
FT                   VGEQPNGDLWMLSRGAEIRFNADPDDIDSWSKPIIPIVNGYNYQDLVWDPSKSIWAAGG
FT                   NGTLLVSNDQGKTWEKDPVGESVPTNFIRILFLDDLNSDSPKGFVFGERGNLLRWQG"
FT   gene            349027..349275
FT                   /gene="psbE"
FT                   /locus_tag="NATL1_03771"
FT   CDS_pept        349027..349275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbE"
FT                   /locus_tag="NATL1_03771"
FT                   /product="Cytochrome b559 alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74941"
FT                   /db_xref="GOA:A2C0D1"
FT                   /db_xref="InterPro:IPR006217"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="InterPro:IPR013082"
FT                   /db_xref="InterPro:IPR037025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0D1"
FT                   /protein_id="ABM74941.1"
FT                   /translation="MAAGSTGERPFFEIITSVRYWIIHAVALPAIFVAGFLFVSSGLAY
FT                   DAFGTPRPDTYFQAGESKAPVVVQRFDSKAELDTRLK"
FT   gene            349305..349424
FT                   /gene="psbL"
FT                   /locus_tag="NATL1_03781"
FT   CDS_pept        349305..349424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbL"
FT                   /locus_tag="NATL1_03781"
FT                   /product="photosystem II PsbL protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74942"
FT                   /db_xref="GOA:A2C0D2"
FT                   /db_xref="InterPro:IPR003372"
FT                   /db_xref="InterPro:IPR037266"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0D2"
FT                   /protein_id="ABM74942.1"
FT                   /translation="MQVNPNPNKVPVELNRTSLYLGLLLVFVMGILFSSYFFN"
FT   gene            349436..349633
FT                   /gene="psbJ"
FT                   /locus_tag="NATL1_03791"
FT   CDS_pept        349436..349633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbJ"
FT                   /locus_tag="NATL1_03791"
FT                   /product="photosytem II PsbJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74943"
FT                   /db_xref="GOA:A2C0D3"
FT                   /db_xref="InterPro:IPR002682"
FT                   /db_xref="InterPro:IPR037267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0D3"
FT                   /protein_id="ABM74943.1"
FT                   /translation="MSKLKGPDGRVGDRLPDGRPAISWQRRWTEGALPLWLVATAGGTA
FT                   VIFVLGIFFYGSYTGIGNAG"
FT   gene            complement(349706..350638)
FT                   /locus_tag="NATL1_03801"
FT   CDS_pept        complement(349706..350638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03801"
FT                   /product="5'-methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="COG5 Purine nucleoside phosphorylase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74944"
FT                   /db_xref="GOA:A2C0D4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0D4"
FT                   /protein_id="ABM74944.1"
FT                   /translation="MITEHDFLNISGTQSDAYDFKQARLGIIGGSGLYRIENLKDIVEL
FT                   SLDTPYGKPSNKLLIGNLFGIEIVFLARHGEKHTLNPSEIPYKANIWAMRSLNVRWLIS
FT                   ASAVGSLKENIKPCDIVIPDQFIDRTHQRPLTFFNNGVVAHISMANPFCDILSQILSKE
FT                   IEKLLTKDKKMHIGGTYLAMEGPAFSTRAESNLYRDWGCSIIGMTNHTEARLAKEAEIA
FT                   YSSLSMVTDYDCWNQNCENVSVEMVIENLQENANFAKSIISAVAKRVSSLRPPSSFHSA
FT                   LKDALVTPEEHVPEKTKSKIKLFTDKYWL"
FT   gene            350624..352804
FT                   /locus_tag="NATL1_03811"
FT   CDS_pept        350624..352804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03811"
FT                   /product="Selenide,water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /note="COG1252 NADH dehydrogenase, FAD-containing subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74945"
FT                   /db_xref="GOA:A2C0D5"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR030805"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0D5"
FT                   /protein_id="ABM74945.1"
FT                   /translation="MFSDHLVLAGGGHTHALVLLQWAMNPKLKPAGMITLVNKASTTVY
FT                   SGMFPGVIAGKYKIDEILIDLRKLALKAGVSFVMAEIEGINLKEKKLLLAGRPEIEYSL
FT                   LSLNIGTKTNINSKLFIRGDKDLAVPIKPFSESYKFIVDQDIHKNDSSAKPFVIIGGGF
FT                   AGIEIAFSLRKRWPKRPILLKVKSGRNINKNLLRNLKALDIEITQKQPSILYPKLICTG
FT                   NKSFNWLKDSGLPIDENGRVLTEKTLQVLNYPELFAVGDCGVIKDYPRPSSGVWAVRAA
FT                   KPLANNLEFITKGLKLEEWKPQRKAIQLLDINIRKKKSKAFISWGEVIIGPFDFLSSFK
FT                   ELIDKQFISKFDLVKDINSDMSSEEEMIKCRGCAAKLAFTPLSSALKKVDLIESSKDDS
FT                   INIGILNSDKTLIQSVDGFPSLISDPWLNGRLLAFHSCSDIWACGGSVISAQSLINLPS
FT                   ISNNLQKELLYQVLEGINSALTIQGANLIGGHTLESRKISEEPFSLGIESSLTVNGVID
FT                   DKKYFWPKGGMRNGDEILISRSLGTGIIFSAFMNGQVKPYILDNVLKEMNKSQHEIVNY
FT                   INQLTNLNPRSKIVNACTDITGFGLLGHLSEMLESTNSDQLKMNLEPFKVTLELDNIPL
FT                   YDGAKELLDKGFESTLAPANQIFLKNIDGDKNLRFELKSNDSSSNRSFYNAMLKILVDP
FT                   QTCGPLVVCCSSIYSEKLIQQGPWIKIGFISK"
FT   gene            complement(352820..354076)
FT                   /locus_tag="NATL1_03821"
FT   CDS_pept        complement(352820..354076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03821"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74946"
FT                   /db_xref="GOA:A2C0D6"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0D6"
FT                   /protein_id="ABM74946.1"
FT                   /translation="MELFDKSTIEKEIKELPSGILTIILEAACSVNITSIAIVGGVVRD
FT                   LIKKSKNQDYEIIFNDLDLIIEGETSTYIKELQKVLGAERVKVIRDNRNYKTSEVIING
FT                   IKVDIASARKETYPIPGENPIVELSTIKKDLIRRDFNINAMAIELKDNRLIDLFSGSDA
FT                   IENMKMDFLHKSSVLDDPTRVIRASRYSAKLDFDLSNQALKQIKDTINLWPWNWHIGDN
FT                   TDLAPSALSIRLKMELELLLEDKYWKNALKNLQVCGGLKIVDSKLQNDQRLIEKIFIAK
FT                   KSNIEPLTAFVYESKSPIYLAKRLHLNQQQKEIIEGACRLNKYLKNLTANHLYKNWSPS
FT                   KWTTNLEKINANESSFMLEICRNNPLKEYLKSWLFNWKNIESPIKGDDLIAKGWEPGPE
FT                   IGIEIKRQRMKLIDENIAF"
FT   gene            complement(354120..356537)
FT                   /gene="uvrD"
FT                   /locus_tag="NATL1_03831"
FT   CDS_pept        complement(354120..356537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="NATL1_03831"
FT                   /product="UvrD/REP helicase"
FT                   /note="COG210 Superfamily I DNA and RNA helicases [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74947"
FT                   /db_xref="GOA:A2C0D7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0D7"
FT                   /protein_id="ABM74947.1"
FT                   /translation="MKQSNSIFLNGLNEAQSHAVDHFHGPLLVVAGAGSGKTRALTHRI
FT                   AHLITEYKVDPSSILAVTFTNKAAREMKDRLELLLAKRLSSLTHGKPWTALQVAEQREI
FT                   RNRIHREISRELWIGTFHALFSRLLRFDIDKFKDPEGLTWTKQFSIYDETDAQSLIKEI
FT                   VTQDLQLDPKRFEPKKVRWAISNAKNQCLLPDDLSNNQEGQRGKLVAETYRLYRKALAA
FT                   NNALDFDDLLLIPVQLLQQNEKIRTYWHSRFKHVLVDEYQDTNWTQYELIKQLVTNGKD
FT                   PSSFQDWNNRSVFVVGDADQSIYSFRAADFRILMGFQEDFGKKSLDNTYDSTLVKLEEN
FT                   YRSTSTILEAANSLISNNKERIDKVLRATRGEGEPIRLTRCDDEIAEAEAVIHRLRILD
FT                   ASNPELNWGDMAILYRTNAQSRAIEDSLVRWSIPYIVVGGLRFYDRREIKDLLAYLRLL
FT                   INPSDSVSLLRVLNVPKRGIGKTTVQRLSDAASQLKIPLWEVVNDPEAVRSLAGRSAKG
FT                   LLIFSELINELQSHLLSSSPAELVQLVLEKSGYLSELIATGTDEAEERRRNLQELVNAA
FT                   LQYQEESEDANLEGFLSTAALSSDADNKDTASNRVTLMTLHSSKGLEFPVVCLVGMEQG
FT                   LFPSYRSLDDPSSLEEERRLCYVGLTRAKEKLFLFHASERRMWGGMREPAIASIFLSEI
FT                   PEELVKGDIPLSGGATLRREKNLDRLTRIDRQSNKKSFPREAENAVRKTYSGPSPGKRW
FT                   SVNDRVEHSSFGEGIITHVFGSGEKISLAIKFSGMGPKILDPRLAPLKLIDE"
FT   gene            complement(356626..356865)
FT                   /locus_tag="NATL1_03841"
FT   CDS_pept        complement(356626..356865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03841"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74948"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0D8"
FT                   /protein_id="ABM74948.1"
FT                   /translation="MLNKKMKSPTEEELEESIKELSEYKNRLEKEVVTISQKLKMPQRK
FT                   IESIINSHQELNKIKIILSKLYKQKENATSNLLL"
FT   gene            357094..357642
FT                   /gene="cpeB"
FT                   /locus_tag="NATL1_03851"
FT   CDS_pept        357094..357642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeB"
FT                   /locus_tag="NATL1_03851"
FT                   /product="Phycobilisome protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74949"
FT                   /db_xref="GOA:A2C0D9"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0D9"
FT                   /protein_id="ABM74949.1"
FT                   /translation="MLDAFSRTVVSADAKGAAIGSEDLADLRKYVADANKRIDATLAIT
FT                   QNVSCIAADAVAGMVCENTGLTQPGGHCYPTRRMAACLRDGEIILRYVSYALLAGDPSV
FT                   LEDRCLNGLKETYLALGVPTSNAIRAVEIMKIATVAIMTEKNTGRKMFKGINSGSGAQC
FT                   QDIASEAASYFDLVIEALR"
FT   gene            357699..358166
FT                   /gene="cpeA"
FT                   /locus_tag="NATL1_03861"
FT   CDS_pept        357699..358166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeA"
FT                   /locus_tag="NATL1_03861"
FT                   /product="Phycobilisome protein (phycoerythrin,
FT                   alpha-subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74950"
FT                   /db_xref="GOA:A2C0E0"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0E0"
FT                   /protein_id="ABM74950.1"
FT                   /translation="MKSAVTTVVSAADAAGRFPSMSDFESVKGSFDRAKARLEAAEKLA
FT                   SCLDKFTNLAVDAVYQNGSYEQANKDKCVRDIHHYLRLINYCLVTGGTGPLDEWGISGM
FT                   REIIRIQLLPTAAYIEAFIFIRDEIKINDVMGQQAETEFKGLLDYLINALA"
FT   gene            358232..358828
FT                   /locus_tag="NATL1_03871"
FT   CDS_pept        358232..358828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03871"
FT                   /product="putative bilin biosynthesis protein cpeZ"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74951"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0E1"
FT                   /protein_id="ABM74951.1"
FT                   /translation="MINSLDLNKYIELYQDFLHPNPNINSQAFLILKKEFEVKFMNNLL
FT                   ANLKEEDLFIRRKSILALGRFGEKALKSIVQLYMDTNNTTVKVSCLKTIIKVVVNFNLE
FT                   ELTQDEMLVVDLALKDSSPEMILTVISLLRQLGRTGRNILMKTCRDKDLLRAKASISAL
FT                   LEMKDQTIDDLFEDLLNDKSIDQMIKEDILRDKII"
FT   gene            complement(358854..359717)
FT                   /locus_tag="NATL1_03881"
FT   CDS_pept        complement(358854..359717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03881"
FT                   /product="FOG: HEAT repeat"
FT                   /note="COG1413 FOG: HEAT repeat [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74952"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0E2"
FT                   /protein_id="ABM74952.1"
FT                   /translation="MDNYLNSEISTEEESEKAKGDKQNIMSKKKSSQKDIKLLIKGLSD
FT                   ENGLVRRNYAIALAEVGSAALPELIKALLNSKNVIQRRAAAKTLKLVNDPSALPHLIKA
FT                   LTSDSDSVVQFSAAGAIAIFGEAAVNHLIIVLENQEYTEMQYGLAAWCLEFIGAKASNA
FT                   IKKAAKSKNTNVKSAAISALEEHIRQSQDQEAIQIVERAINDPAENVQIEAIKLVGKLY
FT                   RIESLIPTLILKLKHKNPDIRKASILSLIQLNINEAINPLRDLLKIEQDKNVTAIIKLA
FT                   IKKINN"
FT   gene            359884..361188
FT                   /gene="cpeY"
FT                   /locus_tag="NATL1_03891"
FT   CDS_pept        359884..361188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeY"
FT                   /locus_tag="NATL1_03891"
FT                   /product="putative bilin biosynthesis protein CpeY"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74953"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0E3"
FT                   /protein_id="ABM74953.1"
FT                   /translation="MQSNPFNNLPKINKIDAINILRRPISEVKLLADYYKAVFHLANFP
FT                   CEESELVLLDFIKHDCEKLEYKIAKRKAIEVLANFGCKKAIQAIAEFLENDDDYLVETV
FT                   IWSLAKLKCNDIDIINKICSKLYKQFNNKRVVIQTLTHLGVRKEIDMIRSLSRDKQSSN
FT                   GVKGASFAALIKLAGEEDKLTDLKKFLRLSNQNDRHCAVQDIINAGHLSVLPDLIKAPL
FT                   SPSFKLQAIDSLWINEVVLCENINLFNCIDSVVVDDPRNIDTLKVNNFNKDLSFLIEQL
FT                   FHTDFNRCYQSIKELLKFPLDKVLYYLNNNWDRAKSDYGAIYFFINVYKLLLDQQLYDE
FT                   FLLDKVGFLLSDDWPDYMKFKSSAIQVLGCLNENKFYNNIIYFSDESHTPYWKNRYTAL
FT                   LVLQNKQIHIKNKFAKLFFNDSHRFVRFKAKEIST"
FT   gene            complement(361222..361821)
FT                   /gene="cpeT"
FT                   /locus_tag="NATL1_03901"
FT   CDS_pept        complement(361222..361821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeT"
FT                   /locus_tag="NATL1_03901"
FT                   /product="CpeT"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74954"
FT                   /db_xref="GOA:A2C0E4"
FT                   /db_xref="InterPro:IPR010404"
FT                   /db_xref="InterPro:IPR038672"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0E4"
FT                   /protein_id="ABM74954.1"
FT                   /translation="MKKKPTLEFAKIVSGVFSNKEQALNNPKKFAHIQIHIRPLFFKTY
FT                   NCFAFYSEQRYQHDIWNPYRQSINKLSQEEEIFIFSNYKIEDKERFTGGALDISLLDKI
FT                   SKYKLYKKPGCSMYFKETNPGNFLGTIESGCKCFIEYGSDKTYVKSKVTVNKNILISED
FT                   SGYAIETDKKVWGSEFGPLIFKKIINFDCFINEYWK"
FT   gene            complement(361834..362319)
FT                   /gene="cpeS"
FT                   /locus_tag="NATL1_03911"
FT   CDS_pept        complement(361834..362319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeS"
FT                   /locus_tag="NATL1_03911"
FT                   /product="phycoerythrin linker protein CpeS"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74955"
FT                   /db_xref="GOA:A2C0E5"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR018536"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0E5"
FT                   /protein_id="ABM74955.1"
FT                   /translation="MRSGHSLAFQEFEEIRSKIKISPSKPKDARVIKFLKDNLISTKAV
FT                   NKAFLISWEAKSEWGEENQNGNSSGESIVVPIEVSKTEGKIVRSVGYTEAIQVVSLYKI
FT                   LGDGTLIIYSEYSHISTEERIWFISNNVRSRSSVTRSLDSLAILQTSYASEIRSLKN"
FT   gene            complement(362407..363198)
FT                   /locus_tag="NATL1_03921"
FT   CDS_pept        complement(362407..363198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03921"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74956"
FT                   /db_xref="GOA:A2C0E6"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0E6"
FT                   /protein_id="ABM74956.1"
FT                   /translation="MSSIPFKALKIGAEAINKDPVKFNKSRVSGSKKTTYGLHIRGASM
FT                   PGEKEKFTVTSKTKPKQFENLIHNNVMSSYRRDKIESYKYKILNKESAGINMLQINEFV
FT                   PIDDDALLVAINALYKHIFGNLSLMQSERPIDIERKLRNGDLTVREFTRKICKSTIYRN
FT                   FYFDGISQYKAIKLRYKHILGRPIKSKDEVTQSSNIINNLGFEEHIDFLIDSNEYNKIF
FT                   GEDIVPYMRSWNSPTGFKTQSFLETSYLTKAFATSDICTII"
FT   gene            complement(363303..363962)
FT                   /locus_tag="NATL1_03931"
FT   CDS_pept        complement(363303..363962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03931"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG398 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74957"
FT                   /db_xref="GOA:A2C0E7"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0E7"
FT                   /protein_id="ABM74957.1"
FT                   /translation="MKKEKLQKYLTIAFFIGAFILLVFLIQTYGIEPLRSAVKEMGIWA
FT                   PLGILILRGISVILPALPSSVYSLLAGSLLGFKTGYLTIFISDLIFCQIAFFIARNFGR
FT                   APVRKLVGIKAMKRIESFNQNQLEGNFFLMTGLLMTGLFDFLSYALGIGGTRWRLFTPA
FT                   LIISLLISDSIIVAVGAGVSQGAGLMLGGALLGMFALATITGFNKNKVSETQKKSL"
FT   gene            364132..365088
FT                   /locus_tag="NATL1_03941"
FT   CDS_pept        364132..365088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03941"
FT                   /product="Nucleoside-diphosphate-sugar epimerases"
FT                   /EC_number="4.2.1.46"
FT                   /EC_number="4.2.1.47"
FT                   /EC_number="5.1.3.2"
FT                   /EC_number="5.1.3.7"
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74958"
FT                   /db_xref="GOA:A2C0E8"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0E8"
FT                   /protein_id="ABM74958.1"
FT                   /translation="MPKSPVKNLVTGGAGFVGSHLIDRLMKSGEKVICLDNFFTGSKEN
FT                   IEHWIGHPSFELIDHDVIEPIKLDVDRIWHLACPASPIHYQFNPIKTAKTSFLGTYNML
FT                   GLARKVGARILLASTSEVYGNPEIHPQPEKYNGNVNPIGIRSCYDEGKRVAESLCYDYM
FT                   RMHGLEIRIARIFNTYGPRMLLNDGRLISNLLVQSIHGNDLTIYGNGKQTRSFCFVDDL
FT                   IDGLTLFMNSLNVGPMNLGNPEELSILQITNFIRNISIEKVNLKFLKALDDDPLRRKPD
FT                   IYLAKKELNWEPKIMFKEGLAITRKYFEKKLIFEKSK"
FT   gene            365177..366223
FT                   /locus_tag="NATL1_03951"
FT   CDS_pept        365177..366223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03951"
FT                   /product="Putative nucleotide sugar epimerase"
FT                   /EC_number="4.2.1.46"
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74959"
FT                   /db_xref="GOA:A2C0E9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0E9"
FT                   /protein_id="ABM74959.1"
FT                   /translation="MNSKASNETILVTGAAGFIGAALVKALLNLDFKVIGIDNLNDYYS
FT                   TSLKRSRLTEIEKVSTVNGEWFFYEIPIEDNKVLQDIINRYNPQVFVHLAAQAGVRYSI
FT                   TNPAAYIQSNLVGFANVLEGCRQNQIPHLIYASSSSVYGGNKNLPFYEEQAVNHPVSLY
FT                   AATKKSNELMAHTYSHLYDLPTTGLRFFTVYGPWGRPDMAPMIFARSILNNEPIQVFNY
FT                   GKMQRDFTYIDDVVEGIIRCCFKKASIDDEFNPLVPNPSTSSAPYRIFNIGNSRPTQLT
FT                   YFIELLEKNLGKKAIKNFQPMQPGDVVSTAARMDLLNSWVDYKPITSIENGIKLFSEWY
FT                   LDYFKNTF"
FT   gene            complement(366257..366487)
FT                   /locus_tag="NATL1_03961"
FT   CDS_pept        complement(366257..366487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03961"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74960"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0F0"
FT                   /protein_id="ABM74960.1"
FT                   /translation="MNLEASSENLYNNADSFAMAFDAAWKDCDLGNNKDIKIDEKIEIA
FT                   FEKIKNHPFLISNPIQSKNVALFRIKLLGLA"
FT   gene            complement(366901..367068)
FT                   /locus_tag="NATL1_03971"
FT   CDS_pept        complement(366901..367068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03971"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74961"
FT                   /db_xref="GOA:A2C0F1"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0F1"
FT                   /protein_id="ABM74961.1"
FT                   /translation="MMNLLIGVQSTFDLSKVDFSSGLGINSPDLAGISFLMVIFAGVLA
FT                   LRLGTTLRDS"
FT   gene            complement(367429..367504)
FT                   /locus_tag="NATL1_tRNAPheVIMSS1309181"
FT                   /note="tRNA-Phe"
FT   tRNA            complement(367429..367504)
FT                   /locus_tag="NATL1_tRNAPheVIMSS1309181"
FT                   /product="tRNA-Phe"
FT   gene            complement(367649..367918)
FT                   /locus_tag="NATL1_03981"
FT   CDS_pept        complement(367649..367918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_03981"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74962"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0F2"
FT                   /protein_id="ABM74962.1"
FT                   /translation="MNSEPINQESSTRICNHMNKDHEDAVNAYAKYYGKIKTFKSAKMI
FT                   SLSPEAVQIKIDEETLEIKFDHILQDCSDAHKTLVRMIKAIPKL"
FT   gene            complement(368016..369251)
FT                   /gene="xylB"
FT                   /locus_tag="NATL1_03991"
FT   CDS_pept        complement(368016..369251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="NATL1_03991"
FT                   /product="Carbohydrate kinase, FGGY family"
FT                   /note="COG1070 Sugar (pentulose and hexulose) kinases
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_03991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74963"
FT                   /db_xref="GOA:A2C0F3"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0F3"
FT                   /protein_id="ABM74963.1"
FT                   /translation="MLNNSFVLGIDLGTSGVRIAIINTKKKILFTSSTKYSKGLEISGD
FT                   WINSLKNLIQEIPKDLKEKLVSCSVAGTSGTLLACNRDGVPLGKALPYFLPFSEYSCEI
FT                   ENLFTKECAGSSVSGSVGRALKLLALYGNEIILRHQADWISGWLINNWEYGEEGNNIRM
FT                   GWEISNSSWPEKFQNLKWLKCLPKIIPSGQIMGNICTKKANELSLPKNLKVIAGTTDSN
FT                   AGVLATFPNKNDGITILGSTIVIKKFVNNPLEGKGISNHKLLGNWLSGGASNTGASILL
FT                   DFFNLEYIAELSKQINPNKSSGLNLLPLSSQGERFPIDDPNLQPKLEPRPVSDSLYLHA
FT                   LFEGLAKIEARGWQKLNELGADLPRQIITIGGGAKNITWKKIREREIGIPIKICNTPPA
FT                   AGVASIALQGLL"
FT   gene            complement(369272..370501)
FT                   /gene="metK"
FT                   /locus_tag="NATL1_04001"
FT   CDS_pept        complement(369272..370501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="NATL1_04001"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COG192 S-adenosylmethionine synthetase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74964"
FT                   /db_xref="GOA:A2C0F4"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0F4"
FT                   /protein_id="ABM74964.1"
FT                   /translation="MSRYVFTSESVTEGHPDKICDQVSDAVLDACLSEDPTSRVACEAV
FT                   VNTGLCLITGEITSKAEVDFNKLVREVIKSIGYRSASDGGFDANSCAVLVALDQQSSDI
FT                   AQGVNEAEDHSTDPLDQVGAGDQGIMFGFACDETPELMPLPISLAHRLARRLALVRHQQ
FT                   LIDYLLPDGKTQVSVSYENGVPCSIDTILISTQHKSEVDGITLEEEIQKRIAKDLWKFV
FT                   VEPATEDLPLKPAKESTRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAF
FT                   SGKDPTKVDRSAAYAARFVAKALVAANLAKKVEVQLSYAIGVAKPISILVDSFGTGKVS
FT                   DSELTQLVQDQFDLRPGAIIKAFDLQNLPSVRGGRFYRDTAAYGHFGRTDILLPWEDVS
FT                   QKAKELSLLK"
FT   gene            complement(370525..371313)
FT                   /locus_tag="NATL1_04011"
FT   CDS_pept        complement(370525..371313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04011"
FT                   /product="Haloacid dehalogenase/epoxide hydrolase family"
FT                   /note="COG546 Predicted phosphatases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74965"
FT                   /db_xref="GOA:A2C0F5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0F5"
FT                   /protein_id="ABM74965.1"
FT                   /translation="MAELLIKNSSVGFIKAVIFDKDGTLSNSEECLLELAKTRINFFED
FT                   KLKKLKLNTIKIWLLKKLLISVYGLKKNSLSANASLAIASREQNIISTATIFTLFGFDW
FT                   FQSLSIGKEIFDEVDIYLFNQKGNAQKHRTLISGALDLLVSLKKEGVSLALMTNDTQVG
FT                   IEEFICRNKLEGIFDYHWSAENKPSKPNPEAVIELCKKMNFNPSDCALISDADTDLRMA
FT                   KEAGITLVVGFNGGWQTPPVLTEKKFLIEKLNELKIHSSY"
FT   gene            complement(371332..372441)
FT                   /gene="rps1a"
FT                   /gene_synonym="rpsA1"
FT                   /locus_tag="NATL1_04021"
FT   CDS_pept        complement(371332..372441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps1a"
FT                   /gene_synonym="rpsA1"
FT                   /locus_tag="NATL1_04021"
FT                   /product="30S ribosomal protein S1, protein A"
FT                   /note="COG1098 Predicted RNA binding protein (contains
FT                   ribosomal protein S1 domain) [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74966"
FT                   /db_xref="GOA:A2C0F6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0F6"
FT                   /protein_id="ABM74966.1"
FT                   /translation="MSENPASKIEEKNPEKETSIPEETVSNSTSAEFEENSISELKEDD
FT                   IPKNIPAADDSSSRINKSDLESAGFTLDEFASLLSKYDYNFKPGDIVNGTVFALESKGA
FT                   MIDIGAKTAAFMPMQEVSINRVEGLSDVLQPSEIREFFIMTEENEDGQLSLSIRRIEYQ
FT                   RAWERVRQLQKEDATIYSEVFATNRGGALVRVEGLRGFIPGSHISTRKAKEELVADFLP
FT                   LKFLEVDEERNRLVLSHRRALVERKMNRLEVGEVVVGAVRGIKPYGAFIDIGGVSGLLH
FT                   ISEISHEHIETPHSVLNVNDQMKVMIIDLDAERGRISLSTKALEPEPGDMLTDPQKVFD
FT                   KAEEMAARYKQMLLEQAEEGEDPIAVMTI"
FT   gene            complement(372545..373024)
FT                   /locus_tag="NATL1_04031"
FT   CDS_pept        complement(372545..373024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04031"
FT                   /product="Predicted transcriptional regulator, consists of
FT                   a Zn-ribbon and ATP-cone domains"
FT                   /note="COG1327 Predicted transcriptional regulator,
FT                   consists of a Zn-ribbon and ATP-cone domains
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74967"
FT                   /db_xref="GOA:A2C0F7"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0F7"
FT                   /protein_id="ABM74967.1"
FT                   /translation="MQCPSCQNTDSRVLESRSADSGRSVRRRRECLNCDFRFTTYERVE
FT                   TTPINVLKRSGAKELFNRSKIINGLNRACEKTLIHGSKIEFIVDEIELELHQGVCKEIK
FT                   SIEIGEMVLTHLKDINEVAYIRFASVYRQFNGINDFMKTLEALKPIKKEQLASVI"
FT   gene            complement(373184..373279)
FT                   /gene="psbT"
FT                   /locus_tag="NATL1_04041"
FT   CDS_pept        complement(373184..373279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbT"
FT                   /locus_tag="NATL1_04041"
FT                   /product="Photosystem II PsbT protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74968"
FT                   /db_xref="GOA:A2C0F8"
FT                   /db_xref="InterPro:IPR001743"
FT                   /db_xref="InterPro:IPR037268"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0F8"
FT                   /protein_id="ABM74968.1"
FT                   /translation="MEAFSYVLILTLALVTLFFAVAFRDPPKYDK"
FT   gene            complement(373317..374840)
FT                   /gene="psbB"
FT                   /locus_tag="NATL1_04051"
FT   CDS_pept        complement(373317..374840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbB"
FT                   /locus_tag="NATL1_04051"
FT                   /product="Photosystem II PsbB protein (CP47)"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74969"
FT                   /db_xref="GOA:A2C0F9"
FT                   /db_xref="InterPro:IPR000932"
FT                   /db_xref="InterPro:IPR017486"
FT                   /db_xref="InterPro:IPR036001"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0F9"
FT                   /protein_id="ABM74969.1"
FT                   /translation="MGLPWYRVHTVVINDPGRLLAVHLMHTALLAGWAGSMALYELAIF
FT                   DPSDPVLNPMWRQGMYVMPFMARLGITGSWNGWDITGATGVDPGFWSFEGVAAAHIVFS
FT                   GLLMLAAVWHWTYWDLELWEDSRTGEPALDLPRIFGIHLFLAGLTCFGFGAFHCSSVGI
FT                   WVSDPYGLTGHVEKVAPVWGAEGFNPFNAGGIVANHVGAGLLGIIGGIFHITNRPGERL
FT                   YRALKLGSLEGVLASALAAVLFVSFVVAGTMWYGSATTPVELFGPTRYQWDSGYFKTEI
FT                   NRRVQESMNDGASKAEAYASIPEQLAFYDYVGNSPAKGGLFRVGAMVNGDGVPSGWQGH
FT                   ISFTDSDGNDLEVRRIPNFFENFPVILEDKDGNVKADIPFRRAEAKYSIEQTGVTATVY
FT                   GGELNGQTFTDPVIVKRLARKSQLGEAFKFDRDRYKSDGVFRSSPRAWFTYAHLCFGLL
FT                   FLFGHWWHAARTLFGDRFSGIDPELGDQVEFGLFKKLGDESTRRVPGRA"
FT   gene            374990..375112
FT                   /locus_tag="NATL1_04061"
FT   CDS_pept        374990..375112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04061"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74970"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0G0"
FT                   /protein_id="ABM74970.1"
FT                   /translation="MRIDSLRLEKIKKKRKRRIFRISIDFVILGRFRIKLILKN"
FT   gene            375320..375478
FT                   /gene="psbM"
FT                   /locus_tag="NATL1_04071"
FT   CDS_pept        375320..375478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbM"
FT                   /locus_tag="NATL1_04071"
FT                   /product="possible Photosystem II reaction center M protein
FT                   (PsbM)"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74971"
FT                   /db_xref="GOA:A2C0G1"
FT                   /db_xref="InterPro:IPR007826"
FT                   /db_xref="InterPro:IPR037269"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0G1"
FT                   /protein_id="ABM74971.1"
FT                   /translation="METTSFGFAASLLFVGVPTIFLIGLFVSTSDGEKSSFYSDTSKGR
FT                   LSPEPKK"
FT   gene            375613..376053
FT                   /locus_tag="NATL1_04081"
FT   CDS_pept        375613..376053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04081"
FT                   /product="Predicted thioesterase"
FT                   /note="COG824 Predicted thioesterase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74972"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0G2"
FT                   /protein_id="ABM74972.1"
FT                   /translation="MSSTNNRWRLTKTVLPQHTDHAGVMWHGSYLNFLEEGRIDALDKI
FT                   GHSYPKLSEKGFEIPVVSIQLRYKISFIHGEKILLESQFKLENKVRLTCKTLFLKSNGD
FT                   IGAEAMIGLVVVRKTNESIKLVRELPVQIKNILLMLEEGPKF"
FT   gene            376120..376941
FT                   /gene="hemK"
FT                   /locus_tag="NATL1_04091"
FT   CDS_pept        376120..376941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="NATL1_04091"
FT                   /product="putative protein methyltransferase"
FT                   /EC_number="1.3.3.4"
FT                   /note="COG2890 Methylase of polypeptide chain release
FT                   factors [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74973"
FT                   /db_xref="GOA:A2C0G3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0G3"
FT                   /protein_id="ABM74973.1"
FT                   /translation="MILIGGRKVDFDWLLDMVAGVSWAKLQSIILNPEKFISLDISTDE
FT                   LEVIWKSHLKDQTPLQYLISKCPWRDVELEVSAEALIPRQETEFLIDIALKKITNFDSG
FT                   RWADLGTGSGAIAVSLAKSLPNWNGHAVDISNEALELAKRNLKAIVPNANVRFSLGDWW
FT                   EPLKRWRGRFDLVLSNPPYIPSDLVEELEPVVKNHEPIIALDGGEDGMNASRKIILGAL
FT                   NGLAKGGWLILEHHYDQSEKITSFMRNIGMEEVSFEKDISGIKRYAICRRK"
FT   gene            376919..377518
FT                   /gene="sua5"
FT                   /locus_tag="NATL1_04101"
FT   CDS_pept        376919..377518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sua5"
FT                   /locus_tag="NATL1_04101"
FT                   /product="Putative translation factor (SUA5)"
FT                   /note="COG9 Putative translation factor (SUA5)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74974"
FT                   /db_xref="GOA:A2C0G4"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0G4"
FT                   /protein_id="ABM74974.1"
FT                   /translation="MQFVAENEMITQQFGIFDLALKLKKGSLALFPTDTLPALCSYPKY
FT                   SKKIWTIKKRPSSKPLILMGGCSDDLFEFVHPCALEESLQLAKIYWPGALTMVLPTIGN
FT                   FSKYLNGNSNAVGFRVPALRIARDLLMQTGPLATTSANISGETPVKDAMEASIQFPEIP
FT                   ILAPIPWPSSSGMASTVVEWKNGKWNLLRPGSVVLK"
FT   gene            377528..377686
FT                   /locus_tag="NATL1_04111"
FT   CDS_pept        377528..377686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04111"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74975"
FT                   /db_xref="GOA:A2C0G5"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0G5"
FT                   /protein_id="ABM74975.1"
FT                   /translation="MIYLFLMVLIVQSIFWWLFRLPIMSFDWIFQLKFFNLFIAAFLIW
FT                   IISGKSK"
FT   gene            complement(377710..377781)
FT                   /locus_tag="NATL1_tRNAThrVIMSS1309180"
FT                   /note="tRNA-Thr"
FT   tRNA            complement(377710..377781)
FT                   /locus_tag="NATL1_tRNAThrVIMSS1309180"
FT                   /product="tRNA-Thr"
FT   gene            complement(377904..378251)
FT                   /gene="minE"
FT                   /locus_tag="NATL1_04121"
FT   CDS_pept        complement(377904..378251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="NATL1_04121"
FT                   /product="possible septum site-determining protein MinE"
FT                   /note="COG851 Septum formation topological specificity
FT                   factor [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74976"
FT                   /db_xref="GOA:A2C0G6"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0G6"
FT                   /protein_id="ABM74976.1"
FT                   /translation="MAMTLRDIINKLLRRQPASASTARERLQLVLAHDRSDLSTELLDQ
FT                   MRKEILEVVAKYVEIDVDEGAVSLETEDRMTALVANLPIKRTITGQIQLKEPKNQSELD
FT                   SPETEGTDQKS"
FT   gene            complement(378256..379071)
FT                   /gene="minD"
FT                   /locus_tag="NATL1_04131"
FT   CDS_pept        complement(378256..379071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="NATL1_04131"
FT                   /product="putative septum site-determining protein MinD"
FT                   /note="COG2894 Septum formation inhibitor-activating ATPase
FT                   [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74977"
FT                   /db_xref="GOA:A2C0G7"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0G7"
FT                   /protein_id="ABM74977.1"
FT                   /translation="MATDTRVILICSGKGGVGKTTLTANLGISLARQGLTTAVLDADFG
FT                   LRNLDLLLGLENRIVYTAQEVLEEECRLDQALVKHKQESNLSLLPAGNPRMLDWLKPDD
FT                   MKRIVDMLKEQFNFVLIDCPAGVEDGFKNAMAASQEAIVVTNPEVSAVRDADRVIGLLN
FT                   TNSIKPVQLVLNRVRPKMMANQEMLSIDDVTDILALPLLGLVLEDEQVIVSTNRGEPLT
FT                   LNSVNSPAAKCYLNIAKRLQGEDIPLIDPAEEISGFGAKFRRLMQTKIF"
FT   gene            complement(379235..379879)
FT                   /gene="minC"
FT                   /locus_tag="NATL1_04141"
FT   CDS_pept        complement(379235..379879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="NATL1_04141"
FT                   /product="possible septum site-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74978"
FT                   /db_xref="GOA:A2C0G8"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0G8"
FT                   /protein_id="ABM74978.1"
FT                   /translation="MNSKSQKIIINIEGRNHPNWKIDLKNKLKILKSNNLEIDAQNIDL
FT                   SCKEILEIIEIANQYNCKIICFCSSSPKTIVSSQSLGYKSQFIESSSKNTSEINKKNPT
FT                   FSKTHFHQGTVRSGEYIESPGDLLILGDVNPGANVSAEGNIIIWGKLLGIAHAGNKGNS
FT                   KAKISALQLSPVQLRIAKKVARGPKEKPQFGLAEQARIDSEEIIISPLETT"
FT   gene            complement(379882..381141)
FT                   /locus_tag="NATL1_04151"
FT   CDS_pept        complement(379882..381141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04151"
FT                   /product="HD superfamily phosphohydrolases"
FT                   /note="COG1078 HD superfamily phosphohydrolases [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74979"
FT                   /db_xref="GOA:A2C0G9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0G9"
FT                   /protein_id="ABM74979.1"
FT                   /translation="MSSRTYYDPLHQSITLNSSIPEEKMVMELIDSSPFQRLRRIKQLG
FT                   PAYLTFHGAESSRFTHSLGVFHLARRAINHLLNVDSGLKEHKFTIYGAALLHDLGHGPL
FT                   SHTSEEIFKIKHESWTAKLINSSKEITTILNKYGKGNAKAISDLIQSRKAEKKSIISLI
FT                   SSQLDCDRLDYLMRDSYTTGARYGQLDIDRIISAMTISPDGDLAIHPKGLMAVEHYLVI
FT                   RNLMYRSVYNHRLNEVCNWLLEQIIKTARKIGPQSLWADKSMSEWLWNHEKMSLESFLS
FT                   NDDIVTGYHIHRWQDCSSNNLSNLCKRFIHRNLLKALNLSSFTLETRLESLAKARKLSE
FT                   KYCLEPDISCGLREQVVKSYHPYKHGLRLWDGDKLQALERVSPLVDRLIQPNQSSWLIY
FT                   PKEIEIELKIEIEKLKMKYN"
FT   gene            complement(381145..382518)
FT                   /locus_tag="NATL1_04161"
FT   CDS_pept        complement(381145..382518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04161"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="COG793 Periplasmic protease [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74980"
FT                   /db_xref="GOA:A2C0H0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0H0"
FT                   /protein_id="ABM74980.1"
FT                   /translation="MHCTFKYLTRCAPWSPQKINPMLSTVKSLTKPLQRLFAVLISFGI
FT                   LFQVFTQPAFALNDGQLLVIEAWNQVNAGYLDPKKFDEIQWKKLRQKALEKPINNSQQA
FT                   YSAIEAMLLPLGDPYTRLLRPVDYEAMKKSNIGSEINGVGLQLGARKEDGDIVVISPLE
FT                   GSPASDAGITSGTIIKKVNGQSPKQLGLEATAAKLRGQTGTQVIVELEQPDNEIKEISL
FT                   ERRSVDLRPVRTKRIRNESHTFGYLRITQFSEGVPEQVKEALEELSGKEIDGLILDLRN
FT                   NSGGLVSSGLAVADDFLSNMPIVETKKRDSINDPISSGLETIYDGPMVTLVNEGTASAS
FT                   EILAGALQDNKRSELIGNKTFGKGLIQSLTNLSDGSGLAVTVASYLTPSGRDIQNLGIE
FT                   PDRLLEMPEPLNPGSDDDRWLLDAELIMQATLDKEEVSEKLSKETLVKEEQLISQEIE"
FT   gene            382525..383181
FT                   /gene="petB"
FT                   /locus_tag="NATL1_04171"
FT   CDS_pept        382525..383181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="NATL1_04171"
FT                   /product="Cytochrome b6"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74981"
FT                   /db_xref="GOA:A2C0H1"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR023530"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0H1"
FT                   /protein_id="ABM74981.1"
FT                   /translation="MANSSPVYDWFQERLEIQDIADDVTSKYVPPHVNIFYCLGGITLV
FT                   CFLIQFATGFAMTFYYKPTVTEAYSSVSYLMTDVSFGWLIRSVHRWSASMMVLMLILHV
FT                   FRVYLTGGFKRPRELTWITGVVMAVITVAFGVTGYSLPWDQVGYWAVKIVSGVPAAIPV
FT                   IGDFMVELLRGGESVGQSTLTRFYSLHTFVMPWLLAVFMLMHFLMIRKQGISGPL"
FT   gene            383240..383722
FT                   /gene="petD"
FT                   /locus_tag="NATL1_04181"
FT   CDS_pept        383240..383722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petD"
FT                   /locus_tag="NATL1_04181"
FT                   /product="PetD protein (subunit IV of the Cytochrome b6f
FT                   complex)"
FT                   /EC_number="1.10.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74982"
FT                   /db_xref="GOA:A2C0H2"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR005870"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0H2"
FT                   /protein_id="ABM74982.1"
FT                   /translation="MSTLKKPDLTDTKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIL
FT                   GTIACVVGLAVLDPAFLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLI
FT                   PLGLMILPFIENINKFANPFRRPVAMSLFLFGTVLTMYLGIGACLPIDKSLTLGLF"
FT   gene            complement(383719..385170)
FT                   /locus_tag="NATL1_04191"
FT   CDS_pept        complement(383719..385170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04191"
FT                   /product="putative neutral invertase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74983"
FT                   /db_xref="GOA:A2C0H3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0H3"
FT                   /protein_id="ABM74983.1"
FT                   /translation="MPARFSQQNQRVRPNSNEDKVVARAKEHFEKTLIQISGDIAGSVA
FT                   ALEHPTKNDALNYGEIFLRDNVPVMIYLLTQKRYDIVKKFLTVSLDLQSTTYQTRGVFP
FT                   TSFVEEKGKLIADYGQRSIGRITSADASLWWPVLCWLYVRKSGDQSFGTSQQVQRGVQL
FT                   LLDLVLHPTFEGNPVLFVPDCSFMIDRPMDVWGAPLEVEVLLHASLKSCIQLMELSRKH
FT                   QKSRLLDQRLVLTRQWVHDLRQFLLKHYWVTSKTMQVLRRRPTEQYGEDQHQNEFNVQP
FT                   QVVPSWLQDWLENRGGYLIGNIRTGRPDFRFYSLGNSLACMFGVLTAPQQRALFRLVLH
FT                   NREHLMAQMPMRICHPPMDVEEWQNKTGSDPKNWPWSYHNGGHWPSLLWFFGASILLHE
FT                   KRYPKADVLLMGQMRALIEECYWSQLNQLPRQKWAEYFDGPTGTWVGQQSRTYQTWTIV
FT                   GFLLMHHLLRAEPDDVLMLDLEEEF"
FT   gene            385837..387301
FT                   /locus_tag="NATL1_rrsVIMSS1309404"
FT   rRNA            385837..387301
FT                   /locus_tag="NATL1_rrsVIMSS1309404"
FT                   /product="16S ribosomal RNA"
FT   gene            387469..387542
FT                   /locus_tag="NATL1_tRNAIleVIMSS1309203"
FT                   /note="tRNA-Ile"
FT   tRNA            387469..387542
FT                   /locus_tag="NATL1_tRNAIleVIMSS1309203"
FT                   /product="tRNA-Ile"
FT   gene            387552..387624
FT                   /locus_tag="NATL1_tRNAAlaVIMSS1309204"
FT                   /note="tRNA-Ala"
FT   tRNA            387552..387624
FT                   /locus_tag="NATL1_tRNAAlaVIMSS1309204"
FT                   /product="tRNA-Ala"
FT   gene            387935..390808
FT                   /locus_tag="NATL1_rrlVIMSS1365723"
FT   rRNA            387935..390808
FT                   /locus_tag="NATL1_rrlVIMSS1365723"
FT                   /product="23S ribosomal RNA"
FT   gene            390899..391015
FT                   /gene="rrf"
FT                   /locus_tag="NATL1_rrfVIMSS1309405"
FT   rRNA            390899..391015
FT                   /gene="rrf"
FT                   /locus_tag="NATL1_rrfVIMSS1309405"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(391064..391912)
FT                   /gene="mutM"
FT                   /locus_tag="NATL1_04201"
FT   CDS_pept        complement(391064..391912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="NATL1_04201"
FT                   /product="Formamidopyrimidine-DNA glycolase (FAPY-DNA
FT                   glycolase)"
FT                   /EC_number="3.2.2.23"
FT                   /note="COG266 Formamidopyrimidine-DNA glycosylase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74984"
FT                   /db_xref="GOA:A2C0H4"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0H4"
FT                   /protein_id="ABM74984.1"
FT                   /translation="MPELPEVETVRKGLEKLLNDFYIERIEVLKERSIASNGGSKSFID
FT                   NVKNSYLGNWERRGKYLIGSLLTKEKFSKGFLVVHLRMTGQFKLLEKEVLACKHTRVRF
FT                   FEERGRELRFIDIRNFGQMWHVPSSRSVPEIVSGIKRLGPEPFSDDFNSHYLEEYLKKK
FT                   TRSIKSALLDQRTVAGVGNIYADETLFDAGINPKTESRNLKSNELKRLCNSLIKILNIS
FT                   IGEGGTTFSDFRDLEGGNGNYGGQALVYRRSGKNCKKCGEKILREKICGRSTHWCPNCQ
FT                   K"
FT   gene            complement(391927..392145)
FT                   /gene="psaE"
FT                   /locus_tag="NATL1_04211"
FT   CDS_pept        complement(391927..392145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaE"
FT                   /locus_tag="NATL1_04211"
FT                   /product="Photosystem I PsaE protein (subunit IV)"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74985"
FT                   /db_xref="GOA:A2C0H5"
FT                   /db_xref="InterPro:IPR003375"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0H5"
FT                   /protein_id="ABM74985.1"
FT                   /translation="MSFARKDKVRILRQESYWFNQIGEIVSIDKSPLMRYPVTVKFDKC
FT                   DFKAFSGVDGGANTSQFSVKELEAAAS"
FT   gene            392348..393397
FT                   /locus_tag="NATL1_04221"
FT   CDS_pept        392348..393397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04221"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74986"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0H6"
FT                   /protein_id="ABM74986.1"
FT                   /translation="MIPQPSLDPSSLSFDLPDPDQDDLSNIDFIKRLENAWSICEQFDL
FT                   QTEIWRGRILRVVRDREKRGGDGRGTGFLQWLREMEISKSKAYSLIQLADSSDNLVVDG
FT                   ILEEASVNNFSKRAFIETAQAEPEIQHMISEAANEGRDITRRQVKSLTDQFMAATSTLL
FT                   PDEIREKTQSNLLPAKFVAPLVRELSKLTPIQQEEICETLRENPEIESVKDMTNTAKWM
FT                   GKSLDASLALRAFQNKNLNLDKATQEALRLDSLGLLSDAFGQAKTIESSILKFHSAWKR
FT                   LEGLQERLWVESGSSTPYLRELLDTLQTLTGSTIRVSLGELSGGKRLRLQLVEEDSERL
FT                   EPPSLEINK"
FT   gene            complement(393399..394259)
FT                   /locus_tag="NATL1_04231"
FT   CDS_pept        complement(393399..394259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04231"
FT                   /product="possible LysM domain"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74987"
FT                   /db_xref="GOA:A2C0H7"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0H7"
FT                   /protein_id="ABM74987.1"
FT                   /translation="MIKNIKTPIGLFYINSIIFLLSIFPLKVNSETKIVAKSGDTLFKI
FT                   SKQYGVTLKELMYKNNFNDATKIIEGEVILIPNSGIVKYKKSEHITYKVIEGDTLYKIS
FT                   RDHNVSLNDIISMNNLRKDSYLNVNQIIFLPKGAKYNKAISIENIKVASKKVFYHKTTK
FT                   TEDLSTIAYLHKIPIEQVKTLNKLNDPIKIKPNIKLKLRKDKPLKWIKYGSLMINWSDW
FT                   TYFDGNYIAQSKTKKNKTFYLALSCKKRVLNNTLNNSYWTTWYFPETDFEFKLINDFCD
FT                   QDFNF"
FT   gene            complement(394304..395683)
FT                   /locus_tag="NATL1_04241"
FT   CDS_pept        complement(394304..395683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04241"
FT                   /product="Putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /EC_number="1.2.1.3"
FT                   /EC_number="1.2.1.39"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74988"
FT                   /db_xref="GOA:A2C0H8"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0H8"
FT                   /protein_id="ABM74988.1"
FT                   /translation="MSLENFVLNQLQDLVLSGKTRNEKWRRAQLKSLSNLLENHQQEIL
FT                   KALSQDLGKPATEAFFEIIAVKQEIKLAQKSLSNWMKTRQINVPVSLKPAQALVQPDPL
FT                   GCILIIGPWNYPFSLTLQPLVGALAAGNTAVLKPSEHAPNVSNLIKKLIEEYFPPEIVQ
FT                   VFEGDGNIAADLMTRQFDHVFFTGGENIGKKVMEAASKNLTPVTLELGGKSPAVVIDGA
FT                   NLEVTAKRVIWGKSLNAGQTCIAPDHLLVENKLFDSLISNLINSINDFYGNTPLDSKHL
FT                   GSIINEKQFNRLNNLLTQAKKNNQIIYGGDSNEKEKRISPTLIKIDNRNDPLMKEELFG
FT                   PLLPILSIKNLDQAISDFKLLPKPLALYLFGGGEKEQGKVLSMTSSGGVCFNDVVLQAG
FT                   IPELPFGGVGTSGMGKYHGKAGFDNFTHYKSVLKRPFWLDLNFRYPPYKLDLSLLNKLI
FT                   G"
FT   gene            395892..396215
FT                   /locus_tag="NATL1_04251"
FT   CDS_pept        395892..396215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04251"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74989"
FT                   /db_xref="GOA:A2C0H9"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0H9"
FT                   /protein_id="ABM74989.1"
FT                   /translation="MSIIYELLFLCIGPKITIPTSERLINHLLVVIVFSLAFIGVAEVM
FT                   YWLYKKEYLRAKAKYLRELIDQKNDLSSLNEPFYACVYEKWNSGEMPLTEANTMCSLKF
FT                   EHN"
FT   gene            396294..397043
FT                   /locus_tag="NATL1_04261"
FT   CDS_pept        396294..397043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04261"
FT                   /product="Hypothetical protein"
FT                   /note="COG398 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74990"
FT                   /db_xref="GOA:A2C0I0"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0I0"
FT                   /protein_id="ABM74990.1"
FT                   /translation="MTNKFIISKYFSYVIIIFFVVILIITFIHLDVNIIADFFYGIVSG
FT                   LNTNNFFSLILIFLLFILRSTSIIIPVLPGTIFSATAGFQFGFTQGLVIIFFADFFSCS
FT                   ISFLLARKLGRKYITRLLGSRQMRRVESISQDYLENNYFLMTALLMSGFFDFVCYAIGL
FT                   TKVTWKRFMPALIFSIIISDSPFVASGVAARKIKDIGLKNFLQKILNGELDTISGNYLF
FT                   LFITSFLIIFTLAMINIYLQKKSNIIK"
FT   gene            complement(397561..397767)
FT                   /locus_tag="NATL1_04271"
FT   CDS_pept        complement(397561..397767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04271"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74991"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0I1"
FT                   /protein_id="ABM74991.1"
FT                   /translation="MPLLLIGANNSPTCINFRRKDMSKKKEKFNVTQGMTLLLLKKISL
FT                   PSNLVFQIILFITNPENNIGYED"
FT   gene            complement(397945..398205)
FT                   /locus_tag="NATL1_04281"
FT   CDS_pept        complement(397945..398205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04281"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74992"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0I2"
FT                   /protein_id="ABM74992.1"
FT                   /translation="MRSRVNQFNTKSDGLEGGKQTLSYFLRGISMTRKRDKVWTAIIAT
FT                   RQWFSKLFTSEADALVDDFGNNPPPEIGTQSYSGDTHDKGD"
FT   gene            399182..399553
FT                   /locus_tag="NATL1_04291"
FT   CDS_pept        399182..399553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04291"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74993"
FT                   /db_xref="InterPro:IPR012447"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0I3"
FT                   /protein_id="ABM74993.1"
FT                   /translation="MLNSIFVSVESPSQRAKKPPVSRWFLFSLIRRMNQPVREALPTPA
FT                   GWLVAPARDFCLFFIRDPKSVMVAPTVLTQLWYCTEQGIPTQLKNTRRLDYESAHETWN
FT                   ELLSNDWELVEHQINDAAA"
FT   gene            399894..400184
FT                   /locus_tag="NATL1_04301"
FT   CDS_pept        399894..400184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04301"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74994"
FT                   /db_xref="InterPro:IPR024525"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0I4"
FT                   /protein_id="ABM74994.1"
FT                   /translation="MAIRPSGNPITAKGLAGMYNSDDLVIELSELVKIHRLEANSDWGF
FT                   TAFTLKEAFSYKGDLNNDLSTYSLIFKKIDGIWKIAWMQRSQGTTDISTWD"
FT   gene            complement(400218..400499)
FT                   /locus_tag="NATL1_04311"
FT   CDS_pept        complement(400218..400499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04311"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74995"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0I5"
FT                   /protein_id="ABM74995.1"
FT                   /translation="MSSEPDNLQTLISKYRTMDIYELEANIDNWNKENDCPIQTQCLVI
FT                   AKNELEIKYKERQEQIELLTKSLTSSSRAGRWVSSVKAVIKQLLKFKK"
FT   gene            400771..400977
FT                   /locus_tag="NATL1_04321"
FT   CDS_pept        400771..400977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04321"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74996"
FT                   /db_xref="GOA:A2C0I6"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0I6"
FT                   /protein_id="ABM74996.1"
FT                   /translation="MTSSTSSQVITEYGKQNIFGRETQPQLVEDYTSYPEEAEKTNGRW
FT                   AMIGMVSLLVSYFTTGQIIPGIF"
FT   gene            400998..401117
FT                   /locus_tag="NATL1_04331"
FT   CDS_pept        400998..401117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04331"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74997"
FT                   /db_xref="GOA:A2C0I7"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0I7"
FT                   /protein_id="ABM74997.1"
FT                   /translation="MQPSNKTILERSIGRPAMMAFVLLTGIYLTTGQLIPGVV"
FT   gene            401117..401263
FT                   /locus_tag="NATL1_04341"
FT   CDS_pept        401117..401263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04341"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74998"
FT                   /db_xref="GOA:A2C0I8"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0I8"
FT                   /protein_id="ABM74998.1"
FT                   /translation="MKNQTTETPRVEEGKVIAERLNGYAAFVGCWALIGAYLTTGQIIP
FT                   GVV"
FT   gene            401263..401412
FT                   /locus_tag="NATL1_04351"
FT   CDS_pept        401263..401412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04351"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM74999"
FT                   /db_xref="GOA:A2C0I9"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0I9"
FT                   /protein_id="ABM74999.1"
FT                   /translation="MTTQNNNNSRNIDPEKVTAERLNGYAALFGCIALVGAYATTGQII
FT                   PGFV"
FT   gene            401412..401537
FT                   /locus_tag="NATL1_04361"
FT   CDS_pept        401412..401537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04361"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75000"
FT                   /db_xref="GOA:A2C0J0"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0J0"
FT                   /protein_id="ABM75000.1"
FT                   /translation="MNKETNYWKTAEQMNGRLAMMGFFAAVINYGLTGWIIPGIV"
FT   gene            401972..402085
FT                   /locus_tag="NATL1_04371"
FT   CDS_pept        401972..402085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04371"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75001"
FT                   /db_xref="GOA:A2C0J1"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0J1"
FT                   /protein_id="ABM75001.1"
FT                   /translation="MIFPPPQVVFGLLLLSIAATLIFNVRYNPFGNSEDDI"
FT   gene            complement(402169..402240)
FT                   /locus_tag="NATL1_tRNAThrVIMSS1309202"
FT                   /note="tRNA-Thr"
FT   tRNA            complement(402169..402240)
FT                   /locus_tag="NATL1_tRNAThrVIMSS1309202"
FT                   /product="tRNA-Thr"
FT   gene            complement(402252..402333)
FT                   /locus_tag="NATL1_tRNATyrVIMSS1309201"
FT                   /note="tRNA-Tyr"
FT   tRNA            complement(402252..402333)
FT                   /locus_tag="NATL1_tRNATyrVIMSS1309201"
FT                   /product="tRNA-Tyr"
FT   gene            402442..402879
FT                   /gene="aroQ"
FT                   /locus_tag="NATL1_04381"
FT   CDS_pept        402442..402879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="NATL1_04381"
FT                   /product="Dehydroquinase class II"
FT                   /EC_number="4.2.1.10"
FT                   /note="COG757 3-dehydroquinate dehydratase II [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75002"
FT                   /db_xref="GOA:A2C0J2"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0J2"
FT                   /protein_id="ABM75002.1"
FT                   /translation="MDLLLINGPNLNLVGKREPSIYGSQTLEDIQEELLTLANELGANL
FT                   KFFQSNSEGEMIDCIQNSVGSIDGILINAGAYTHTSIALRDALLGVAIPYVEVHLSNIY
FT                   SREEFRHKSFLSDKALGLVCGFGANSYQLALEGIVSYLKRV"
FT   gene            402887..403501
FT                   /gene="miaE"
FT                   /locus_tag="NATL1_04391"
FT   CDS_pept        402887..403501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaE"
FT                   /locus_tag="NATL1_04391"
FT                   /product="putative tRNA-(MS[2]IO[6]A)-hydroxylase-like
FT                   protein"
FT                   /note="COG4445 Hydroxylase for synthesis of
FT                   2-methylthio-cis-ribozeatin in tRNA [Nucleotide transport
FT                   and metabolism / Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75003"
FT                   /db_xref="GOA:A2C0J3"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0J3"
FT                   /protein_id="ABM75003.1"
FT                   /translation="MDNSISQIAGPSKIRWLINKTSEDWVDLAISNPMEILLDHAHCER
FT                   KAAGVALQLMFRYVSEPGLSEVLSPLAREELEHFERVLSILNTRGKKLQKLASPPYGAT
FT                   LAKNICKDEPLRMLDSFLVAGLIEARSHERMKLLSIHSPDIELRNLYADLLKSEARHFG
FT                   IYWKLADERFERNLLTSRLEELAKVESDALLEMHHLPRMHS"
FT   gene            403538..404266
FT                   /gene="cobI"
FT                   /gene_synonym="cbiL"
FT                   /locus_tag="NATL1_04401"
FT   CDS_pept        403538..404266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobI"
FT                   /gene_synonym="cbiL"
FT                   /locus_tag="NATL1_04401"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /note="COG2243 Precorrin-2 methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75004"
FT                   /db_xref="GOA:A2C0J4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0J4"
FT                   /protein_id="ABM75004.1"
FT                   /translation="MKVLTIAGVGPGDPSLLTLAAVDAIQESTVVSYPVSTRGGASLAE
FT                   KIASKWITKDKKKLPLHFPMVDDQNTLKSAWRVAGRELMKMVDKGERVVFLAQGDISLF
FT                   STGSYLSKELEKYHPECVVKLIPGVTSFSAAAAKSKLPLAFQEEELLVLPVPDSYDELK
FT                   SILSDAESKKRVVVLLKLGKKWEWVKLLLEELDLIKISIFAERIGFSDQQILRASDLPS
FT                   GTRPYFSLLLIRQSWPLTMP"
FT   gene            complement(404273..405265)
FT                   /locus_tag="NATL1_04411"
FT   CDS_pept        complement(404273..405265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04411"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /note="COG42 tRNA-dihydrouridine synthase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75005"
FT                   /db_xref="GOA:A2C0J5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0J5"
FT                   /protein_id="ABM75005.1"
FT                   /translation="MKEFSPICLSGNGTPRSIECLVIQSPLAGVSDQIFRNFVRRWSPK
FT                   ALLFTEMVNAKSLELGHGEEKVIELSEESGPIGVQLFDHRPDSMVDAAIKAESSGAFLI
FT                   DINMGCPVKKIARKGGGSALLKEPELAQLIVKKVSKAISIPVTVKIRLGWCETTSDPVS
FT                   FALGLQEAGAQLITVHGRTRRQGFSGHSNWKAIAQIKKSLDIPVIANGDIKNSRDAIEC
FT                   LKITNADGVMIGRASMGAPWLVGQIDEEIKNQTTFKPPDAKMKVSLSLEHLKLLVSKKG
FT                   SHGLLIARKHMNWTCRGFEGASTLRHKLVRASTPNDAIKLLEDELIKFN"
FT   gene            complement(405290..405568)
FT                   /locus_tag="NATL1_04421"
FT   CDS_pept        complement(405290..405568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04421"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75006"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0J6"
FT                   /protein_id="ABM75006.1"
FT                   /translation="MTLYRSKLRLILHTTSMSKEFDSKMKFRNQTSLKRLTKKNRDSST
FT                   TKPSLIAILLVLIAFLQVPISLKASINIFCLFSEISETDKTFSLCNY"
FT   gene            405593..406963
FT                   /locus_tag="NATL1_04431"
FT   CDS_pept        405593..406963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04431"
FT                   /product="GTP-binding protein (HSR1-related)"
FT                   /EC_number="1.1.1.95"
FT                   /note="COG1160 Predicted GTPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75007"
FT                   /db_xref="GOA:A2C0J7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0J7"
FT                   /protein_id="ABM75007.1"
FT                   /translation="MALPVVAIIGRPNVGKSTLVNRLCQSREAIVHDEPGVTRDRTYQD
FT                   GFWRDRDFKVVDTGGLVFDDDSEFLPEIREQANLALEEAVVALVIVDGQEGITTADESI
FT                   AEFLRSRSCKTLVVVNKCESPEQGLAMAAEFWKLGLGEPYPISAIHGVGTGDLLDQVVN
FT                   LFPSKDLDEVSDSPVQLAIIGRPNVGKSSLLNSICGETRAIVSSIRGTTRDTIDTRITH
FT                   QGKEWKLVDTAGIRRRRSVNYGPEFFGINRSFKAIERSDVCVLVIDALDGVTEQDQRLA
FT                   GRIEQEGRACLIVINKWDAVEKDSHTMSAMEKDIRSKLYFLDWAQMIFTSAVTGQRVEG
FT                   IFALATLAVDQSRRRVTTSVVNEVLTEALKWRSPPTTRGGKQGRLYYGTQVAINPPSFT
FT                   LFVNEPKLFGETYRRYIERQIREGLGFEGTPIKLFWRGKQQRDVEKDMARQQKGVQN"
FT   gene            406973..407887
FT                   /gene="cbiQ"
FT                   /locus_tag="NATL1_04441"
FT   CDS_pept        406973..407887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="NATL1_04441"
FT                   /product="possible cobalt transport protein"
FT                   /note="COG619 ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters [Inorganic ion
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75008"
FT                   /db_xref="GOA:A2C0J8"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0J8"
FT                   /protein_id="ABM75008.1"
FT                   /translation="MDWLKKIPIGQYVSGKSSWLRGIDPRIKLSWILLFLLTPILANSL
FT                   WRISIAFVLLLITFLSFLPPRIWWRSLVFLLAFSLVIGSLSIVLPASQSSFALPIRASN
FT                   EIPGAIILSRSWEIFRLGPIDFGGISLGPLIIDRRSAELGIKTSTLIFTVIHSVNLILI
FT                   TTPPEDLVWAIRWFFAPLTLLGFPLEKLSFQLLLALRFLPLVQEELQNLFRSIGVRAID
FT                   FKKLGLKSSLGLFVTLGERLLSNILLRAEQGADSLMSRQGLWLSSEQLRPNIVINPKYL
FT                   WINISSIFLLLIAISLRCLYGTS"
FT   gene            407943..408170
FT                   /locus_tag="NATL1_04451"
FT   CDS_pept        407943..408170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75009"
FT                   /db_xref="InterPro:IPR021926"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0J9"
FT                   /protein_id="ABM75009.1"
FT                   /translation="MLYLVSPASNGRDVYATLYAQKIFFLVTLQPRGATFEVIPYMDAR
FT                   HYSEMHLAKCRREKSSDMDVWQELFNQTFM"
FT   gene            408182..408823
FT                   /locus_tag="NATL1_04461"
FT   CDS_pept        408182..408823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04461"
FT                   /product="Predicted enzyme with a TIM-barrel fold"
FT                   /note="COG325 Predicted enzyme with a TIM-barrel fold
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75010"
FT                   /db_xref="GOA:A2C0K0"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0K0"
FT                   /protein_id="ABM75010.1"
FT                   /translation="MILTGSNEFKKIKDSIPLGVNLLAVSKGHKHDSIRKLYGYGQLDF
FT                   GESRLQEAILKKIDLSDLTQLRWHFVGTLQKNKVRRVIKEFDFIHSVDSLPLLERISRI
FT                   SQEEQKSPNIFLQVKFIEDPNKGGFLKEELLKSWSNIISLKNINLIGLMTIPPIVLNSF
FT                   QRKDLFCECRNFANHLGLKDCSMGMSNDWQEAIQGGATWIRLGSLLFGKR"
FT   gene            408985..409560
FT                   /locus_tag="NATL1_04471"
FT   CDS_pept        408985..409560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04471"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG1799 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75011"
FT                   /db_xref="GOA:A2C0K1"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0K1"
FT                   /protein_id="ABM75011.1"
FT                   /translation="MSLISRLRAVVAGDDFLDSDFDELEYDSSDDFENFNRGNKEGSTE
FT                   MATISQANPFDGRSGFPPSNVIGMPGISTNDSEVSLMEPRSFDEMPRVIQALRERKTVI
FT                   LNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFAPSCVTVTNSFQEEASPSNM
FT                   SNKGNDLISKETSPAPEPAWGETVATAL"
FT   gene            409574..410416
FT                   /gene="proC"
FT                   /locus_tag="NATL1_04481"
FT   CDS_pept        409574..410416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="NATL1_04481"
FT                   /product="Delta 1-pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="COG345 Pyrroline-5-carboxylate reductase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75012"
FT                   /db_xref="GOA:A2C0K2"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0K2"
FT                   /protein_id="ABM75012.1"
FT                   /translation="MEISLGIIGLGSMAKAIVLPLLERGEYNPQQVLGIVGRSSSIASA
FT                   LNDLPQEVKVVTSKDPLSKEVWKAPIKILAVKPQQLSKIKESVSSFQSNDQFPKPLLIS
FT                   VLAGITLKSLKKAFPRHTCVRAVPNTPSLVGQGLTGLAWPDDMTSDQKKVVRKIFEPIS
FT                   EIYELEEPKLDSFLALTSSGPAYIALVVEAMADGAVAAGLPRQLSNQLAHRTLSGTASL
FT                   LREKNLHPAELKDMVASPAGTTISALRHLELSGLRSALIEAVVLAAQKSRQLAEEVST"
FT   gene            complement(410307..411581)
FT                   /locus_tag="NATL1_04491"
FT   CDS_pept        complement(410307..411581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04491"
FT                   /product="possible Glycosyl transferase, group 1"
FT                   /note="COG438 Glycosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75013"
FT                   /db_xref="GOA:A2C0K3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0K3"
FT                   /protein_id="ABM75013.1"
FT                   /translation="MTHIAWLGKKTPFCGNVCYGLTTTEELRERGYQTSFIHFDNPMRD
FT                   GNNKTSLLANDPDVSLPYLIKSQVYTIPSLNAQRELRESLSRLKPDLVHASLTLSPLDF
FT                   RLPELCHQLNLPLIATFHPAFDSKLRNLTANTQQLTYQLYAPSLAKYDKVIVFSDLQAE
FT                   VLAKLGVKESRLEVIPNGIDIKKWNTLKPNNSQNELHFEIKKKLGSERIFIYMGRIASE
FT                   KNVEALLRAWRFVQPKGCRLVIVGDGPLRPTLENHSIFNKEDNVFWWGYEADQNKRVAL
FT                   LQIAEVFLLPSLVEGLSIALLEAMATGTACVATDAGADGEVLENGAGIILNTEGVTSQL
FT                   RTLLPVLHDQPVLTHELGRRARLRVEEKYTLQQNIDSLENLYANVLRSSRSKLPQPIDD
FT                   SSALPKQLLQLRRISSQKVQGVEEH"
FT   gene            complement(411712..412491)
FT                   /gene="recO"
FT                   /locus_tag="NATL1_04501"
FT   CDS_pept        complement(411712..412491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="NATL1_04501"
FT                   /product="possible Recombination protein O (RecO)"
FT                   /note="COG1381 Recombinational DNA repair protein (RecF
FT                   pathway) [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75014"
FT                   /db_xref="GOA:A2C0K4"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0K4"
FT                   /protein_id="ABM75014.1"
FT                   /translation="MKGLSLKVGPLGENDRLLTILSEESGISRLAIPGARKPKSRLGAT
FT                   SPFNLLDLHIVGKKDLKKVTQIKIIKSYGNLGKNIETLSAAQAISELILIMVGNEDPQK
FT                   DLLKLVLMHLNRLNELHKTEFNSLEALAISVQSSIHLLALGGYCLPLQNCCHSGSKLIP
FT                   PIGEWGWRCSFIPEEGFAIGTMPNASAELNPSELALLQRLLLEKVPFHSNGKLLGPKQV
FT                   WLKLLKIVETWIETHLQRRITSLQMMREVIISNDLNT"
FT   gene            complement(412509..413192)
FT                   /gene="deoC"
FT                   /locus_tag="NATL1_04511"
FT   CDS_pept        complement(412509..413192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="NATL1_04511"
FT                   /product="Putative deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="COG274 Deoxyribose-phosphate aldolase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75015"
FT                   /db_xref="GOA:A2C0K5"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0K5"
FT                   /protein_id="ABM75015.1"
FT                   /translation="MSKNSLEEAHANISNVIYQAILNPHFNKETIVQICDASKQNSFAG
FT                   LCTSLANLTIARERLGSKSTTKLISVIAFPFGFIPTSNKRKEAEYAIEKGADELDLVPN
FT                   YFALKEGKIELFAEEINQISELGIPVRVIIDANILINSSKLSMAIDALIDAGAIGIQIG
FT                   NGFGPSVSKDQTKHVSKLVKNRCSIKAVGGIKTFDQAIEIIEAGSTYIGTSFGFEITQE
FT                   QKKKE"
FT   gene            complement(413204..413788)
FT                   /gene="lrtA"
FT                   /locus_tag="NATL1_04521"
FT   CDS_pept        complement(413204..413788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrtA"
FT                   /locus_tag="NATL1_04521"
FT                   /product="light repressed protein A-like protein"
FT                   /note="COG1544 Ribosome-associated protein Y (PSrp-1)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75016"
FT                   /db_xref="GOA:A2C0K6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0K6"
FT                   /protein_id="ABM75016.1"
FT                   /translation="MKLLIHGRNLELTPSLRDYTKTKIDKATHNFQEMVQEADVHLSVA
FT                   RNPRVPQQTAEVTVFANGTVIRAQERSENLYASIDLVANKLARQLRKYKERHNSHNVHN
FT                   NQSTKSVQNEKIENFSSSDHSLIEGKEPHLPNPGVRRKYFEMDPMTIEQARVQLDLIDH
FT                   DFYLFREEEGSALRVIYRRNHGGYGVIQEKS"
FT   gene            413771..414505
FT                   /gene="lipB"
FT                   /locus_tag="NATL1_04531"
FT   CDS_pept        413771..414505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="NATL1_04531"
FT                   /product="putative lipoate-protein ligase B"
FT                   /note="COG321 Lipoate-protein ligase B [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75017"
FT                   /db_xref="GOA:A2C0K7"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0K7"
FT                   /protein_id="ABM75017.1"
FT                   /translation="MDKKLHSVSPESGPNSNLDLTPQLAQSSSAFLFEPKNIVPFETAL
FT                   GWQKNFLKNLIEEPFSPQAVWLLEHFSCFTMGRGSDKKNLLFEENNSPLPVFSIERGGE
FT                   VTHHMPGQIVGYLVLNLSLHKKDLAWYLRELEQVLIDVLDLLGIEGKRVDGLTGVWCED
FT                   KKVGSIGIGCKRWVTQHGFSLNVDCDLIGFEKIIPCGLDKVKVGKLSDWIPGIKVCDVT
FT                   PLLRESVKRRFKLNWEKINQSL"
FT   gene            414541..416514
FT                   /gene="fadD"
FT                   /locus_tag="NATL1_04541"
FT   CDS_pept        414541..416514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="NATL1_04541"
FT                   /product="putative long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /note="COG1022 Long-chain acyl-CoA synthetases
FT                   (AMP-forming) [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75018"
FT                   /db_xref="GOA:A2C0K8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0K8"
FT                   /protein_id="ABM75018.1"
FT                   /translation="MTKTNSQKNIFSSEDALAFWIPNRKEEQAINRRSHLNKITQVDEI
FT                   WELLKVQLGEVLAVDSPHTFHPESFTYEELAENISMAASAFSQVGVEPDEVVALFAENS
FT                   PRWLIADQGLMRIGATDSVRGATAPPSELRYILEDSKAVGLIVQNSDVWERLSLNDDQI
FT                   NSLKFVLQLEGKACEGVFEWETFLKKGLNIENVSKQEKIIDRQQKRIATILYTSGTTGK
FT                   PKGVPLTHSNLLHQIRSLACVANPSPGAPVLSVLPIWHSYERSAEYYFFSCGCTQTYTS
FT                   IRHLKEDLPRVKPIVMATVPRLWESIKLGFEDAVDKMPRLRKTLIKSAISNSKAYKLAR
FT                   RKLYFLTIESVSSFEQLISCIEILLRYPIHRISSIYLWPKILTKICGGKLRFPISGGGA
FT                   IAPHIDSFFEALGVELLVGYGLTETSPVLTCRRPWRNIRGGAGQPLPETEIKIVDPETF
FT                   QIKKLRQKGLVLARGPQIMSGYLGKRSESKKVLDATGWFNTGDLGMLLSDGSLILTGRA
FT                   KDTIVLSSGENIEPGPLEECLIASPLIEQALLLGQDQKYLAALIVPRIDHVKEWLAGRG
FT                   VNSKVVLGISPANYELRQSLKLEMNQALANRLGSRREERLFSIALVEPFTIENGLLTQT
FT                   LKQKRENIIQRDLKLINEIYGL"
FT   gene            416595..417029
FT                   /locus_tag="NATL1_04551"
FT   CDS_pept        416595..417029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75019"
FT                   /db_xref="InterPro:IPR021297"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0K9"
FT                   /protein_id="ABM75019.1"
FT                   /translation="MDSISIKRSITVRAVVTPSWKEEAERELSNAISAIDQQLGELEKE
FT                   GQQIVDGIRRQSSNPLDPRVQEQVAQVQNQVASKRSEFEEQKRNLLSQQSQVRELEMEQ
FT                   IVEQGQIDSFCDLKVGDNLVSKMGVSILVRDGVVEAIDQD"
FT   gene            417220..418590
FT                   /gene="pdhC"
FT                   /locus_tag="NATL1_04561"
FT   CDS_pept        417220..418590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /locus_tag="NATL1_04561"
FT                   /product="Dihydrolipoamide acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /EC_number="2.3.1.61"
FT                   /note="COG508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75020"
FT                   /db_xref="GOA:A2C0L0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0L0"
FT                   /protein_id="ABM75020.1"
FT                   /translation="MATHDIFMPALSSTMTEGKIVEWLKKPGDKVERGESVLVVESDKA
FT                   DMDVESFQDGFLASIVMPAGSSAPVGETIGLIVETEDEIAAAQANSPSPSPQSGSQEKD
FT                   SSSPQVQEKQASVDSPKATVVTKASPAPLVSESSVNQDQFLNDGRIVASPRAKKLASQM
FT                   GVDLATVRGSGPHGRIQAEDVQSAKGQPISVPWIAESNAPAKIVSDVPRVEKKSVDAGK
FT                   PPAPGKSFGSRGETIAFNTLQQAVNRNMEESLNTPCFRVGYSILTDELDDLYKQVKPDG
FT                   VTMTALLAKAVGLTLARHPQVNAAFSSEGIAYPSQINVAVAVAMEDGGLITPVLQNADK
FT                   TSLTDLSLQWADLVKRARNKQLEPQEYSSGTFTLSNLGMFGVDRFDAILPPGTGAILAV
FT                   GASLSKVVASKDGSISIKKQMQVNLTADHRVIYGADGALFLKDLAYLIEKNPYSLSS"
FT   gene            418643..419740
FT                   /gene="queA"
FT                   /locus_tag="NATL1_04571"
FT   CDS_pept        418643..419740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="NATL1_04571"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="COG809
FT                   S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
FT                   (queuine synthetase) [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75021"
FT                   /db_xref="GOA:A2C0L1"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0L1"
FT                   /protein_id="ABM75021.1"
FT                   /translation="MLDQKDNLLSSYNYDLPKDLIAQSPTRSRHDAKLMIIKDGLDDSL
FT                   NLVHAKVWDIKDILKPADLLVVNNTRVVKARLKIRLSGGGAGELLIMEPRGDGRWLCLG
FT                   RPARRMRGGDQLWLDTSRDNSLILKVIDKDEKTGGRIIQFSNEFTSWTEMENLLDLCGE
FT                   VPLPPYIDKDRSSGHEENYQTRFASKPGAIAAPTAGLHLSDELIENLKIRGIRIAQITL
FT                   HVGLGTFRPLEKEDLSQLHLHSEWIEVTEETIKAITTCKEEGGKVFAVGTTSVRALEAA
FT                   YLSGRGALKPYEGKVNLVIKPGFKFSVIDGLLTNFHLPKSSLLLLVSALIGRNRMLKLY
FT                   KHAISNKYRFFSYGDAMLITPESVI"
FT   gene            complement(419750..420736)
FT                   /locus_tag="NATL1_04581"
FT   CDS_pept        complement(419750..420736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04581"
FT                   /product="O-acetylserine (thiol)-lyase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="COG31 Cysteine synthase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75022"
FT                   /db_xref="GOA:A2C0L2"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0L2"
FT                   /protein_id="ABM75022.1"
FT                   /translation="MSRIYEDNSFAIGHTPLVKLNSITKNAKATVLAKIEGRNPAYSVK
FT                   CRIGANMIWDAEKKGLLNKDKVIIEPTSGNTGIALAYTAAARGYKLILTMPESMSIERR
FT                   RMMAVLGAELILTEAAKGMPGAIAKAKEIADGDPQKYFMPGQFDNPANPEIHFKTTGPE
FT                   IWDDTDGQIDVLVSGVGTGGTITGVSRFIKQEKNHSLLSVAVEPTHSPVITQTLNGEEV
FT                   KPGPHKIQGIGAGFIPKNLDLSVVDQVEQVSNDESIAMALRLAQEEGLLVGISCGAAAA
FT                   VALRLAEKEEFAGKTIVVVLPDLAERYISSVMFENVPTGVIKEPSLA"
FT   gene            complement(420825..422291)
FT                   /locus_tag="NATL1_04591"
FT   CDS_pept        complement(420825..422291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04591"
FT                   /product="possible Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="COG626 Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75023"
FT                   /db_xref="GOA:A2C0L3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0L3"
FT                   /protein_id="ABM75023.1"
FT                   /translation="MTERNLLIDPCWSAKDLGEPLPSRPHAVSVALPRWEDVIAYEEKV
FT                   PACINSLKAIYPRFGFNPFVAEVARKSLEFHGESNKSSWPYPNRASALSAQEYCLRKNS
FT                   DCFSKIEDFLGVSCLIIDQKNTSSAKAFWQHTGLGLSSREAAIALGKEKKPLTSDGDYA
FT                   REELIKRLANIYNCDKCLIRLHRSGMAALTTIISAINCIKGTSSTLQIGFPYVDVLKLP
FT                   QIIFQGSDLIIKTKLNHIKEELDKKNPAALIIEIPSNPLLQCVDLISISKLAKEKNIPV
FT                   IVDDTIGSSLNVHLTPYADVIFSSLTKSFAGRGDILAGSTVISPYSKWKKEIAEIIPKV
FT                   ALSTLSDSDAIELELTSRDVKDRLKRLNQSCLKLKEKLETKKEISKVLHPQYCKNFNSL
FT                   LKKGGGYGCLLSFELKGGIEESKRVYDSLRVNKGPSLGTNFTLVCPYVQLAHFKELKWA
FT                   ESCGVSEHLLRVSVGLENEDELWSRFNSVI"
FT   gene            complement(422288..423457)
FT                   /gene="metB"
FT                   /locus_tag="NATL1_04601"
FT   CDS_pept        complement(422288..423457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="NATL1_04601"
FT                   /product="putative Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="COG626 Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75024"
FT                   /db_xref="GOA:A2C0L4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0L4"
FT                   /protein_id="ABM75024.1"
FT                   /translation="MGSVKRDKKFSNGVNTRVIHHKDNFSEGTGSIMPPIFPTSTFVHG
FT                   NEGGFDYTRSGNPNFRILESVLSDLEECQFASVFSSGVAAITAIVSTLQAGDLILCEEN
FT                   LYGCTVRLFEQVFNRFGLKTQWIDFTKPNFQEVISNHKPAMIWIESPTNPLLKIIDIEG
FT                   ICHFSNKMKIPVVVDNTFATPLLQRPLKLGATLSLTSTTKFINGHSDALGGAVCTENPI
FT                   WRDKLNFAQKALGLNPSPFDCWLITRGIKTLPLRLERQVNNASKIANQLADNPAIKYVR
FT                   YPFRNDHPQCKLAKKQMAMGGAIVTATVNATQAQTYSFCKSLHYFKMAESLGGIESLVC
FT                   HPATMTHASVSKETKLKIGITDSLIRFSIGCEDIEDLSADLNQALGTIS"
FT   gene            complement(423559..424167)
FT                   /gene="rpsD"
FT                   /locus_tag="NATL1_04611"
FT   CDS_pept        complement(423559..424167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="NATL1_04611"
FT                   /product="30S ribosomal protein S4"
FT                   /note="COG522 Ribosomal protein S4 and related proteins
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75025"
FT                   /db_xref="GOA:A2C0L5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0L5"
FT                   /protein_id="ABM75025.1"
FT                   /translation="MSRYRGPRLRITRRLGDLPGLTRKAAKRSHPPGQHGQARRKRSEY
FT                   AIRLEEKQKLRFNYGISERQLVRYVKKARAQEGSTGTNLLKLLENRLDNVCFRLGFGPT
FT                   IPGSRQLVNHGHVTVNGKITDIASYQCKAGDVIAIRDNKASKQLAQANLEFPGLANVPP
FT                   HLELDKTKLSAKITAKTDREWVAIEINELLVVEYYSRKV"
FT   gene            424259..424498
FT                   /locus_tag="NATL1_04621"
FT   CDS_pept        424259..424498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04621"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG759 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75026"
FT                   /db_xref="GOA:A2C0L6"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0L6"
FT                   /protein_id="ABM75026.1"
FT                   /translation="MLTKINKAIALVFVSLISFYQKWISPLFGPSCRFIPSCSAYGIEA
FT                   VNKHGPWRGGWLTLKRLSKCHPFTPCGCDPVPEK"
FT   gene            424495..424806
FT                   /locus_tag="NATL1_04631"
FT   CDS_pept        424495..424806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04631"
FT                   /product="Thioredoxin family protein"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75027"
FT                   /db_xref="GOA:A2C0L7"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0L7"
FT                   /protein_id="ABM75027.1"
FT                   /translation="MNSEVLILYSRKGCCLCQTLEKKLSRICLDNLNPSIELTIVDIDS
FT                   KTVSLDIQMKYTNEVPVIVLDSTRLLKKIELPRVSPRLKEDMLLSWIQKNLNILYKKV"
FT   gene            425023..426552
FT                   /gene="murE"
FT                   /locus_tag="NATL1_04641"
FT   CDS_pept        425023..426552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="NATL1_04641"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /EC_number="6.3.2.13"
FT                   /note="COG769 UDP-N-acetylmuramyl tripeptide synthase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75028"
FT                   /db_xref="GOA:A2C0L8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0L8"
FT                   /protein_id="ABM75028.1"
FT                   /translation="MSRYLHTLLKAIDLQVRSGLANPEIKNLSTDSREIEKGDLFLGLD
FT                   GEKVDGGTFWAKAIERGACAAIISKKASLLNPPTNEDPVVILPEPVSLFMGKLAADFWG
FT                   KPSSEICLIGITGTNGKTTTSFLIEFLTTSLGHPSALFGTLINRWPNYEETSKYTTTFA
FT                   VPLQAKLRKAVQAGVEYGAMEVSSHALSQNRVAGCDFNGAIFTNLSRDHLDYHDSMESY
FT                   FEAKASLFRSHLIDDDGPRSVINIDDKWGSILAKELNKKCWTCSLKENSQIREKPDLYI
FT                   SNLQIMQDGYMGKLHTPFGVGNFISPLIGEFNLMNMLQAIGILVQRGLPLNDLLEALNK
FT                   FPGVPGRMQLINMDGFKVKDGYPLVIVDYAHTPDGLQNALIASRSLTKKRLICVFGCGG
FT                   DRDKGKRSKMGEVAAKFADYIVVTSDNPRQEDPIEIIKDIQKGITIDSEISVEPERSIA
FT                   IQFAIAKAKKNDVVLIAGKGHEDYQILKDQTIYFDDREQARKALSLRTDVI"
FT   gene            complement(426553..427755)
FT                   /locus_tag="NATL1_04651"
FT   CDS_pept        complement(426553..427755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04651"
FT                   /product="putative L-cysteine/cystine lyase"
FT                   /note="COG520 Selenocysteine lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75029"
FT                   /db_xref="GOA:A2C0L9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0L9"
FT                   /protein_id="ABM75029.1"
FT                   /translation="MSPILFKDNMPALQNKAYFNYGGQGPLPTQSLNAITSSWQTIQKL
FT                   GPFTNNVWPYITKEVITTKNLIAEICSIHPKRIAFTENVTSGCVLPLLGLPFSDGDNLL
FT                   LSDCEHPGIVAACKELARKKNLTIAILPVSKLCNGNDKKDETYNTVLKLIDEYLQKNTK
FT                   LVVLSHLLWNTGQIMPIELISKRLKEHSSKPYLLVDAAQSFCHIPSKGACDNADIYAFT
FT                   GHKWAYGPEGLGAVVLSARVLEESSPTLIGWKSLKAEEGIHINNKAPFHSDARRFEIAT
FT                   SCIPLLAGLRSSLAMLKNEGNETERFFKIKSLSCILWEKLNQIKNIELVLNSPPPSGII
FT                   SFTISGNHSPEEVVDYLGKENLWIRVLEDPKWLRACVHITTDSNEIDNLVIGLKNFIST
FT                   K"
FT   gene            427936..428070
FT                   /locus_tag="NATL1_04661"
FT   CDS_pept        427936..428070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04661"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75030"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0M0"
FT                   /protein_id="ABM75030.1"
FT                   /translation="MNIKKEQKIKAQEWVVMFDGQIKKSEKQIDSDEHHLEVNNQKSD"
FT   gene            428578..428781
FT                   /locus_tag="NATL1_04671"
FT   CDS_pept        428578..428781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04671"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75031"
FT                   /db_xref="GOA:A2C0M1"
FT                   /db_xref="InterPro:IPR003398"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0M1"
FT                   /protein_id="ABM75031.1"
FT                   /translation="MLIGGIVVLLAGSVAYGVYSTFGSGSKELRDTIDEHAKMHELVIA
FT                   HGHGGSSEAYEMSGKLQKDQIS"
FT   gene            428953..429621
FT                   /locus_tag="NATL1_04681"
FT   CDS_pept        428953..429621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04681"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75032"
FT                   /db_xref="GOA:A2C0M2"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0M2"
FT                   /protein_id="ABM75032.1"
FT                   /translation="MLISVLTGFSAGAVHVVSGADHMVAMAPFSVRKPRVALINGLAWG
FT                   IGHSAGVLILSILGILAKDLINIELLSSYAEFLVGISLLIVGGVAIKTSLKVNIHMHQH
FT                   MHGEEATHKHFHFHSLGNKLHTSHTHAATGLGVLHGFAGASHLVAVIPALALPLFGALA
FT                   YLFSYLLGSIFAMGCVVLGISFATSKANKMFYPFLMRSIGALSIVTGIFWLQKTSILTF
FT                   "
FT   gene            429634..429768
FT                   /locus_tag="NATL1_04691"
FT   CDS_pept        429634..429768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04691"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75033"
FT                   /db_xref="GOA:A2C0M3"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0M3"
FT                   /protein_id="ABM75033.1"
FT                   /translation="MNYTASLFALGGFFLWVVIATLIWARRMRKLKKEYSLNKSKFKN"
FT   gene            429858..430118
FT                   /locus_tag="NATL1_04701"
FT   CDS_pept        429858..430118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75034"
FT                   /db_xref="GOA:A2C0M4"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0M4"
FT                   /protein_id="ABM75034.1"
FT                   /translation="MKGVLFFLGSIFRWPVQNSKEFLILHVYLLGIYGITFLLRNLGLG
FT                   VSNLIFTVGLMAPIGYLIYNGLPLDCLDYKSAIKRELSSLN"
FT   gene            complement(430148..430393)
FT                   /locus_tag="NATL1_04711"
FT   CDS_pept        complement(430148..430393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04711"
FT                   /product="NifU-like protein"
FT                   /note="COG694 Thioredoxin-like proteins and domains
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75035"
FT                   /db_xref="GOA:A2C0M5"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0M5"
FT                   /protein_id="ABM75035.1"
FT                   /translation="MSDETLALTTENVEKVLDELRPFLMADGGNVEIAEIDGPIVKVRL
FT                   QGACGSCPSSTMTLKMGIERKLREMIPEVSEVIQVL"
FT   gene            430432..431958
FT                   /gene="mqo"
FT                   /locus_tag="NATL1_04721"
FT   CDS_pept        430432..431958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqo"
FT                   /locus_tag="NATL1_04721"
FT                   /product="putative malate/quinone oxidoreductase"
FT                   /EC_number="1.1.5.4"
FT                   /note="COG579 Predicted dehydrogenase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75036"
FT                   /db_xref="GOA:A2C0M6"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0M6"
FT                   /protein_id="ABM75036.1"
FT                   /translation="MQDSLYVILIKILFNTPTPDSENTYDAILVGAGIMSSTLAVLLHE
FT                   LEPDLRLLVVEKLSSAGLESSCAKNNAGTGHAANCELNYTPIQEDGHLSTNKAFEINKS
FT                   FEQSLEFWASLAEKGKLIPKTFLNKLPHISLVFGDEDISLLKKRFSKLSSHAAFAEMEF
FT                   TMDHGELKDWVPLIMDGRQHSEKIAATRIKRGTDIDFGNLTRSYINQIEGAKSIDINYS
FT                   TNVENLQQDSEGDWYLSLEGAKNNRIVRSKFVFLGAGGGALSLLQKSRIPEGLLYAGFP
FT                   VSGKWLICDEEKSTKTHNAKVYGKAAVGAPPMSVPHLDTRWIDKKKSLLFGPFAGFSSN
FT                   FLKYGSKLDLFRSIKTTNLFSMLQAGLDNIDLGKYLLNQLIQTNEDRIDTLKRFLPQVS
FT                   PNDWKLSTAGQRVQIIKQTSKGGVLKMGTEVVTSSDGSLAALLGASPGASTAVTIMIEV
FT                   LNRCWLEKMKSSKWKNKMLELFPSIGTDINSDQEALLAIRKRNDFLLKLI"
FT   gene            complement(431983..432102)
FT                   /locus_tag="NATL1_04731"
FT   CDS_pept        complement(431983..432102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04731"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75037"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0M7"
FT                   /protein_id="ABM75037.1"
FT                   /translation="MVNMSNYAEVPQTRNGHISHTKAIKGARSSFINSTLNKN"
FT   gene            432043..433854
FT                   /gene="lepA"
FT                   /locus_tag="NATL1_04741"
FT   CDS_pept        432043..433854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="NATL1_04741"
FT                   /product="GTP-binding protein LepA"
FT                   /EC_number="3.6.5.3"
FT                   /note="COG481 Membrane GTPase LepA [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75038"
FT                   /db_xref="GOA:A2C0M8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027518"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0M8"
FT                   /protein_id="ABM75038.1"
FT                   /translation="MTNVPISRLRNFCIIAHIDHGKSTLADRLLQDTGTVSSRDMQEQF
FT                   LDNMDLERERGITIKLQAARMNYKADDGEEYVLNLIDTPGHVDFSYEVSRSLQACEGAL
FT                   LVVDASQGVEAQTLANVYLALENDLEIIPVLNKVDLPGADPEKIKNEIESIIGLDTSKA
FT                   ISCSAKTGVGIPEILQAVVDRIPSPKDNTDQATKALIFDSYYDPYRGVIVYFRIMSGGI
FT                   SKKDKVLLMSSKKSYELDEIGVMAPDQVKVNSLHAGEVGYLAASIKAVADARVGDTITL
FT                   VDRPAEDALPGYAEAKPMVFCGLFPTDADQYPDLRDALDKLQLSDAALKYEPETSSAMG
FT                   FGFRCGFLGLLHMEIVQERLEREYDLDLIVTAPSVIYKVKMIDGEVKMIDNPATLPDPQ
FT                   KRETIEEPYVRMEIYAPNDYNGTLMGLCQDRRGDFIDMKYITTDRVTLIYEIPLAEVVT
FT                   DFFDQMKSRTKGYASMEYHLIGYRENDLVRLDVLINSERADPLTTIVHKDNAYGVGKGL
FT                   VEKLKELIPKQQFKIPLQASIGSRIIASEGISALRKDVLSKCYGGDISRKKKLLKKQAK
FT                   GKKRMKSMGKVDVPQEAFMAVLKLNND"
FT   gene            complement(433871..434038)
FT                   /locus_tag="NATL1_04751"
FT   CDS_pept        complement(433871..434038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04751"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75039"
FT                   /db_xref="GOA:A2C0M9"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0M9"
FT                   /protein_id="ABM75039.1"
FT                   /translation="MHFKNDGLTVGELSITIAVLIIIGFIWTNITKNKGNQEVSMFINN
FT                   SSEISYIRQT"
FT   gene            complement(434105..434218)
FT                   /locus_tag="NATL1_04761"
FT   CDS_pept        complement(434105..434218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04761"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75040"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0N0"
FT                   /protein_id="ABM75040.1"
FT                   /translation="MPIYMDKIISPAKNNRDDKFFRLKKPLKFNDQIIRPN"
FT   gene            434229..434987
FT                   /gene="dppC"
FT                   /locus_tag="NATL1_04771"
FT   CDS_pept        434229..434987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="NATL1_04771"
FT                   /product="putative ABC transporter, oligopeptides"
FT                   /note="COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components [Amino acid
FT                   transport and metabolism / Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75041"
FT                   /db_xref="GOA:A2C0N1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0N1"
FT                   /protein_id="ABM75041.1"
FT                   /translation="MPLLITLKIVPNGEFGLGNPIFSAPSIDHWCGTDRLGRDVCIRTL
FT                   AASGVALQVVFIAVSLAVLVGIPLGLLSGYIGGLLDRVLVLFMDTLYTIPVLLLSVVMA
FT                   FLLGRGILNASIALCVVYIPQYFRLVRNQTSQVKSELYIEAAISMGASPLWVIRKYLLK
FT                   NVLTSVPVVLTLNAADAVLVLGGLGFLGLGLPENIPEWGSDLNMALVALPTGIWWTAIY
FT                   PGMAMFVLVLGLSFIGEGLEKILSETSLQD"
FT   gene            complement(435009..435698)
FT                   /locus_tag="NATL1_04781"
FT   CDS_pept        complement(435009..435698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04781"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /EC_number="2.1.1.34"
FT                   /note="COG566 rRNA methylases [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75042"
FT                   /db_xref="GOA:A2C0N2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0N2"
FT                   /protein_id="ABM75042.1"
FT                   /translation="MPLLPRRFERLKSVLNRRISDLTVLIENVEKPHNLSAIIRSCDAV
FT                   GVLEAYAIFNKEKFLTFNSTAQGSQKWVKINQYKMTTEAIKVLKEKGFKLYGTNLNPRS
FT                   IDYRKCNFKGPTAFVLGAEKWGISEEASSLMDEHIHIPMRGMVESLNVSVAASALLFEA
FT                   IRQRQVANMVPESGEGMSQETYKEKLFEWAYPEVAQWSKSEGRKYPELNDKGEIIDNLP
FT                   RTEKMRY"
FT   gene            complement(435875..436876)
FT                   /locus_tag="NATL1_04791"
FT   CDS_pept        complement(435875..436876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04791"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75043"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0N3"
FT                   /protein_id="ABM75043.1"
FT                   /translation="MKLFSRLLVAPAALGLMAPVAANADTAFSSTTTLSGSAVFTTGSV
FT                   ADGGTSDTEEELYMQYAYGLNINSSFTGEDLFSAGLVTGNASGPLASMDSAESGDLDVT
FT                   SLFYNFPVGDLSVTVGPLVDQDDVVAATTSAYSDAFRLGSMPYSLAGNETGPGVGVAYS
FT                   GDNGVVASVSFVSVGGASSTVGIGADDGDDVSTFTLGYNGDGFGGGLVIASNDGEAGEG
FT                   YDTFGGGIYYSPESIDATFSVAYDTTDPETGADATDLFVGVDYEVGPGTLSAAYNSTDV
FT                   DGSDSEDSTGFEVSYTYSLNDNVTLTPGFFTVEDTSTGDDDTGVVLETAFSF"
FT   gene            437072..438418
FT                   /gene="sun"
FT                   /locus_tag="NATL1_04801"
FT   CDS_pept        437072..438418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="NATL1_04801"
FT                   /product="Sun protein (Fmu protein)"
FT                   /note="COG144 tRNA and rRNA cytosine-C5-methylases
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75044"
FT                   /db_xref="GOA:A2C0N4"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0N4"
FT                   /protein_id="ABM75044.1"
FT                   /translation="MLLSENLSSIKGLDARKAAWEVIQAVGGGSFADVALERIFNLYSF
FT                   KSIDKALITELSYGAIRQRYYLDCWIDHLGKVPAKKQPPLLRWLLHLGLYQVLKMKRIP
FT                   PAAAINTTVELAKTHHLRKLAPVVNGILRSALRSKERGLLLPKSNNPSLELAKNESLPV
FT                   WFAEELIAWKGVEHAQQIAKAFNSVSPIDIRVNKLRADLKDVKELFDTCGIQNQLIPNC
FT                   PSGLEVRAGIGEPRQWPGYEEGKWSVQDRSSQLIAPSLGPLPGEKILDACAAPGGKSTH
FT                   IAELINNEGNLWSVDRSSRRSKKILANSERLGTKCLQILVADSNELLLKKPDWKGFFDR
FT                   ILIDAPCSGLGTLARHPDARWRMNQDNIQQLVAVQSQLLNSLAPLLKNGGKLVYSTCTI
FT                   HPEENSHQIKNFLQSKSEFLLEYEKQIWPGEGDNGDGFYIAVLNKLKNQ"
FT   gene            complement(438485..439435)
FT                   /gene="chlG"
FT                   /locus_tag="NATL1_04811"
FT   CDS_pept        complement(438485..439435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlG"
FT                   /locus_tag="NATL1_04811"
FT                   /product="chlorophyll synthase 33 kD subunit"
FT                   /EC_number="2.5.1.62"
FT                   /note="COG382 4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75045"
FT                   /db_xref="GOA:A2C0N5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="InterPro:IPR011799"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0N5"
FT                   /protein_id="ABM75045.1"
FT                   /translation="MSDARQLLGIKGGSETTNIWKLRLQLMKPITWIPLLWGVICGAAA
FT                   SGNYHWELSNILASISCMFMSGPLLTGYTQTINDYFDREIDAINEPNRPIPSGAISLFQ
FT                   VKCQIWVLLIAGLGVAYLLDLWAHHTIPSVLLLALGGSFVSFIYSAPPLKLKQNGWLGN
FT                   YALGASYIALPWWAGQALFGHLTWTTALLTLAYSLSGLGIAVINDFKSVEGDKSLGLES
FT                   LPVVFGIKNASRISAGMIDIFQLAMVVVLIAIGQHFASVILVLLIIPQITFQDIWLLRD
FT                   PLKFDVKYQASAQPFLILGMLVTAIAIGHSSLISL"
FT   gene            complement(439451..439672)
FT                   /locus_tag="NATL1_04821"
FT   CDS_pept        complement(439451..439672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04821"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75046"
FT                   /db_xref="InterPro:IPR021291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0N6"
FT                   /protein_id="ABM75046.1"
FT                   /translation="MAKPTSLSRIGSKIKINIERVRDRIPSYLIDQLSEDPRGTVIDYK
FT                   MTDGRGGIGVVIKMNDGSKHWFFEDEVS"
FT   gene            439725..440495
FT                   /gene="hisF"
FT                   /locus_tag="NATL1_04831"
FT   CDS_pept        439725..440495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="NATL1_04831"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   HisF (cyclase)"
FT                   /note="COG107 Imidazole glycerol-phosphate synthase [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75047"
FT                   /db_xref="GOA:A2C0N7"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0N7"
FT                   /protein_id="ABM75047.1"
FT                   /translation="MVALRLIPCLDVSNGRVVKGVNFVGLRDAGDPVELGCRYSKAGAD
FT                   ELVFLDITATHEKRSTLVDMVRRTSEAVTIPFTVGGGISSLNGINELLRAGADKVSLNS
FT                   SAVKDPSLISQGANRFGSQCIVVAIDAKKNKHIPNKWDVYVSGGRKNTGLDAIEWAEKI
FT                   FEMGAGEILLTSMDGDGTQNGYDIELTRCISEKVSIPVIASGGAGSLSHIKDAFTLGKS
FT                   SAALLASLLHDGQLTIREIKEYLIKENLPIRPIE"
FT   gene            440578..441276
FT                   /gene="ubiE"
FT                   /locus_tag="NATL1_04841"
FT   CDS_pept        440578..441276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="NATL1_04841"
FT                   /product="Ubiquinone/menaquinone biosynthesis
FT                   methyltransferases"
FT                   /note="COG2226 Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75048"
FT                   /db_xref="GOA:A2C0N8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032904"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0N8"
FT                   /protein_id="ABM75048.1"
FT                   /translation="MRPGNTKAIEEMFNSISSKYDFLNDIFSFGLHRFWKTKLLDILNP
FT                   TFGEKWIDLCCGTGDMSMLLARYIKSSKNITGIDSASQALLVARERSKQNYSSIEWING
FT                   DALETRLTSHQFDGLLMAYGLRNLSSPYEGLKEAFRILKPGGRAGILDFRSFEGTSIQG
FT                   LFQKIYLSCYVVPISSLFGLGKEYSYIKKSLVNFPSGEKQIHLALSAGFKKAKYQTLAM
FT                   GQMGILLLEA"
FT   gene            complement(441288..441707)
FT                   /locus_tag="NATL1_04851"
FT   CDS_pept        complement(441288..441707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04851"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75049"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0N9"
FT                   /protein_id="ABM75049.1"
FT                   /translation="MEEIKSSWKENVGGLIQDWVEIAGEQLALNCTPLNIQNKILTIGA
FT                   SHPQWRQALQYNRLELIQSLKSYGYQIKEIRIRQYYPNDLVTRESEKEIWEKHPSRTDK
FT                   TGITNCPFCKVPSPKGEVKLWGKCSFCRRKELRID"
FT   gene            441844..442620
FT                   /gene="pspA"
FT                   /locus_tag="NATL1_04861"
FT   CDS_pept        441844..442620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="NATL1_04861"
FT                   /product="membrane-associated 30 kDa-like protein"
FT                   /note="chloroplast membrane-associated 30 kDa-like protein;
FT                   COG1842 Phage shock protein A (IM30), suppresses
FT                   sigma54-dependent transcription [Transcription / Signal
FT                   transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75050"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0P0"
FT                   /protein_id="ABM75050.1"
FT                   /translation="MGLFDRLSRLIRANLNAFVSDAEDPIKILDQSVADMQEDLVKLRQ
FT                   AVAMAIASQKRLENQANQAKEQIKNWFNRAELALKKGEDDLAREALSRKKTFQETYESL
FT                   STQFQTQNGQVEKLKKSLLLLERKIAEARTKKDMLKARAQAAKAQQQIQSAVGDLGSKS
FT                   AMAAFERMEDKVEALEASGQAALELAGEDLESKFAALEGGDDIEKELEILRTQLKSGVE
FT                   VIALPPSDLDVNEVKTVEIQEVEVELEEMKKSMDNS"
FT   gene            442736..443413
FT                   /gene="birA"
FT                   /locus_tag="NATL1_04871"
FT   CDS_pept        442736..443413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="NATL1_04871"
FT                   /product="putative Biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="COG340 Biotin-(acetyl-CoA carboxylase) ligase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75051"
FT                   /db_xref="GOA:A2C0P1"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0P1"
FT                   /protein_id="ABM75051.1"
FT                   /translation="MLKTICASTEIELSKWITEKPVKKNQPIAIFSSCQRFGKGQAGRI
FT                   WHAPKGGVWVSAAINREDSCENNSQLYGLAVALALVERIERIGVNVNIKWPNDLLVDGQ
FT                   KLAGILPRLFFRGGKLRLLRVGVGLNVFNNVPQEGISLKQIIGDKTININFWSSEVLLA
FT                   IERSLDLLDNKHFLCSQVEQRLWSRKYIDKETGLKWDIKGIDSSGGLNLSKENKVKVLS
FT                   NYA"
FT   gene            complement(443423..444130)
FT                   /gene="salX"
FT                   /locus_tag="NATL1_04881"
FT   CDS_pept        complement(443423..444130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="salX"
FT                   /locus_tag="NATL1_04881"
FT                   /product="possible ABC transporter, ATP binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /EC_number="3.6.3.32"
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75052"
FT                   /db_xref="GOA:A2C0P2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0P2"
FT                   /protein_id="ABM75052.1"
FT                   /translation="MVNQLKSLKKSVARLTNINKFYGEGSVKVKALDELNLEVYQGDYL
FT                   AVMGASGSGKSTAMNILGCLDRPTNGTYELNGTAVEKLDDDLLADIRNKELGFVFQQFH
FT                   LLQEISALENVMLPMIYACVPSLQREKRAEEALKRVGLGNRMTNLPNQLSGGQQQRVAI
FT                   ARAIINKPSLLLADEPTGALDSKTTEDVLNLFDQLHSQGITIVLVTHEDNVAQRAKKIA
FT                   RFRDGKVIEITHN"
FT   gene            complement(444123..445670)
FT                   /locus_tag="NATL1_04891"
FT                   /note="NAD(P)H-quinone oxidoreductase chain 2; framshift."
FT   gene            445813..448719
FT                   /gene="topA"
FT                   /locus_tag="NATL1_04911"
FT   CDS_pept        445813..448719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="NATL1_04911"
FT                   /product="Prokaryotic DNA topoisomerase"
FT                   /EC_number="5.99.1.2"
FT                   /note="COG550 Topoisomerase IA [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75053"
FT                   /db_xref="GOA:A2C0P3"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0P3"
FT                   /protein_id="ABM75053.1"
FT                   /translation="MPTDHTLVIVESPTKAKTIRGFLPKDFQVLASMGHIRDLPNNASE
FT                   IPAKHKGEKWATIGVNTTADFDPLYVVPKDKKKIVKELKQSLKGASELLLATDEDREGE
FT                   SISWHLMNVLDPKIPVKRMVFHEITKEAISKALSKTRAIDMELVHAQETRRILDRLVGY
FT                   TLSPLLWKKVSWGLSAGRVQSVAVRLLVLRERARRAFKSGSYWDLKAKLEKEGSEFEVK
FT                   MTSIGGKRIATGSDFDESTGLLKSGRNVILLKEEESKELAKNLTTDKWKVVNVEEKPSI
FT                   RKPVPPFTTSTLQQEANRKLRLSARETMRCAQGLYERGFITYMRTDSVHLSDQAINASR
FT                   NCVESKYGVEYLSKKPRQFSNKTRNAQEAHEAIRPSGESFKTPKESNLQGRDLSLYELI
FT                   WKRTVASQMADARLTMLGVELKASDVSFRASGKRIDFPGFFRAYVEGTDDPDSALEGQE
FT                   VLLPKLAVGDSPTAKNVEALGHQTQPPARYSEASLVKTLEKEGIGRPSTYASIIGTIVD
FT                   RGYSVLNNNSLTPSFTAFAVTALLEEHFPDLVDTSFTARMESTLDEISTGKVSWLPYLK
FT                   GFYKGDTGLENQVQQREGDIDGGEFRAVSLEGLSSLVRLGKFGTYLESKQLGENGKPIT
FT                   ATLPQEITPADLDEDIAEMILKQKAEGPESLGVDPDSGQNLYLLNGRYGHFVQRGLVVE
FT                   LKDLGIPKGKKKLGNLRLFKSSQYGLYLKQDSSKVQVLLPENIKEEEIDVEKALEYLDD
FT                   KSLKKAPNPKRTSLPKSLKPEDLTFEKALGLIQLPRLLGEHPEGGKVQSSLGRFGPYVV
FT                   WSKNGGEKDYRSIKGEDDVLQVSLERALELLSIPKRGRGGRTALKELGIPDGEKETIQL
FT                   FDGPYGLYVKQGKVNASLPEGKTAEDITIEVAIELLAAKKSSKKTTSKKRKSTQKTTKS
FT                   TKKDLNSSASKKSSTQKAPSTTKTGRLRASKVRVIKTK"
FT   gene            448724..449212
FT                   /locus_tag="NATL1_04921"
FT   CDS_pept        448724..449212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04921"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75054"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0P4"
FT                   /protein_id="ABM75054.1"
FT                   /translation="MNITRLVEKIFIRSFLIVTLFALQSCSNTLIGEKLESSFDSMEKP
FT                   RTSEKTNIKPQKPNEKTKIKSILKDDKKENKNAFANTVKENSISNKDRLSKKITKSKKK
FT                   TIFNPQPYRIILRLSGANPSAPAETVTEALRTAGVQFEVEKIERFDKEDLSKDSSFKR"
FT   gene            449218..449904
FT                   /locus_tag="NATL1_04931"
FT   CDS_pept        449218..449904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04931"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4241 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75055"
FT                   /db_xref="GOA:A2C0P5"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0P5"
FT                   /protein_id="ABM75055.1"
FT                   /translation="MNLDNKNSLKSRSLYKAPLSKRQALKIVESSYLAAATALIWIALY
FT                   YLPIGGAVFRLALPLPLALLQIRRGVKTGIEGVTICVMLLTALMGPLRGPLVLFPYGLL
FT                   SLWLGYCWEKGWNWWLSWSVGVSIGTMGFLVRVFVLSLLVGENLWVILTRAGAGLLEKG
FT                   IDIFNLSFTPDMRQVQIVALCLIITQEIIYVLCLHALAYWIFPRLKSSIPEPPALLEKL
FT                   ISLESN"
FT   gene            449911..451107
FT                   /gene="cobT"
FT                   /locus_tag="NATL1_04941"
FT   CDS_pept        449911..451107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="NATL1_04941"
FT                   /product="NaMN:DMB phosphoribosyltransferase"
FT                   /note="COG2038 NaMN:DMB phosphoribosyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75056"
FT                   /db_xref="GOA:A2C0P6"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0P6"
FT                   /protein_id="ABM75056.1"
FT                   /translation="MTGDNYVLLPSRVLAFGEGLHEQNVEERVQRWQENITNMAFFLIL
FT                   AGSQTAEIEGISAAGSTAVSRRYTAIADAELLLRGPNLPKRWPLPPLPAGVSPALISYV
FT                   ASSFLKIKPTIISAGLLQTPPFTHVSLEPSEIGPARCLSSGNAMERTRVKLLFEGGYKI
FT                   GKKLKKSLLLTECVPGGTSTAFAVLSGLGINVNGLISGSHRNPPSELKIKLVKQGLEAA
FT                   KLKKNPSSVELMAAVGDPFQPIAVGLLMGARESGQEILLGGGCQMLAVLALALNEIEPE
FT                   SRSEFVGKILIGTTSWLVDESLSSSENRNSFIHLMNHVANHFKVNILGLASGYRFNDSK
FT                   QQVLRDYEIGYVKEGVGAGALSLLAQIKGLTQKEMVQRCDIEVSNLFKFDNEKTCQGI"
FT   gene            451113..452114
FT                   /locus_tag="NATL1_04951"
FT   CDS_pept        451113..452114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04951"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75057"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0P7"
FT                   /protein_id="ABM75057.1"
FT                   /translation="MNTKTLGRREFIKYGLSSSLVLLSGCSTSQKKLALRGVTNSFPSE
FT                   FVNSLSTGWEFFPIKDIEFKKSPYNSALNEKTDLLVLNDGWISGLPINSLQEIKADNIR
FT                   NNFSKQTSAFLDGLGKDYKNKLFPLAVSPWVILFRNEDSLALNNKNSWEVVFSSSLTKQ
FT                   IVFPKSPYLLISIAQKIGLVNDFSKIKSQAQSFDDMNALNWVVSGRANAAVLPLSSCVD
FT                   SLVKDPRLSILLPQEGSPLNWTVLASPSLSPESFPTDWFNSLWSSTYLRRVISKGFLPP
FT                   TNFLDLRRKNINVPKRYQSIFLPEESVWNKCWSLPILSFQEKKDLALNWNNS"
FT   gene            452199..452852
FT                   /gene="ribE"
FT                   /locus_tag="NATL1_04961"
FT   CDS_pept        452199..452852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="NATL1_04961"
FT                   /product="Putative Riboflavin synthase alpha chain"
FT                   /EC_number="2.5.1.9"
FT                   /note="COG307 Riboflavin synthase alpha chain [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75058"
FT                   /db_xref="GOA:A2C0P8"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0P8"
FT                   /protein_id="ABM75058.1"
FT                   /translation="MFTGLIQAIGTIKKNNLGVIVDGCNPFSPLKLGDSVSVDGVCLTV
FT                   SELMNDSFFSNISEETLKRTNLAEKAQKNGYVNLEPALRLSDRLGGHIVSGHIDGLGKV
FT                   VSIENLKNSWNLRVSWDDLNFCRYMCDKASISLNGISLTIAEIYVDGCEFSVAVIPHTW
FT                   SNTCLKFLTIGEKVNLEVDLMAKYAEKLLKVNNNDSISKQSPVINSQWLSEQGW"
FT   gene            complement(452898..453254)
FT                   /locus_tag="NATL1_04971"
FT   CDS_pept        complement(452898..453254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_04971"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75059"
FT                   /db_xref="GOA:A2C0P9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0P9"
FT                   /protein_id="ABM75059.1"
FT                   /translation="MLVGKELLDKARSLSDRPEDEIAKGCGYVGPSGRVLRKSFYRALV
FT                   EAKGYKLRSNGPGRAGNRSSRGRQAEFRTKVHGNGNLLIGHAYTKKLGLEPGQEFRIDV
FT                   RKESGAISLLPLKK"
FT   gene            complement(453350..453955)
FT                   /gene="ctaE"
FT                   /locus_tag="NATL1_04981"
FT   CDS_pept        complement(453350..453955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaE"
FT                   /locus_tag="NATL1_04981"
FT                   /product="Cytochrome c oxidase, subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /note="COG1845 Heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 3 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75060"
FT                   /db_xref="GOA:A2C0Q0"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Q0"
FT                   /protein_id="ABM75060.1"
FT                   /translation="MTSIVPKEQSSGSKNELSAEEHEDFRLFGLIAFLIADGMTFAGFF
FT                   AAYLTFKAVNPIGPDAIYELELPLPTLNTILLLISSFTFHRAGKFLEKNESKQCQKWLL
FT                   ITGVLGVAFLISQMFEYFTLPFGLTDNLFASTFYALTGFHGLHVTLGSIMIMIIWWQTR
FT                   VPSGRVNNQNKFPFEAVELYWHFVDGIWVVLFIILYLL"
FT   gene            complement(453952..455592)
FT                   /gene="cyoB"
FT                   /locus_tag="NATL1_04991"
FT   CDS_pept        complement(453952..455592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="NATL1_04991"
FT                   /product="Cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="COG843 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 1 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_04991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75061"
FT                   /db_xref="GOA:A2C0Q1"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Q1"
FT                   /protein_id="ABM75061.1"
FT                   /translation="MTISLKPNNSSPEKLQPTGWLKYLSFSLDHKVIGLQYLVCGFLFY
FT                   LIGGSLAGAIRVELISPLSDFMPREVYNQVLTLHGTIMIFLWIVPVVNGAFGNYLIPFY
FT                   VGARDMAFPRLNAVAFWLIPPSGLMLITSYFINGAAQSGWTAYPPLSITTPAAGQIIWI
FT                   LSVLLLGGSSIFGGINFIATILKLRRPGLKLMQLPMYCWAMLGTSILVVLSTPVLAGTL
FT                   ILLSFDIVAHTGFFNPSLGGNVIVYQHLFWFYSHPAVYIMVLPAFGLVSEILPIHSRKP
FT                   LFGYTTMVFSIMGIVVLGLVVWAHHMFTSGTPPWMRLFFTIATAFIAVPTGIKFFNWVA
FT                   TLWGGKISLNAAMLFSCGFIINFVLGGITGVALAQVPFDVHVHDTYFVVAHFHYIVYGG
FT                   SVFVIFSSIYHWFPKFTGKMLNENLGRFHFIITFIGFNLCFAPQHWLGLNGMPRRVAEY
FT                   DPQFQLINQISSVGALLMALSTLPFLWNILQSILFGEEAGDNPWNALTPEWLTSSPPPV
FT                   ENWDGEAPLVLEPYGYGEKDSNETQEAIR"
FT   gene            complement(455597..456409)
FT                   /gene="cyoA"
FT                   /locus_tag="NATL1_05001"
FT   CDS_pept        complement(455597..456409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="NATL1_05001"
FT                   /product="putative cytochrome c oxidase, subunit 2"
FT                   /EC_number="1.9.3.1"
FT                   /note="COG1622 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 2 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75062"
FT                   /db_xref="GOA:A2C0Q2"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Q2"
FT                   /protein_id="ABM75062.1"
FT                   /translation="MPKPSAILTLTTSLILGIAGVWVAYNVDMLPVSASMNAPVYDELY
FT                   RVLFIIGVMLFIGMTALVIYSLIQFRRRPGETGDGIDLEGNISLEIFWTAVPAIVVLFV
FT                   GLYSYDIYDRMGGMQPLMHDHSGQMDNQAERVWGGIGSGPIESSSKNNSSSLPIELTAM
FT                   QFAFIFHYPKGDIISGELHVPVGREVSLKMESKDVIHAFWVPQFRLKQDVIPGQPTILN
FT                   FTPTKAGNFPIVCAELCGPYHGGMRSNVIVDEQEDFDTWLKENSKESI"
FT   gene            456592..457518
FT                   /gene="ctaA"
FT                   /locus_tag="NATL1_05011"
FT   CDS_pept        456592..457518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="NATL1_05011"
FT                   /product="Uncharacterized protein required for cytochrome
FT                   oxidase assembly"
FT                   /note="COG1612 Uncharacterized protein required for
FT                   cytochrome oxidase assembly [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75063"
FT                   /db_xref="GOA:A2C0Q3"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Q3"
FT                   /protein_id="ABM75063.1"
FT                   /translation="MQVIYPPKPLFRLGQLAAHVVVALIALVVIGGATRVMEAGLACPD
FT                   WPLCYGSFLPGRQMNLQVFLEWFHRLDAFFVGIVLITQFAFSLYWAKTLPRWLPWIYGF
FT                   LTLLVSLQGFLGALTVLQLLPSLVVMAHLVVAFTLVAIMSGVTQQLLNPGKSIFPTWLR
FT                   CFGFLSLFAVIAQSLLGSRVATSWAAQRCLDFGESCNLLGLHRVSAIPVSLLVILFVIV
FT                   SSLQRDVFTKQWPYLLTIIFLVISQILLGVLSVHLRMSEPSLIIGHQLIACLLVAVIAA
FT                   LNFKGRGNDDSSQSLYINQSTLETCHG"
FT   gene            457511..458506
FT                   /gene="cyoE"
FT                   /locus_tag="NATL1_05021"
FT   CDS_pept        457511..458506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="NATL1_05021"
FT                   /product="putative protoheme IX farnesyltransferase"
FT                   /note="COG109 Polyprenyltransferase (cytochrome oxidase
FT                   assembly factor) [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75064"
FT                   /db_xref="GOA:A2C0Q4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0Q4"
FT                   /protein_id="ABM75064.1"
FT                   /translation="MVSSTSELITQPVNREEVVPSRKRIKLPAWLEVVKPRLIPLLLAT
FT                   TVGGMALSEEWPLPSPRLACTLGGGALAAAAAGALNCLWEQDLDKRMKRTSNRALPSGR
FT                   LSQSSVFIGAVACTLVSSALLVSGVNCLAAGLTLLGLCSYVLLYTAFLKPRTSQNIVFG
FT                   GVAGAIPPLVGASAAAGHIGLGGWWLFSLVMVWTPAHFWALAILLKEDYRSVGIPMLPT
FT                   VSGPFVTAKAISVYGYLTVFLSFLGCFVLPEGGLLYGILLLPYNSRLLQLVSRLRDNPE
FT                   DLDRAKGLFRWSILYMFGVCFLLVISRLQVSIVFNDQLIALIKDFSIGFS"
FT   gene            458608..459621
FT                   /gene="ccmA"
FT                   /locus_tag="NATL1_05031"
FT   CDS_pept        458608..459621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="NATL1_05031"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /note="COG1131 ABC-type multidrug transport system, ATPase
FT                   component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75065"
FT                   /db_xref="GOA:A2C0Q5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Q5"
FT                   /protein_id="ABM75065.1"
FT                   /translation="MFFIKLRDLFKSYGPVMALNGLNLEVPKGSLYGLLGPNGAGKSTA
FT                   LRIICTLLSPDSGHVEVGGHNVLFEEKETRRRLGYVAQDVAIDKILTGRELLQLQGDLY
FT                   HLDKKYKRKRIEELIERLDMHEWIDRRCGSFSGGMKRRLDLSSGLLHEPELLILDEPTV
FT                   GLDIESRSVIWGLLKELRNKETTILLSSHYLEEVDELADEMAIIDKGKVIASGKPDDLK
FT                   KELGGDRVTLRVREFSDEVEAESVKKLIKNINGVSNVVVNQTQGYSLNFLVQSNDVISN
FT                   LSGHLSKENFEVFALSHSRPSLDDVYLQATGKTLMDAELELAGKRDFKLENKKSMR"
FT   gene            459653..460507
FT                   /locus_tag="NATL1_05041"
FT   CDS_pept        459653..460507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05041"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75066"
FT                   /db_xref="GOA:A2C0Q6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Q6"
FT                   /protein_id="ABM75066.1"
FT                   /translation="MITTNQSLQKEKQSRNDLNEMSQEISALTWRLFIQLIRRPSTLFA
FT                   GILQPLIWLLLFAALFSKAPIDFLPGSSSYGEFLGAGLIVFTAFSGALNAGLPLMFDRE
FT                   FGFLNRLLVAPLSSRSSIVISSVIYITSISLLQSFAIMATSALLGYGWPSLGGFLLIAI
FT                   TLLLLVFAITGLSLGLAFVLPGHIELIAIIFIANLPVLFASTALAPISFMPEWLGWIAS
FT                   INPLTFAIEPIRMAYHSSVDLRAILIDAPYGEVNGYSCLAILLILTVGLFFLIRPLLNR
FT                   KLA"
FT   gene            460537..461010
FT                   /locus_tag="NATL1_05051"
FT   CDS_pept        460537..461010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05051"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75067"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Q7"
FT                   /protein_id="ABM75067.1"
FT                   /translation="MESRKYQLQKQIIEALKANDNDLYSLLKSQWAHRFGVDSLEELKS
FT                   LDLEQLNQTPNNVDNQKIDQSQENSFEGEKETSIKDDENHSKEIINKEVDESVKDENDK
FT                   SFTITSYSIADKENDEDKTINPYKDSRSQPEIKALIPLPPKPKYSYLKKWLLR"
FT   gene            complement(461078..462769)
FT                   /gene="groL"
FT                   /locus_tag="NATL1_05061"
FT   CDS_pept        complement(461078..462769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="NATL1_05061"
FT                   /product="GroEL2 protein (Chaperonin cpn60 2)"
FT                   /EC_number="3.6.4.9"
FT                   /note="COG459 Chaperonin GroEL (HSP60 family)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75068"
FT                   /db_xref="GOA:A2C0Q8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0Q8"
FT                   /protein_id="ABM75068.1"
FT                   /translation="MAKLLSFSDESRGALEKGVNNLANALKVTIGPKGRNVVIEKKFGA
FT                   PDIVNDGVTIAKEIDLEDPFENIGAKLIEQVASKTKEKAGDGTTTATVLAQFMVQEGLR
FT                   NTAAGASPIELRRGMEKAVAQIVDDLKKKSKSVSGDAIKQVATVSAGGDEEIGSMIADA
FT                   IDKVSFDGVITVEESKSLATELDITEGMAFDRGYSSPYFVTDEDRLICEFENPSILITD
FT                   KKISSIADLIPVLETVQKNGTPLIILAEEVEGEALATLVVNKNRGVLQVAAVRAPSFGE
FT                   RRKAALGDIAVLTGGTLISEDKAMSLEKVQISDLGQARRVTITKDSTTIVANDNQNTEL
FT                   SNRIASIKRELDETDSEYDQEKLNERIAKLAGGVAVIKVGAPTETELKNRKLRIEDALN
FT                   ATRAAIEEGIVAGGGTTLLELSEGLGDLAKKLEGDQKTGVEIIKRALTAPTKQIAINAG
FT                   FNGDVVVSDIKRLGKGFNAQTGEYVDLLEAGILDASKVIRLALQDAVSIASLLITTEVV
FT                   IADKPEPPSAPGAEGGDPMGGMGGMGGMGGMGGMGGMGGMGMPGMM"
FT   gene            462898..463074
FT                   /locus_tag="NATL1_05071"
FT   CDS_pept        462898..463074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05071"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75069"
FT                   /db_xref="GOA:A2C0Q9"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Q9"
FT                   /protein_id="ABM75069.1"
FT                   /translation="MNDPGTLFFILMAGLAGTMTLIYFPLRIFLTATARSRRLKLLQRI
FT                   RRLRDELGQPLQN"
FT   gene            complement(463082..463834)
FT                   /locus_tag="NATL1_05081"
FT   CDS_pept        complement(463082..463834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05081"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75070"
FT                   /db_xref="GOA:A2C0R0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0R0"
FT                   /protein_id="ABM75070.1"
FT                   /translation="MTLSKLLEGQTAIVTGASRGIGKAIAIFLAKEGAEVIINYSSSLE
FT                   NANKVVSEINSFGGKAYPLQADISNENSVNDLIKTVLEKNNKIDVLVNNAGITKDGLLM
FT                   RMKTDDWQKVLDLNLSGVFYCTRAVSRQMLKQKKGRIINITSVVGLMGNPGQANYSAAK
FT                   AGVVGLTQSAAKEFASRGITVNAVAPGFISTDMTKDLDSESILSAIPLGRFGNPEDVAG
FT                   AVRFLAADPSASYITGQVIQVDGGMVMS"
FT   gene            464000..464671
FT                   /gene="ispD"
FT                   /locus_tag="NATL1_05091"
FT   CDS_pept        464000..464671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="NATL1_05091"
FT                   /product="putative 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="COG1211 4-diphosphocytidyl-2-methyl-D-erithritol
FT                   synthase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75071"
FT                   /db_xref="GOA:A2C0R1"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0R1"
FT                   /protein_id="ABM75071.1"
FT                   /translation="MLIAAAGSGSRMGADRNKLLLKVAGKTVLEWTLKAAFEAKTISWI
FT                   GIIGQPKDKNPICSILDNSVKAVQWINGGSTRQQSVQLGLAALPNDAKSVLIHDGARCL
FT                   VRPFVFDEISKIVSKGQSVIAASQVTDTIKKVDIDGEIIESPPRSDLWAAQTPQGFPVN
FT                   KLKHAHSEAISKGWNVTDDASLFERLGLTVKIYDAGPSNIKVTTPFDLVIAESLLSTLK
FT                   D"
FT   gene            complement(464655..465530)
FT                   /locus_tag="NATL1_05101"
FT   CDS_pept        complement(464655..465530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05101"
FT                   /product="Putative carboxypeptidase"
FT                   /EC_number="3.4.17.13"
FT                   /EC_number="3.4.17.1"
FT                   /note="COG1619 Uncharacterized proteins, homologs of
FT                   microcin C7 resistance protein MccF [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75072"
FT                   /db_xref="GOA:A2C0R2"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0R2"
FT                   /protein_id="ABM75072.1"
FT                   /translation="MTEPIKKGDHFHIVAASSPITKKEDLHSGIKVLQEWGLICNHFDE
FT                   IDRSWGYLAGNDEVRFNELHPSKHYPLLAFARGGWGSARLLEKQQPWKEGWMIGFSDLT
FT                   SILLARLASGFQGGIHGPLITTLGSEPDWSKDRLKSILFGNCVPDIYGEPWGGGISKGR
FT                   LIVGNLTVLTHLIGTEHLPSFKKSILIIEDIGEAPYRIDRMLTHLRLAGVLHQLSGLGF
FT                   GSFTRCDDEKDVDKSKTFKLLDIFKDRTQDLKIPIVSSLPIGHCCGNASLPLGSQAILN
FT                   GDKGSLSLLK"
FT   gene            complement(465556..466419)
FT                   /gene="ubiA"
FT                   /locus_tag="NATL1_05111"
FT   CDS_pept        complement(465556..466419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="NATL1_05111"
FT                   /product="probable 4-hydroxybenzoate-octaprenyltransferase"
FT                   /note="COG382 4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75073"
FT                   /db_xref="GOA:A2C0R3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0R3"
FT                   /protein_id="ABM75073.1"
FT                   /translation="MGYYFQLLRWNKPSGRLILLIPSGWSLWLTPAAPPSLLFLGIIIL
FT                   GGLFVSGAGCIANDIWDRKFDKKVIRTKERPLANGKVSLKAAWILLILMLFFSLFIVLS
FT                   IPQESRNLCLLLSSLSLPFILLYPSAKRWFQYPQLILSICWGFSVLIPWAASESSLAGV
FT                   TLIYCWLATILWTFGFDTVYAMADESEDKVIGLNSSAISLGGKSLKTVSLCYFLTCIFL
FT                   ALAAFKANLGLIYWPFWLITTVGMQREVFLLSSKSKGIKTSGLHFSNQVRLGSLLLLGM
FT                   VFSKII"
FT   gene            466529..468163
FT                   /gene="ppx"
FT                   /locus_tag="NATL1_05121"
FT   CDS_pept        466529..468163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="NATL1_05121"
FT                   /product="putative exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /note="COG248 Exopolyphosphatase [Nucleotide transport and
FT                   metabolism / Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75074"
FT                   /db_xref="GOA:A2C0R4"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0R4"
FT                   /protein_id="ABM75074.1"
FT                   /translation="MLGDSINNSSERNSIELDLGEKQDAELCRVATIDIGTNSTHLLIA
FT                   KIERKLNTFSIELAEKSTTRLGERDPQTGELTSLAMNRAFSTLKRFKDLSESYKVESLI
FT                   IAATSAVREAPNGKIFIAEIKKKIGLDVELISGAEEARLIYLGVLSGMQFGNKPHLVLD
FT                   IGGGSTELILADSSEARALTSTKIGAVRLQREFIKKDPISSQNELFLRSFIRGSMESAI
FT                   DKVSKRIEAGEIPVLVATSGTAMAIGSLLSNKENHMQSKLQGYKITKNNLDIIVSQLIK
FT                   MTPSERSQLSSLSERRSEIIVPGALILQTIMNMVDVNEIILSERALREGLVVDWMCRNN
FT                   YLKDQLSFQGSIRERTVIHQAKRFGVNSKRSKSVSEFALTFYDQTKGVLHNDNGGGRDL
FT                   LWAAAKLHACGKQINISAYHKHSWYLIKNGELLGYSQSEHLMVAAIARYHRKSFPKKRH
FT                   ESWQLLVDESQRSLVADMSLLLRLSCSLDRRPEPLVSKIVIEANNKKVNIELIPNNLGQ
FT                   NLDLEKWSLTKAILLVKKIMDVDINIL"
FT   gene            complement(468160..468657)
FT                   /locus_tag="NATL1_05131"
FT   CDS_pept        complement(468160..468657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75075"
FT                   /db_xref="GOA:A2C0R5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0R5"
FT                   /protein_id="ABM75075.1"
FT                   /translation="MEKSEERKSGSSHVANKKSSLRTVGEFLREARQGRNLSVEDLSSS
FT                   LRIGKEQLIALESGDESALPEKVFIRAMVRRIAEKLNLDTSFILEELNEKKKNEPKPSP
FT                   VIKKKNTRKNKKFNPFIIVILSGALGLFTSIMLLKYIEKGQNDSLNPQRSDIFLLDKKI
FT                   SS"
FT   gene            complement(468769..469527)
FT                   /gene="cobM"
FT                   /locus_tag="NATL1_05141"
FT   CDS_pept        complement(468769..469527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /locus_tag="NATL1_05141"
FT                   /product="putative precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="COG2875 Precorrin-4 methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75076"
FT                   /db_xref="GOA:A2C0R6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0R6"
FT                   /protein_id="ABM75076.1"
FT                   /translation="MNPISIVGAGPGALDLMTIRAQQRIKSADVLLWTDSLIPIQITNF
FT                   VKDDCEKIKTSSLTLEEILLILIKKHKEGKKIVRLHDGDPCLYGAISEQICRLNDEGIE
FT                   VEVVPGVSAYQATAATLGFELTVPDLTQTIILSRADGRTGKPERESLQKLASIQSSLCL
FT                   YLSARHVEEVQSILIKYYPANTPVAIAYRVTWPDEWIKVIPLNEMAKTSQEQNLIRTTL
FT                   YIISPTLKIGNNRSKLYNPTHSHLFRSSSR"
FT   gene            complement(469524..470435)
FT                   /gene="lgt"
FT                   /locus_tag="NATL1_05151"
FT   CDS_pept        complement(469524..470435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="NATL1_05151"
FT                   /product="putative prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /note="COG682 Prolipoprotein diacylglyceryltransferase
FT                   [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75077"
FT                   /db_xref="GOA:A2C0R7"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0R7"
FT                   /protein_id="ABM75077.1"
FT                   /translation="MEHIFLELRSPGPDLFQLGPFSLRWYGLLIAISVLVGLNLSSELA
FT                   SKKGLKKSLINDLLPILVLASVIGARIYYVAFEWRNYTGKNFWSSINFLNLNIPLPSAL
FT                   EIWGGGIAIHGALIMGTLSIIFFCRWRKEPFWDVIDVLVPSVALGQAIGRWGNFFNNEA
FT                   FGIPTNLPWKLFIPYRFRPEIFSTQDYFHPTFLYESVWNIFVFGILIFLFRKSNKKELK
FT                   LPPGSLSCLYLITYSLGRFWIEGLRTDPLCLGGVPPFCEGGLRIAQLISLFLISAGLLG
FT                   IWRIYVSKKALPDPSSINGRNQ"
FT   gene            complement(470449..471414)
FT                   /gene="petA"
FT                   /locus_tag="NATL1_05161"
FT   CDS_pept        complement(470449..471414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="NATL1_05161"
FT                   /product="Cytochrome f"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75078"
FT                   /db_xref="GOA:A2C0R8"
FT                   /db_xref="InterPro:IPR002325"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR024058"
FT                   /db_xref="InterPro:IPR024094"
FT                   /db_xref="InterPro:IPR036826"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0R8"
FT                   /protein_id="ABM75078.1"
FT                   /translation="MKKNFYTISKTMSRSLKLILFSVFIGFSIFLIPQPTWAYPFWAQQ
FT                   KFENPREATGKIVCANCHVASMPTRAEVPQAVAADSVFKTVVEIPYKKDLQEIGADGSK
FT                   VPLQVGAVVMLPDGFKLAPQERWTDEIKEETQGVYFTQYSEEQENIILVGPLPGDQNRE
FT                   IVFPVLSPDPRKDSNYNFGKYSIHVGGNRGRGQVYPTGEKSNNNLFTATNSGTITSIET
FT                   NEDGTQIINLNNEEGESFTENLPAGTSLLIKEGDTIEKGAKLTEDPNVGGFGQLDKEIV
FT                   LQSKARVIGMIIFFIGVGLSQIMLVLKKKQVEKVQAAEGI"
FT   gene            complement(471422..471958)
FT                   /gene="petC"
FT                   /locus_tag="NATL1_05171"
FT   CDS_pept        complement(471422..471958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="NATL1_05171"
FT                   /product="Rieske iron-sulfur protein"
FT                   /EC_number="1.10.9.1"
FT                   /note="COG723 Rieske Fe-S protein [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75079"
FT                   /db_xref="GOA:A2C0R9"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023960"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0R9"
FT                   /protein_id="ABM75079.1"
FT                   /translation="MTQMTTADVPSMGRRQFMNLLTFGTVTGVALGALYPVAQYFTPYR
FT                   AGGGGGGTNAKDELGNNVSASGWLSTHPVGDRSLVQGLKGDPTYLIVEGEDAITSYGIN
FT                   AICTHLGCVVPWNSGANKYMCPCHGSQYDSTGKVVRGPAPLSLAIAHVSIEDDQVLVSQ
FT                   WTETDFRTGTDPWWG"
FT   gene            472042..472404
FT                   /locus_tag="NATL1_05181"
FT   CDS_pept        472042..472404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75080"
FT                   /db_xref="InterPro:IPR021420"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0S0"
FT                   /protein_id="ABM75080.1"
FT                   /translation="MSFKSNELNTGGFSSPIPLEVDEVVGCLRRRWGVTYDLKLLIKKD
FT                   RIYLQMMWGFLEQQSFPLDEETFRENLNRTLEIINRAGQSGFVRNWLENVQAKPRLGRA
FT                   ITLPLPMDQRMDEFVL"
FT   gene            complement(472370..473089)
FT                   /gene="tatC"
FT                   /locus_tag="NATL1_05191"
FT   CDS_pept        complement(472370..473089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="NATL1_05191"
FT                   /product="protein secretion component, Tat family"
FT                   /note="COG805 Sec-independent protein secretion pathway
FT                   component TatC [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75081"
FT                   /db_xref="GOA:A2C0S1"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0S1"
FT                   /protein_id="ABM75081.1"
FT                   /translation="MPLVDHLEELRQRILKSLIAVLLSSGFCLLFVRKLVQALEMPAGK
FT                   IQFLQVAPGEFLFTSIKVAGYGGLTLSLPFILFQFLKFILPGLTKKEKILIAPSVAGSA
FT                   ILFFLGIFFAWKALIPAALGFLVSYGADVVEPLWSIEKYLDFVLLLMLSTGLAFQLPIL
FT                   QLILGFLEIISWKKMLSAWRLVVMASAVAGAILTPSTDPITMLLLSTSITFLFFVGIGL
FT                   VALTTNLKGQIRPSFDP"
FT   gene            complement(473321..473572)
FT                   /locus_tag="NATL1_05201"
FT   CDS_pept        complement(473321..473572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75082"
FT                   /db_xref="GOA:A2C0S2"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0S2"
FT                   /protein_id="ABM75082.1"
FT                   /translation="MIDFLLGTHEFLGNHTFPEFLIGYLFGAALIIGAPTVFLLLAFTS
FT                   ALMKTNGKMGGYKEYASYGESSLNDCPPFILPDPTKNK"
FT   gene            complement(473614..475317)
FT                   /locus_tag="NATL1_05211"
FT   CDS_pept        complement(473614..475317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05211"
FT                   /product="possible secreted protein MPB70 precursor"
FT                   /note="COG1293 Predicted RNA-binding protein homologous to
FT                   eukaryotic snRNP [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75083"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0S3"
FT                   /protein_id="ABM75083.1"
FT                   /translation="MNKVPIQIMDLTTLKAVVFELSQDIIPSRFETAQQIDSHTIQLGL
FT                   RTLEKLTWIEISWLPESPIIVSIPPPKRYGEKSTLAKQIKHLLVNLALVDITQIGFERI
FT                   VRFKFSSRPGEEIEKELIVELMGRHSNILLLDRSGKVITLGKQIKESQSRLRPIGTGDI
FT                   YTSPPPLKGLVPVLSEAFNSWKGNICLVPSTFKNSLKDTYQGISPALTLQIVSSDYNES
FT                   LKIINKPVTSIELETWEAIYKRWKEWLLDLENSNYTINFEGPTDYIVWGKKESTAKNKK
FT                   IGLSLSMYYSNKLVERKINSIREKLKQDLANCKGHEKRKLDVQELLIKNISEYITMQNK
FT                   AKSLLTLPSPTKKQIIEAQSLFKEAKRKKRSRESIVNRINFHKKKLSEIQCCESFLDSF
FT                   IYEENEDNKNKLESIIELKEEVEEYICIKKNNSKFKLKRKKENSLNIKEIQSPSGLKIQ
FT                   IGGNNRQNELISLKKGKKGDLWFHAQEIPGSHVVLKSSDGLVDETDIQLAADLASFFSR
FT                   ARGNKLTPVNMVPIENLKRLSGSLPGTVSHRGGKVLWGKAERAAKYFYQK"
FT   gene            475386..475946
FT                   /gene="gmk"
FT                   /locus_tag="NATL1_05221"
FT   CDS_pept        475386..475946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="NATL1_05221"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /EC_number="2.7.4.12"
FT                   /note="COG194 Guanylate kinase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75084"
FT                   /db_xref="GOA:A2C0S4"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0S4"
FT                   /protein_id="ABM75084.1"
FT                   /translation="MSSLGNLTVLTGPSGVGKGTIVRKILESHSDVWLSISATTRQPRS
FT                   GEIEGEHYFFLEKKKFQEIIDKDGFLEWASFSNNFYGTPKKIVKEKIEKGTNVLLEIEL
FT                   EGARQIRKSFPEAFQIFLAPPNLYELEKRIRGRGTETEESIRDRLSIAEKELIAQKEFD
FT                   AVVINEDIEKAFKEIEGFMGLKL"
FT   gene            complement(475969..476106)
FT                   /gene="psaJ"
FT                   /locus_tag="NATL1_05231"
FT   CDS_pept        complement(475969..476106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaJ"
FT                   /locus_tag="NATL1_05231"
FT                   /product="Photosystem I PsaJ protein (subunit IX)"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75085"
FT                   /db_xref="GOA:A2C0S5"
FT                   /db_xref="InterPro:IPR002615"
FT                   /db_xref="InterPro:IPR036062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0S5"
FT                   /protein_id="ABM75085.1"
FT                   /translation="MFQLFRTKWFRSAPVVATIWITLTAGIIVEFNRFVPDLLFHPMSF
FT                   "
FT   gene            complement(476154..476711)
FT                   /gene="psaF"
FT                   /locus_tag="NATL1_05241"
FT   CDS_pept        complement(476154..476711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaF"
FT                   /locus_tag="NATL1_05241"
FT                   /product="Photosystem I PsaF protein (subunit III)"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75086"
FT                   /db_xref="GOA:A2C0S6"
FT                   /db_xref="InterPro:IPR003666"
FT                   /db_xref="InterPro:IPR036577"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0S6"
FT                   /protein_id="ABM75086.1"
FT                   /translation="MSRLLSILLSAFLFLGIAPIANARPGPALNADRAPTDFTASALVS
FT                   CADNPRFQERASTASTDQAIKRFERYSKALCGDDGLPHLIIGPPIEPWGAWINRGHEGD
FT                   LLIPGVMFIYIAGIIGWSGREYVRAVRGKKNAAEYEIIIDTSLAWQCLKRGAAWPLQAN
FT                   REGKNGELRAKDNNVSLNGPRG"
FT   gene            476784..477854
FT                   /gene="qri7"
FT                   /locus_tag="NATL1_05251"
FT   CDS_pept        476784..477854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qri7"
FT                   /locus_tag="NATL1_05251"
FT                   /product="probable o-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="COG533 Metal-dependent proteases with possible
FT                   chaperone activity [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75087"
FT                   /db_xref="GOA:A2C0S7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0S7"
FT                   /protein_id="ABM75087.1"
FT                   /translation="MSIILSLETSCDESAAALVSNEKGKIDLLANEIASQIDEHANWGG
FT                   VVPEIASRRHLENLPFLIEEVFAKSTLQIKDIDAVAATVTPGLAGSLLVGSITARTLAN
FT                   LHQIPFLGIHHLEGHLSSIYLSENHPKPPFLVLLVSGGHTELIKVDVKHKYQRLGRSHD
FT                   DAAGEAFDKVARLLGLSYPGGPAIQKIAKSGDPKKFLFPKGRVSKPEGGFYPYDFSFSG
FT                   LKTAVFRQIEKIRSENKKLPIEDIAASFEYIVAEVLVERSFKCALDQGLNSLVLVGGVA
FT                   ANVRLREMMLAKASKNSIDITLAPMEFCTDNAAMIGAAALLRLSSEGFKSSMELGVSAR
FT                   WPLEKSDSLYDPIPPF"
FT   gene            477885..478067
FT                   /locus_tag="NATL1_05261"
FT   CDS_pept        477885..478067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05261"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75088"
FT                   /db_xref="GOA:A2C0S8"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0S8"
FT                   /protein_id="ABM75088.1"
FT                   /translation="MSLKESDEENKFTKLASSNELNSWKRGFTPQAEIWNGRMAIAGLF
FT                   IVLIILLASNLFFSG"
FT   gene            478248..478631
FT                   /locus_tag="NATL1_05271"
FT   CDS_pept        478248..478631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05271"
FT                   /product="Hypothetical protein"
FT                   /note="COG4333 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75089"
FT                   /db_xref="InterPro:IPR012441"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0S9"
FT                   /protein_id="ABM75089.1"
FT                   /translation="MRIINFSSRWNYKNIYIINLFGLISKSPLQLSKSNDPIGENNDLI
FT                   TLKSLEFWRENNNCDLWLGWGDKGQLNGRDLKVLKLIKNFSNLKSNENNYSKRVLSLGL
FT                   SKKGNPRHPLYMPNKSFLRRFDL"
FT   gene            478802..480046
FT                   /gene="nhaP"
FT                   /locus_tag="NATL1_05281"
FT   CDS_pept        478802..480046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaP"
FT                   /locus_tag="NATL1_05281"
FT                   /product="putative Na+/H+ antiporter, CPA1 family"
FT                   /note="COG25 NhaP-type Na+/H+ and K+/H+ antiporters
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75090"
FT                   /db_xref="GOA:A2C0T0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0T0"
FT                   /protein_id="ABM75090.1"
FT                   /translation="MTPERLGLLWGITVFSGAGARLLSVLTGLPGVVLLLLSGLLIGRS
FT                   GLGLVEPLDLGKGLETIVGLLVSLVLFDGGLNLRFPGGAIKSIVLRISSIRLIISLAAG
FT                   FFAAHWFAGLGWSVAGVYSAIVLATGPTVVTPLVRQIRLASPLSDVLEAEGLILEPIGA
FT                   VLALLLLELVVGDLHGWRELFLGLLSRLGGGVLIGSLAGLFLSEGLKRLRSEPYIGIRL
FT                   QLTLGVVFLLYGVCEWLLPESGLPASVAAGFVVGQRPSTQANELDKLIRELAQLAITML
FT                   FPLLAADVSWGELSPLGWGGITCVLFLMIIVRPIAVSIATYGLPLDNKQRLFLGWLAPR
FT                   GIVTAAVASLFSIRLEQAGVLGAGKLQGLVFLTILMTVGIQGLTAQPLAKMLGLLDEDK
FT                   DLDKPTNSGSIFTES"
FT   gene            complement(480002..481480)
FT                   /gene="gltX"
FT                   /locus_tag="NATL1_05291"
FT   CDS_pept        complement(480002..481480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="NATL1_05291"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="COG8 Glutamyl- and glutaminyl-tRNA synthetases
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75091"
FT                   /db_xref="GOA:A2C0T1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0T1"
FT                   /protein_id="ABM75091.1"
FT                   /translation="MRVRIPSVPYLNRIRALKVRVRLAPSPTGTLHLGTARTALFNWLF
FT                   AKKEGGTFLLRIEDTDIERSREEYINDIYDGLKWLGINWDESPTIQSERVNEHKQIIKT
FT                   LVDKGFAYKCYASEAELDEMRETQKRNGLAPKYDNRHRNLTPEQESEFIKLGRDPVIRF
FT                   KISDEKLISWNDLIRGKMTWSGKDLGGDMVIARRAPGNSIGDPLYNLVVVADDSAMKIS
FT                   HVIRGEDHLANTAKQILLYEALDLNIPVFAHTPLILNSEGKKLSKRDGVTSISEFKKMG
FT                   YTSEAMANYMTLLGWSVPEGINERFNISEVSEIFSFKKVNKASAKFDWDKLNWLNSQVI
FT                   HEMSAETLLENLEPLFKENGWHLPSHEWGINLVGLIGPSMVLINDGVDQAKPFFEEQEL
FT                   SDDGKKQLEIKEAAVILKFILEKLADSDAASFSKEKALDLIDQATKSCKVKKGVVMKSL
FT                   RAALFGTLNGPDLIQSWVLLSRFSKDRARISRLI"
FT   gene            complement(481454..481527)
FT                   /locus_tag="NATL1_tRNAAspVIMSS1309200"
FT                   /note="tRNA-Asp"
FT   tRNA            complement(481454..481527)
FT                   /locus_tag="NATL1_tRNAAspVIMSS1309200"
FT                   /product="tRNA-Asp"
FT   gene            complement(481730..481918)
FT                   /locus_tag="NATL1_05301"
FT   CDS_pept        complement(481730..481918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05301"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75092"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0T2"
FT                   /protein_id="ABM75092.1"
FT                   /translation="MELDLQPGDVVKVLESAALGWVRARVIRVKSGGRVVVQSDQGREF
FT                   TARGNQVRLIEPAGFRP"
FT   gene            complement(481954..482026)
FT                   /locus_tag="NATL1_tRNATrpVIMSS1309199"
FT                   /note="tRNA-Trp"
FT   tRNA            complement(481954..482026)
FT                   /locus_tag="NATL1_tRNATrpVIMSS1309199"
FT                   /product="tRNA-Trp"
FT   gene            complement(482086..482574)
FT                   /gene="rplS"
FT                   /locus_tag="NATL1_05311"
FT   CDS_pept        complement(482086..482574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="NATL1_05311"
FT                   /product="Ribosomal protein L19"
FT                   /note="COG335 Ribosomal protein L19 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75093"
FT                   /db_xref="GOA:A2C0T3"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0T3"
FT                   /protein_id="ABM75093.1"
FT                   /translation="MSVDSKEPSSEEVKIEDESNASEDSGVKTASENKSKGKKISIKNL
FT                   SPAEIIKTFEDAQLGKDLPDIYVGDTVRVGVRISEGNKERVQPYEGVVIAKRHGGIHQT
FT                   ITVRRIFQGIGVERIFLVHSPQVASIKVERRGKVRRAKLFYLRERVGKATRVKQRFDR"
FT   gene            complement(482825..482917)
FT                   /locus_tag="NATL1_05321"
FT   CDS_pept        complement(482825..482917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05321"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75094"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0T4"
FT                   /protein_id="ABM75094.1"
FT                   /translation="MSFQKKEDQRKDSLFSKKVKTSKFASLLMI"
FT   gene            482878..483717
FT                   /gene="map"
FT                   /locus_tag="NATL1_05331"
FT   CDS_pept        482878..483717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="NATL1_05331"
FT                   /product="putative methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="COG24 Methionine aminopeptidase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75095"
FT                   /db_xref="GOA:A2C0T5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0T5"
FT                   /protein_id="ABM75095.1"
FT                   /translation="MNLFSDLLSSENSKIPINNGPVIKQRRGVEIKSSREIAIMRKSSK
FT                   IVATVLSEIRDLVKPGMSTLDLDNYAEKRIRDHDAKPSFKGYHGFPGSICSSINNEVVH
FT                   GIPSKKKIINDGDLLKVDTGAFYNGYHGDSCITICVGNTSDKANELSRVAREALMLGIK
FT                   QIRPQNKLLDIAGAIEDYVKANGFSVVEDYTGHGVGRNLHEEPSVFNFRTNDLPNVTLR
FT                   EGMTIAVEPIINLGSKHCKTLRDGWTVITKDGNLSAQWEHTVLVTKNGCEILTDRGD"
FT   gene            complement(483720..484484)
FT                   /locus_tag="NATL1_05341"
FT   CDS_pept        complement(483720..484484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75096"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0T6"
FT                   /protein_id="ABM75096.1"
FT                   /translation="MKKSLSDKSRFKGLKIAITGANGSLGKSLIEVLKKEGAYLIGLTH
FT                   DKKNNSNSEGSKPDEWILWSCGKERLLSSSLANVDILILNHGFNPKGMIESNEINKALE
FT                   INSLSHLRLIEIFEDLALSNNLNKYNSKEVWVNTSEAEIQIAFSPVYEITKRLIGELIS
FT                   LKKSKLLMEKRNSFIIKKLILGPFKSKLNPQGIMSPEFVAKKIVQKAKKEDYLVIVSPN
FT                   PITHLIMPFVELIRIFYSRFINKIYSNTTPLK"
FT   gene            484635..485726
FT                   /gene="pta"
FT                   /locus_tag="NATL1_05351"
FT   CDS_pept        484635..485726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="NATL1_05351"
FT                   /product="BioD-like N-terminal domain of
FT                   phosphotransacetylase"
FT                   /note="COG857 BioD-like N-terminal domain of
FT                   phosphotransacetylase [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75097"
FT                   /db_xref="GOA:A2C0T7"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0T7"
FT                   /protein_id="ABM75097.1"
FT                   /translation="MSKTFLIGSCEPFSGKSALVLGIARNLIASNHMVRFGKPLATSLE
FT                   LNVSERGDIQDMIDDDVRFVGETLQLSAENLIPSIQFLAASTASERIQKNTLDPGGGFD
FT                   EFRLSLNSSGEAINILEAAGSLHEGLLYGLSLPQLAKGLKAKVLLAHFWQDSRSVEALL
FT                   EAKNQLGDHLSGVILNAVNPDQIKDIKENIVPSLKALGLDIFGVMPRSPLLRSVTVEEL
FT                   VRRLNARVICCSDRLELMVETLSIGAMSVNSAMEFFRRRRNMAVVTGADRTDIQLAALE
FT                   ASTQCLILTGAGEPLPQLINRSEELDVPLLKVDRDTLSTVEVIEQAFGHVRLHETVKAT
FT                   YAFRLVQEHCDLDRIFKTLGISS"
FT   gene            485767..486285
FT                   /locus_tag="NATL1_05361"
FT   CDS_pept        485767..486285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75098"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0T8"
FT                   /protein_id="ABM75098.1"
FT                   /translation="MSLSRSLDLPALGRVDTLAQELALLKNEGKRRIAFLGSRHVPVVS
FT                   IHIVELIARSLAQEGHSIITSGSQGVNAAVIRAVLDVNPSLLTVLLPQSLDRQTAEVKD
FT                   LLGSVLHLIEKEDNNDLPLPMASSLCNQEIINRCDQLICFAFHDSETLLSSCHSAEDMG
FT                   KVVSLMFFD"
FT   gene            486411..486908
FT                   /locus_tag="NATL1_05371"
FT   CDS_pept        486411..486908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05371"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG1666 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75099"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0T9"
FT                   /protein_id="ABM75099.1"
FT                   /translation="MPSSYSFDVVSEFDQQELVNAIDQLRREVDQRYDLKDSKTKIDIK
FT                   EDELSIVSLSDMTIESVKDILLQKATKRNLSLKIFDFQKIETIGGNMVMQIVKLKKGLS
FT                   QEISKKLSKLVRDNMKKVTASIQGDSLRITGKNKDDLQAAINLIKKQEEELDIALQFQN
FT                   YR"
FT   gene            486950..487144
FT                   /locus_tag="NATL1_05381"
FT   CDS_pept        486950..487144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05381"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75100"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0U0"
FT                   /protein_id="ABM75100.1"
FT                   /translation="MDSLIKKLSKKAIDLSGKSKKELERTCWMIVHEYKHGAMPTEYDI
FT                   REIDEELYLQVLSMAKEMI"
FT   gene            487283..488086
FT                   /gene="hflC"
FT                   /locus_tag="NATL1_05391"
FT   CDS_pept        487283..488086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="NATL1_05391"
FT                   /product="Band 7 protein"
FT                   /note="COG330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75101"
FT                   /db_xref="GOA:A2C0U1"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0U1"
FT                   /protein_id="ABM75101.1"
FT                   /translation="MTTPFRNVTPNGPGGTTTLLLVLSFTGFLLLTQAFFVVPAGQVSV
FT                   VTTLGKVSGGSRKPGLNFKVPFVQNTYPFNVQTQVRPEKFDSLTKDLQVISATATVKYA
FT                   LKPNEAGRVFKTISYNDREIYNRIIQPSLLKALKSVFSKYELVTIASSWSDISELVEDT
FT                   VAEELNKFDYVDVQSLDLTGLTIADEYRAAIEQKQIAEQQLLRAQTEVKIAEQEALRYD
FT                   TLNKSLDDQVLFKLFLDKWNGETQVVPSLPGNGSGNVPVIVRGKN"
FT   gene            complement(488146..489432)
FT                   /gene="hemL"
FT                   /locus_tag="NATL1_05401"
FT   CDS_pept        complement(488146..489432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="NATL1_05401"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="COG1 Glutamate-1-semialdehyde aminotransferase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75102"
FT                   /db_xref="GOA:A2C0U2"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0U2"
FT                   /protein_id="ABM75102.1"
FT                   /translation="MNTKRSEEIFGAAKNLMPGGVSSPVRAFKSVEGDPIVFDRVKGPY
FT                   AWDVDGNRYIDYVGSWGPAICGHAHPEVIAALQETLEKGTSFGAPCVLENQLAEMVIDA
FT                   VPSVEMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFEGCYHGHADMFLVKAGSGVATLG
FT                   LPDSPGVPRSTTANTLTAPYNDLEAVKELFAENPDAISGVILEPVVGNAGFITPEPGFL
FT                   EGLREVTQENGALLVFDEVMTGFRISYGGAQERFGVTPDLTTMGKVIGGGLPVGAYGGR
FT                   KEIMSMVSPSGPMYQAGTLSGNPLAMTAGIKTLELLKQEGTYEKLEALTKKLLDGILTA
FT                   AKESNIPIYGQSISAMFGFYLCEGPVRNFEEAKSSDTELFSKIHRLMLQKGVYLAPSAF
FT                   EAGFTSLAHSEDDINATIKAFQEIFSEIS"
FT   gene            complement(489714..490541)
FT                   /gene="xthA"
FT                   /locus_tag="NATL1_05411"
FT   CDS_pept        complement(489714..490541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="NATL1_05411"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="COG708 Exonuclease III [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75103"
FT                   /db_xref="GOA:A2C0U3"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0U3"
FT                   /protein_id="ABM75103.1"
FT                   /translation="MLVATWNVNSIRSRIDHVKEWLITNKIDILCLQETKTEDKFFPIE
FT                   NFSDLGYEVSISGQKSYNGVAIISRFPINNIKIGFNEVINDYQDLSILSEQKRIISADI
FT                   NDIRIINVYVPNGSSINSDKFIYKKKWLECLQVYLREINKNNTPICLLGDFNIAPEDRD
FT                   IHTPSRYEESIMASSKERELLKDALGGELEDVFRIFEPGEKNWSWWDYRHSAWERDKGW
FT                   RIDHIYLTEDILSCANSCWIDKEQRSREKPSDHAPVVVDINWPPSDIENEFFF"
FT   gene            490600..490935
FT                   /locus_tag="NATL1_05421"
FT   CDS_pept        490600..490935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05421"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75104"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0U4"
FT                   /protein_id="ABM75104.1"
FT                   /translation="MKQTARFINGQLWFALSCLAPILITVGQVFSSSKTIRISELKNYS
FT                   TDEKRDIYSTFDTEDQIDQGLPIDPFDLMNRLKQAGAMNNATTPSDALDAALNAFDQSD
FT                   DENIPNE"
FT   gene            491005..491652
FT                   /locus_tag="NATL1_05431"
FT   CDS_pept        491005..491652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75105"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0U5"
FT                   /protein_id="ABM75105.1"
FT                   /translation="MQNHPIPSVTDPLQYRAIGLVRGIYKPQDDDTFTRGALIDSKGNE
FT                   IDSVVLGRVITLIRNHVPLEKPHLWVVYPRCRNNQNLHLQITGIWEPSTLKKDLLDSEG
FT                   LNENSGFKGDSDSLLEGDDYFSIRGELIFTKPEEKDVVIKIRQKPRSQQKKALPFKLNL
FT                   KGEVPINYLKHFISLNVRRVDYQLLIEDFQIIGPLSKQQINNKSKKILKNKN"
FT   gene            491718..492944
FT                   /locus_tag="NATL1_05441"
FT   CDS_pept        491718..492944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05441"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG1641 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75106"
FT                   /db_xref="GOA:A2C0U6"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0U6"
FT                   /protein_id="ABM75106.1"
FT                   /translation="MKSIFIDCSLGISGDMLASALFDLGVPHSIFLDNLVSLNIDKNYK
FT                   LKFKEGDSEGIKGIVCMKNEIQFKELSRSLNEIKNLLLNSSLNDYVKKKSIKVFEILAE
FT                   AEAVVHGNQISDVHFHELGSIDSILDIVNVCSAIDFLKPYKIYFSNPPSGKGIVSTSHG
FT                   PLPVPVPTVLEIARQNEIPLMVLDDKYFGEITTPTGIALIATFIDKFGQPSNLNIQNIG
FT                   IGLGSKNISRPNFLRILLIDENDDYMENNKPSNETIIAQEAWIDDSTPEDVAVLIDRLR
FT                   SAGAIDVICYSVDMKKNRKGICIQAIVYPKHKNLLREVWFNYSTTIGIRENKISRWILP
FT                   RRTVSHKTKFGTVNVKQAMRPNGLNSIKIEHKDLTRITLNTGIPIEEIRQKLIIELSEF
FT                   YEIDDWSFL"
FT   gene            492941..493906
FT                   /locus_tag="NATL1_05451"
FT   CDS_pept        492941..493906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75107"
FT                   /db_xref="GOA:A2C0U7"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0U7"
FT                   /protein_id="ABM75107.1"
FT                   /translation="MINFIMNGIIRKNFVFGKISKINIKLLITLSCFAFLGNSIYGNFD
FT                   SLSNQTITSEEMLWILWGVIFSFFSIIINAYAWKLLINNIGCSINNLNIIKLFLATNIY
FT                   KYLPGGIWHFVSRYKNLRLEISNEKSIESILLEPILMLVAGFIFIPFRGFNLPTYILCW
FT                   SSTLLFLPTFRQSLIKKLRTMKAKIFTNNDNIKDRDLAKNSQNISTSLFYPYKPLFVEI
FT                   IFIFFRFVGFLCCVNAFSIGSLISHGELISSFSLAWIIGLIVPAAPGGLGVFESVILFS
FT                   LSSHLPEAPLLASLLCYRLVSTVSDILAALIYPVKKIFKV"
FT   gene            complement(493916..495502)
FT                   /gene="thiP"
FT                   /locus_tag="NATL1_05461"
FT   CDS_pept        complement(493916..495502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="NATL1_05461"
FT                   /product="putative iron ABC transporter"
FT                   /note="COG1178 ABC-type Fe3+ transport system, permease
FT                   component [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75108"
FT                   /db_xref="GOA:A2C0U8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0U8"
FT                   /protein_id="ABM75108.1"
FT                   /translation="MNNNRPASKAFKIEKNINFVYNLIGLNNSRYILKYLVVLLTFFIL
FT                   WPLFNLVKEGLYGIQKGSIYLTTANLNDIKGTLLLLIFSLTLGGFLGVTNGWILANCHF
FT                   KGRKVLRVCQLIPFATPAYLLAATFIDLGSIYSIRITGMLWGVVIMAFTTYPYVFLLSL
FT                   ESFEEGGRKQIEACRTLGIGPWKSFFRISLPIAIPSITAGLALMAMEIINELGAVQLLN
FT                   IPSISAGILESWVEEGEPSGAIALALFALILVFLLVAIERKSREKSKRWIDGISSVDSP
FT                   KWELKGINLFLAQVVTFTPPILTLGIPITWAIINIDQINQGFNIDLIGLTIRSFSLALA
FT                   VSLITIFISLILSISKRWHNHQWLNIFTFLSSIGYAIPGSVLALALLSFQGSIWQVNIL
FT                   SLLIWGYSIRFLAVSKGGLDAGFERISPNIDNAAINLGKNWSEVLLKIHLPLLKGPILV
FT                   GILLVFVDTIKELPLTFILRPFDFDTLSVRIFQYAGDERLAESILPSLIIICLGLIASL
FT                   ALIPSLNNRNK"
FT   gene            complement(495530..496558)
FT                   /locus_tag="NATL1_05471"
FT   CDS_pept        complement(495530..496558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05471"
FT                   /product="Putative GTPases (G3E family)"
FT                   /note="COG523 Putative GTPases (G3E family) [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75109"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0U9"
FT                   /protein_id="ABM75109.1"
FT                   /translation="MNTNVSNLNKNMASKTNIPITIISGFLGSGKTTLLNHILTNQQGI
FT                   KTAVLVNEFGEIGIDNELIIKTEEEMIELSNGCICCSINGELVEAIEKLINVNKKLDYI
FT                   IIETTGLADPLPVAMTLLGSDLRDQTRLDSIITLIDAENFNDVALESSIGRSQVIYGDI
FT                   LLLNKCDLVTNKNIEETIDKLKEIKNDVRILKSIKGNIPLNLLLSVGLFETDLINQKES
FT                   VHDHSHGHGHGHGHGHVHGHSEEDNRIEDFLSVSFQTKEPFSLRKFQYFLDNQLKSDVF
FT                   RAKGILWFSESERRHVFHLAGKRISIEDSEWGEERNNQLVFIGKELDKEKILSQLNACI
FT                   DK"
FT   gene            complement(496584..496889)
FT                   /locus_tag="NATL1_05481"
FT   CDS_pept        complement(496584..496889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05481"
FT                   /product="4a-hydroxytetrahydrobiopterin dehydratase (PCD)"
FT                   /EC_number="4.2.1.96"
FT                   /note="COG2154 Pterin-4a-carbinolamine dehydratase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75110"
FT                   /db_xref="GOA:A2C0V0"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0V0"
FT                   /protein_id="ABM75110.1"
FT                   /translation="MKYKKPMVSLIEKNQLDSFIKKNPSWIIDNKTIKKEFKFQNFIEA
FT                   FGFMSKVAILAEKIDHHPDWQNTYNKVKINLTTHDKGGITTNDIKLAESIDKLNNT"
FT   gene            complement(496891..497352)
FT                   /locus_tag="NATL1_05491"
FT   CDS_pept        complement(496891..497352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05491"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG432 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75111"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0V1"
FT                   /protein_id="ABM75111.1"
FT                   /translation="MEQILSTIDFETTGQGFTDITKDINHWIKYKKLKKGILLIFLKHT
FT                   SCSLIINENADINVLKDLSAYMNAIVPEEGVYPLNKNLKKIEYLHSEEGLDDMPAHIRT
FT                   MLTSNNLSFSVVDGKLEIGLWQAIYIWEHRTSNKSRSLQLHAIGDFDLN"
FT   gene            497581..499110
FT                   /locus_tag="NATL1_05501"
FT   CDS_pept        497581..499110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05501"
FT                   /product="Carboxypeptidase Taq (M32) metallopeptidase"
FT                   /EC_number="3.4.17.19"
FT                   /note="COG2317 Zn-dependent carboxypeptidase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75112"
FT                   /db_xref="GOA:A2C0V2"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0V2"
FT                   /protein_id="ABM75112.1"
FT                   /translation="MSKSAWQLLGDYLKDTQLLGSIQSTLYWDQNTSMPIAGSNWRGEQ
FT                   LSLLAKQLHARQSSEQFEILIKEAKSELQKSKEKDDFESQLITDRFRNIDLLEQDFNRQ
FT                   KSLDPQLVVELATAKSEGYMCWQEARKNNDFKSFSPALKKLIALRTEQSNQLCEERSCW
FT                   ETLAQPFEPNLTIDRVSELFEPLQKRLPELIQKAETITNKKSEKWDLAISDQEKLCQIL
FT                   LNDWSRDPANTAIAKSPHPFSITLGPDDYRITTRIVKGQPLSCLLATAHEWGHSLYEQG
FT                   LPSKSHQWFAWPLGQATSMAVHESQSLFWENRIARSFSFAKSFWHHFENAGAPIHSGDD
FT                   LWINLNPFTPGLNRVEADELSYGLHIMIRTELEIDLLERGLSVEDLPNEWNKRYLNLLG
FT                   VSPKNDTEGCLQDVHWSEGMFGYFPSYLLGHLISAQLTKTLEEDLGKIENLIESTEISK
FT                   ILGWLRKNVHHYGRSLDSEELVRKVSGAKLSPTYFLEYLDNKLEKLSTISK"
FT   gene            499238..499825
FT                   /locus_tag="NATL1_05511"
FT   CDS_pept        499238..499825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05511"
FT                   /product="putative inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="COG221 Inorganic pyrophosphatase [Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75113"
FT                   /db_xref="GOA:A2C0V3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0V3"
FT                   /protein_id="ABM75113.1"
FT                   /translation="MANLDQAPSRTMPNLLHILPAFANESELRVNTIVELNSNTINKYE
FT                   LITETGHLKLDRVGYSSLAYPFAYGCLPRTWDEDGDPLDIEIVNVTEPLVPGSIVEARI
FT                   IGIMTFDDGGEVDDKVIGVIADDKRMDHIQSFEQLGKHWINETTYYWEHYKDLKKPGTC
FT                   TVNGFFGVEKAVQIIKSCEERYLSEIDPNLIN"
FT   gene            complement(499840..500787)
FT                   /gene="hemC"
FT                   /locus_tag="NATL1_05521"
FT   CDS_pept        complement(499840..500787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="NATL1_05521"
FT                   /product="Porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="COG181 Porphobilinogen deaminase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75114"
FT                   /db_xref="GOA:A2C0V4"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0V4"
FT                   /protein_id="ABM75114.1"
FT                   /translation="MTLDQLRIASRRSQLAMVQTNWVRDELQRAHPDLAITIEAMATQG
FT                   DKILDVALAKIGDKGLFTKELEAQMLLGHAEIAVHSLKDLPTNLPEGLILGCITEREDP
FT                   SDALVVNEKNQIHKLETLPEGSVVGTSSLRRLAQLRYHYPHLVFKDVRGNVITRLEKLD
FT                   SGEYDCLILAAAGLQRLGFANRIHQLIPTDISLHAVGQGALGIECVSGQQKVLDILKTL
FT                   EHESTSKRCLAERSFLRELEGGCQVPIGVRTEINNNELILEGMVASLDGKRLIRDIKKG
FT                   SVSSAEEIGIDLANELKGRGAGEILEEIFKSARA"
FT   gene            complement(500947..502209)
FT                   /locus_tag="NATL1_05531"
FT   CDS_pept        complement(500947..502209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05531"
FT                   /product="Putative principal RNA polymerase sigma factor"
FT                   /note="COG568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32) [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75115"
FT                   /db_xref="GOA:A2C0V5"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0V5"
FT                   /protein_id="ABM75115.1"
FT                   /translation="MLKEKQTSKNISINQDPKNNSKKIKKTAAKVNVTKETQTLPQESS
FT                   NDLKIDLDLEADKLIAEANKVPEADIDLDDDDDNASVLSSAQEAAAKALASIKIGPKGV
FT                   YTEDSIRVYLQEIGRIRLLRPDEEIELARKIADLLQLEEEAAQFESENGHFPSVKEWAV
FT                   LADMPLTRFRRRLMLGRRAKEKMVQSNLRLVVSIAKKYMNRGLSFQDLIQEGSLGLIRA
FT                   AEKFDHEKGYKFSTYATWWIRQAITRAIADQSRTIRLPVHLYETISRIKKTTKVLSQEF
FT                   GRKPTEEEIAESMEMTIEKLRFIAKSAQLPISLETPIGKEEDSRLGDFIEADIENPEQD
FT                   VAKTLLREDLEGVLATLSPRERDVLRLRYGLDDGRMKTLEEIGQIFDVTRERIRQIEAK
FT                   ALRKLRHPNRNGVLKEYIKLN"
FT   gene            502435..502584
FT                   /locus_tag="NATL1_05541"
FT   CDS_pept        502435..502584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05541"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75116"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0V6"
FT                   /protein_id="ABM75116.1"
FT                   /translation="MYKQGSQGISQTGLSQNWIFPILDKASSLPSGWNFASSTTALKLF
FT                   TIQW"
FT   gene            502621..504864
FT                   /gene="priA"
FT                   /locus_tag="NATL1_05551"
FT   CDS_pept        502621..504864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="NATL1_05551"
FT                   /product="primosomal protein N' (replication factor Y)"
FT                   /note="COG1198 Primosomal protein N' (replication factor Y)
FT                   - superfamily II helicase [DNA replication, recombination,
FT                   and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75117"
FT                   /db_xref="GOA:A2C0V7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0V7"
FT                   /protein_id="ABM75117.1"
FT                   /translation="MNSFIFDIWLHVGREGRCFSYQDGNNLDIDLGDVVTVRLKGQRMQ
FT                   GLVVKKMKKNINSTHQNLNNFSLNNVETLVQKAAIKKEWREWLEEIALDLYVSDFQMLK
FT                   TALPPGWLGRSKLSNRPKKLWWVKLSSNNYEGKISSRQIELKKNLLLNGGGKWQKDLEA
FT                   EGFSSVLIRNFVSVGCGEREKRFYLFNSFDNEESNEKKMLKIEEPQPLTLEQKLAKEKY
FT                   ESLPNGSALLLWGVTGSGKTEVYLQIAAQELSESRHCLILTPEIGLVPQLVDRFRKRFG
FT                   LNVFEYHSNCSPKEKIETWKRALDNTKPSVFIGTRSAIFLPLSSLGLIVLDEEHDSSFK
FT                   QESPMPCYHARELAIHRAKKTSAKVILGTATPSLNVWKNLKPNGNVVVAKLTKRISNRK
FT                   LPTVSVVDMREELALGNRSLISRYLKKQLLSIKESGNQAIVLVPRRGYSSFLSCRSCGE
FT                   VVQCPHCDISLTVHRSKEGNQWLRCHWCDFRSKISDKCGECGSNAFKPFGTGTQRVMDH
FT                   LERELEGISLLRFDRDTTRGRDGHRLLLERFADGDADILVGTQMLSKGMDLPKVTLAVV
FT                   LAADGLLYRPDLMATEETLQLFMQLAGRAGRGEQPGKVVVQTYCPDHPVILHLIDGSYE
FT                   EFLKKEEKTRKEASMVPYSRACLLRFSGESSELASQGAFNVLSKIKNACSQKGWKLVGP
FT                   APSLVERVAGKSRWQLLLYGPESSHIPLPYGPELWKDLPKGVTLSIDPDPLQL"
FT   gene            complement(504878..505969)
FT                   /locus_tag="NATL1_05561"
FT   CDS_pept        complement(504878..505969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75118"
FT                   /db_xref="GOA:A2C0V8"
FT                   /db_xref="InterPro:IPR021499"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0V8"
FT                   /protein_id="ABM75118.1"
FT                   /translation="MSNIASAIKATEAALEKGDYGICIKIIDPLLLDFQAETEIGGQLR
FT                   LLIVTAYMGKGNEQKAINICQTLIHNKEESIRQQAKQLLSILDAPRLPKPSNWSVEIPK
FT                   LEMEPSLKSSVSKAKKKREKIYHPPTGPTKNLDFGFSIITLLIILLITFLLSGCVDIST
FT                   NLSVTGPDRLKISLDIDSNYGESIPWQMEFEENLSKKHSILKLQTHEDKQHFESPTIRF
FT                   EEVNKLFQEIVLVASKASGFSINKPEIITNNKNWIIGTSQNFKIYFDLREIPKIPGLTL
FT                   NIVIDGIDNKNNFKTKPLEPTFNQGLTSFPIEIGQINQLEISNWKWNQISVGIILIIAL
FT                   TLLSLSLQRLRLQMGFGFPELPP"
FT   gene            complement(505970..506884)
FT                   /gene="argB"
FT                   /locus_tag="NATL1_05571"
FT   CDS_pept        complement(505970..506884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="NATL1_05571"
FT                   /product="Aspartokinase superfamily:Acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="COG548 Acetylglutamate kinase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75119"
FT                   /db_xref="GOA:A2C0V9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0V9"
FT                   /protein_id="ABM75119.1"
FT                   /translation="MNKEIQQANHSKNINKPFTDKDSIRVSVLSEALPYIQRFANKRIV
FT                   IKYGGSAMADKTLQNAVFRDLALLSSVGVQIVVVHGGGPEINQWLEKLGIKPVFLDGLR
FT                   ITDTETMDVVEMVLTGRVNKQIVSGINNHGRLAVGLCGIDGGLIEARTLGGGSHGLVGE
FT                   VAKVNTKILSPLLEEGYVPVISSVANSSDGRSHNINADTVAGELAAALGAEKLILLTDT
FT                   PGILRNENDPSSLIEKIRLSEARELIDQGIVKAGMKPKVECCIRSLAQGVNAAHIIDGR
FT                   TPHSLLLEVFTDAGIGTMVMGRG"
FT   gene            complement(506877..507440)
FT                   /locus_tag="NATL1_05581"
FT   CDS_pept        complement(506877..507440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75120"
FT                   /db_xref="GOA:A2C0W0"
FT                   /db_xref="InterPro:IPR021275"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0W0"
FT                   /protein_id="ABM75120.1"
FT                   /translation="MNKLLSPASLITIGGASLSLIGLTAYFTDATNLSVPTFFYGVPIF
FT                   LIGISLKTTEVPPALRVVPATKFASERDRAPEELGKLVKDVTRWRYGQSCQLEASLRVL
FT                   KLWDIDNPPQLIEVEELVKEGNYGIRMRFEMAAVSLERWNAQKERLGRFFAKGLCAELF
FT                   CPTPGAIDLILLPQKQEDNPQENE"
FT   gene            507495..507686
FT                   /locus_tag="NATL1_05591"
FT   CDS_pept        507495..507686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05591"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75121"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0W1"
FT                   /protein_id="ABM75121.1"
FT                   /translation="MASHQKQFSELNELVEKLNKDRAWILEQLDKGSWPEFRPDLAALE
FT                   RELGQLLTRAAEYIEENG"
FT   gene            complement(507692..508129)
FT                   /locus_tag="NATL1_05601"
FT   CDS_pept        complement(507692..508129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05601"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /note="COG629 Single-stranded DNA-binding protein [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75122"
FT                   /db_xref="GOA:A2C0W2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0W2"
FT                   /protein_id="ABM75122.1"
FT                   /translation="MNHCMLEVLVKKAPTVRFTQDNKTPLAEIEVEFDSLRADDPPCSI
FT                   KVVGWGKLAEELQNTVQVNSKLVIEGRLRMNTVPRQDGTKEKQAEFTLSRIHPFSSKTA
FT                   LSSIPSQTQSNIKSDSANPLNNEGVKWDSSPLVPDTDDIPF"
FT   gene            508162..508971
FT                   /gene="cobK"
FT                   /locus_tag="NATL1_05611"
FT   CDS_pept        508162..508971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobK"
FT                   /locus_tag="NATL1_05611"
FT                   /product="possible precorrin-6X reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="COG2099 Precorrin-6x reductase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75123"
FT                   /db_xref="GOA:A2C0W3"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0W3"
FT                   /protein_id="ABM75123.1"
FT                   /translation="MDIREKCQPHLWLLTGTGEGHVFAESLLKEGWKITVSVVSDRASI
FT                   PYEKLNLEKILIGALITEEEIRGVILNARIHQNGFHCVVDLTHPFAMKITRSISKVCKE
FT                   LGQTFIRYERAIDNISNAFLIEKFSDLRNYDLKNKSILLAVGVRHLQEAFVFARNSGAN
FT                   VYARVLANPESIRKTLSSSIQKTNFAVLNPSVSSNGKIEKALVRKWNIAGVICRQSGGS
FT                   NEILWHRICLSMRINLWLLERPTEFKNINSVDSYEKLNKKLKSISME"
FT   gene            508987..509310
FT                   /gene="cutA"
FT                   /locus_tag="NATL1_05621"
FT   CDS_pept        508987..509310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="NATL1_05621"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="COG1324 Uncharacterized protein involved in
FT                   tolerance to divalent cations [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75124"
FT                   /db_xref="GOA:A2C0W4"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0W4"
FT                   /protein_id="ABM75124.1"
FT                   /translation="MSLSGFNQEIYLVITTEVDKKNASKLANLLLREKLIPCVTFKNIE
FT                   SHFWWEGNINQSQEVQLMIKCKKENLDNVCNKISELHSYEIPEIIYFRVSANKNYHHWM
FT                   NSI"
FT   gene            complement(509322..510329)
FT                   /locus_tag="NATL1_05631"
FT   CDS_pept        complement(509322..510329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05631"
FT                   /product="Possible carbohydrate kinase"
FT                   /note="COG524 Sugar kinases, ribokinase family
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75125"
FT                   /db_xref="GOA:A2C0W5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0W5"
FT                   /protein_id="ABM75125.1"
FT                   /translation="MTNETNAASLDIVGIGNAIVDVLTTIDDSFLKKLSFDKGSMTLID
FT                   ENKAKELYEMTTNRIQKSGGSVANSLACVAQLGGKAAFIGRVRDDKLGEIFTEEISTTG
FT                   TIFKTPPSSVGPSTARCIIFVTPDAQRTMCTYLGASVLLEPKDIDLSLVKEAKILYLEG
FT                   YLWDNPAAKNAFIKAAEIAKNAGRKVALSLSDSFCVSRHRESFIKLVDDHIDILFANED
FT                   EITNLYETSSLSKALEKLKKKCDLAAITIGEKGSILISNGKEIKIDPFILGKAVDTTGA
FT                   GDLYAGAFLKGYADGLKPELSAKIGSICAGQIVTELGSRSNTDLLNLINSYLEN"
FT   gene            complement(510371..511684)
FT                   /gene="purA"
FT                   /locus_tag="NATL1_05641"
FT   CDS_pept        complement(510371..511684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="NATL1_05641"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="COG104 Adenylosuccinate synthase [Nucleotide
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75126"
FT                   /db_xref="GOA:A2C0W6"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0W6"
FT                   /protein_id="ABM75126.1"
FT                   /translation="MANVVVIGAQWGDEGKGKITDLLSRSADVVVRYQGGVNAGHTIVV
FT                   EDKVLKLHLIPSGILYPDTICLIGSGTVVDPKVMIKEIKMLEDNDIDISGLKLASTAHV
FT                   TMPYHRLLDLAMEQKRGDQKIGTTGRGIGPTYADKSQRNGIRIIDLMSREKLQERLQVP
FT                   LSEKNGLLQKIYGIEPLIIDEIIEEYLDYGKQLKKHIVDCNRTIHQAARKKKNILFEGA
FT                   QGTLLDLDHGTYPYVTSSNPVSGGACIGAGVGPTLIDRVIGVAKAYTTRVGEGPFPTEL
FT                   HGSINDQLCDRGGEFGTTTGRRRRCGWFDGVIGKYAVEVNGLDCLAITKLDVLDELEEI
FT                   DICVAYELNGKRIDYFPTSVEDFEKCNPIFKKLPGWRCSTENCRRLEDLPPAAMSYLRF
FT                   LAELMEVPIAIVSLGANRDQTIVIEDPIHGPKRALLNS"
FT   gene            complement(511780..512214)
FT                   /gene="psb27"
FT                   /locus_tag="NATL1_05651"
FT   CDS_pept        complement(511780..512214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psb27"
FT                   /locus_tag="NATL1_05651"
FT                   /product="possible Photosystem II reaction center Psb27
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75127"
FT                   /db_xref="GOA:A2C0W7"
FT                   /db_xref="InterPro:IPR017488"
FT                   /db_xref="InterPro:IPR025585"
FT                   /db_xref="InterPro:IPR038450"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0W7"
FT                   /protein_id="ABM75127.1"
FT                   /translation="MISAFHRLSIRLVRAALAICLGFCLIFFQFASEVNAAKTLMTGDF
FT                   AKDTIAVSSTLKETITLPKEDKGLSEAEKEAVFLISDYISRYRNRSQVNTSTTFTTMQT
FT                   ALNALSGHYKTFANRPVPENLKERLNKELSKAEKLAVRDS"
FT   gene            complement(512261..514051)
FT                   /gene="proS"
FT                   /locus_tag="NATL1_05661"
FT   CDS_pept        complement(512261..514051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="NATL1_05661"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="COG442 Prolyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75128"
FT                   /db_xref="GOA:A2C0W8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0W8"
FT                   /protein_id="ABM75128.1"
FT                   /translation="MRVSRLMLNTLRDVPSEADIISHQLLVRGGYIKRITGGIYAYMPL
FT                   LWKVLKKITSIVEEELSTKGCLQTLLPQLQPSEIWERSGRWKSYTQGEGIMFSLKDRQG
FT                   KELGLGPTHEEVITQIISQTIHSYKQLPINIFQIQTKFRDEIRPRFGLMRSREFIMKDA
FT                   YSFHANENDLQSTYSDMRNAYQNIFTKCGLDFVCVDADSGAIGGAASQEFMVTAESGED
FT                   LILISSDGKYGANQEKAVSIIEEGNLLEPNKPSIIKTPNQKTIDELCNYNDFHPSQIVK
FT                   VLAYLATCDDNKKYPVLVSIRGDQEINDIKLSNKISQELKKNVLDIRIIYNEDMQKQGI
FT                   TNIPFGFIGPDLSDNLLAQSKGWEKKFIRIADNSAKDLKSFICGNNIKDEHKIFYNWNL
FT                   INTVQLICDIRKAKPGDRCIHDKTQKLEECRGIEIGHIFQLGTKYSKSLNATFTNEKGI
FT                   EDHLWMGCYGIGISRLAQAAVEQNHDDLGIIWPTSIAPFTVIIIIANIKNNDQKCLAED
FT                   IYQKLIQNRVDVLLDDRDDRAGIKFKDADLIGIPWRIVAGREASSGLVELHNRKTKTTE
FT                   LLDLNSVLKKLSEEFNTEKL"
FT   gene            514226..514687
FT                   /locus_tag="NATL1_05671"
FT   CDS_pept        514226..514687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05671"
FT                   /product="possible Helix-turn-helix domain of resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75129"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0W9"
FT                   /protein_id="ABM75129.1"
FT                   /translation="MFNGSVNSGTNGRSEEFLDKGLNTASNSSDSLLTIDEVQKTLNRS
FT                   RASVYRYTNTDTRNLNPPFNPRKLNTEFRSDQKDQLLFHPNEVARFAKDILRIKEVTLE
FT                   ILNSPSSETQNILNAILDELRIIRNKIDGQADKNHSIPNHLQDPDKKAA"
FT   gene            514791..515039
FT                   /locus_tag="NATL1_05681"
FT   CDS_pept        514791..515039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05681"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75130"
FT                   /db_xref="GOA:A2C0X0"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0X0"
FT                   /protein_id="ABM75130.1"
FT                   /translation="MDLEPHLINKQSPEIDPPLLNKEKDQLSADDEDPYSFNSTSTSLI
FT                   GLAIVFVMLGIPLLAVISERPETTKSLTTSINQNGPE"
FT   gene            515026..515553
FT                   /locus_tag="NATL1_05691"
FT   CDS_pept        515026..515553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05691"
FT                   /product="Inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="COG221 Inorganic pyrophosphatase [Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75131"
FT                   /db_xref="GOA:A2C0X1"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0X1"
FT                   /protein_id="ABM75131.1"
FT                   /translation="MDLSDLPPSPSPGLVNLVVEIPAGSRNKYEYFSSAGIMALDRVLH
FT                   SSVKYPFDYGFVPNTLAEDGAPLDAMVVMEEPTFAGCLIQARPIGVLDMHDSGAYDGKL
FT                   LCVPTADPRQREINTIKQIAQDQLEDVAEFFRTYKSLEGRVIEIDGWRDYDAVDELLKS
FT                   CIEAHHLEITQK"
FT   gene            515572..515952
FT                   /gene="arsC"
FT                   /locus_tag="NATL1_05701"
FT   CDS_pept        515572..515952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="NATL1_05701"
FT                   /product="putative arsenate reductase"
FT                   /note="COG1393 Arsenate reductase and related proteins,
FT                   glutaredoxin family [Inorganic ion transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75132"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0X2"
FT                   /protein_id="ABM75132.1"
FT                   /translation="MGKLIFLGFENLKLFNYSSCSTCRRAIKWLKNNDITFELIDLLKS
FT                   PPSKEMLISASELYGDRKYLINTSGFIYRSIGSDAVKKMSDNEFFEQLFIEPRLIKRPF
FT                   LYKSNKCFLVGFKEEKWAEKLL"
FT   gene            516035..516727
FT                   /locus_tag="NATL1_05711"
FT   CDS_pept        516035..516727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05711"
FT                   /product="Signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="COG681 Signal peptidase I [Intracellular trafficking
FT                   and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75133"
FT                   /db_xref="GOA:A2C0X3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0X3"
FT                   /protein_id="ABM75133.1"
FT                   /translation="MKQNYSDSTKEAKNCWWYSFFDTWGPISLTILLYVGIRHFIAEAR
FT                   YIPSGSMLPGLKINDRLIVEKLSLRKRKPSRGEIVVFNSPYSFDQQLIADRTKQLPSKF
FT                   QCSLITFPLISWIPALSDRACDAYIKRIVAVGGDRLLINGKGEINLNGRSINEPYVMNF
FT                   CPSKPKFNLCPPMTSTVPKGHVFVLGDNRANSWDSRFWPGGGFLPHKEIIGKASWRFWP
FT                   INRFGKLN"
FT   gene            complement(516869..518197)
FT                   /gene="gpmB"
FT                   /locus_tag="NATL1_05721"
FT   CDS_pept        complement(516869..518197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="NATL1_05721"
FT                   /product="possible alpha-ribazole-5'-P phosphatase"
FT                   /EC_number="5.4.2.-"
FT                   /note="COG406 Fructose-2,6-bisphosphatase [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75134"
FT                   /db_xref="GOA:A2C0X4"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0X4"
FT                   /protein_id="ABM75134.1"
FT                   /translation="MTLRLIFVRHGLSSFNKEGRIQGRNDLSTLTKEGQLQAEAAGRTI
FT                   SSIPIDAVYSSPLQRASETTKIIIKEHQSELKVTYTNELLEVDLGPWSGLTKNEIKNQF
FT                   PEELSIWQKEPKELTINRDDGSKFQPIKELLYQAENFLKSLFDAHSGSNKTILIVAHNA
FT                   ILRCLILKLINEPSKGFRRLKLDNTSISICNINFNDWNDRQVQIQCLNNIAHLHPTIPK
FT                   KSSKKRIILVRHGETDWNKQGRFQGQIDIPLNKNGKSQAKAASEFLKPNIIQKAFSSSL
FT                   SRPKETAQIILNEHPGIEITLKDNLIEIGHGKWEGKLESEIKTDWPDLLQTWKISPEKV
FT                   QMPEGENIKEVSTRSITGWDEICQDLKNNETALVVAHDAVNKTILCHLLGLMPSNIWMI
FT                   KQGNGGVTVIDLSDKDGEPDQITCLNITSHLGGIIDSTAAGAL"
FT   gene            518307..519653
FT                   /locus_tag="NATL1_05731"
FT   CDS_pept        518307..519653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05731"
FT                   /product="Possible membrane associated protease"
FT                   /note="COG1266 Predicted metal-dependent membrane protease
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75135"
FT                   /db_xref="GOA:A2C0X5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0X5"
FT                   /protein_id="ABM75135.1"
FT                   /translation="MRQAKTGWKWAIALFSLLLTVLIWQQGLQESFERPSVAPKISLMQ
FT                   TEMAVSASSSLPETIQEVFLGSEPQEKLYQALSDIPLGQIEDRERLLLAILEESENEQK
FT                   FILKEGFSDKNFETVKGYILNREKGKEIDRFPDFDEIELDPLLYQISCSSLGFADEKCI
FT                   NKKYNFYTALRLLTSQLFPFFASIAGSVLLIRYAFIFLRKKNTPWPEMISPPLSVIDMV
FT                   LLISGGFVVIGEVVFPALIIPITDLLFNNLSSPLNQSLRVFIGYCSMTIAPLFIIRYQL
FT                   MGLVPSGIDGGWLQWKIRPIKEGLFKSISGWLMIMPLVLLIGWLMNEIIGDQGGSNPLL
FT                   ELVLGSDEFFPLFLLLITTVVLAPVFEELVFRGILLPVLVSKVGKASGVLLSALIFALA
FT                   HLSVGELPPLFVLGIGLGLMRLSSGRLFPCALMHSLWNGVTFISLLLVA"
FT   gene            519738..520202
FT                   /locus_tag="NATL1_05741"
FT   CDS_pept        519738..520202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05741"
FT                   /product="conserved hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75136"
FT                   /db_xref="GOA:A2C0X6"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0X6"
FT                   /protein_id="ABM75136.1"
FT                   /translation="MISRTQYIQKVGQFQKKKLSKELLYSVFSSKQVQRKFPIQAALHL
FT                   VLDGALVGILMTVAIMSSVALHSQYLWTKSFTKLETTRDLNRRTLESTSILESYLLKNQ
FT                   KLSRNLVSTKAEDLIYVDRPKPEDTKKLFDVTLKSRFLEKISSFPVKSGY"
FT   gene            520211..522007
FT                   /locus_tag="NATL1_05751"
FT   CDS_pept        520211..522007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05751"
FT                   /product="putative peptidoglycan synthetase (pbp
FT                   transpeptidase domain)"
FT                   /EC_number="2.4.1.129"
FT                   /note="COG768 Cell division protein FtsI/penicillin-binding
FT                   protein 2 [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75137"
FT                   /db_xref="GOA:A2C0X7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0X7"
FT                   /protein_id="ABM75137.1"
FT                   /translation="MRSSDHRKKRKTFKVNTLQPLSQSRFRIIFFLLCLGLGGLFLRVG
FT                   WLQLFQSDQLRALAREVQTEQKTPLGTRRSILDRNGKLVAIDERRFKIWAHPRYFNFPG
FT                   DSSRTVRKPVEVAKLLSSPLSISVDDILKKLGNYSSGVKLAEGVTPEQANAIKKLGISG
FT                   IDLEVYPQRLYPHGSLFANVVGFLDLDRRPQAGLELSLDGDLKRLEKASLIRRGADGTP
FT                   LPTGVQRGVFDEDQLSLQLTLDVRLQEVAIKEISKQVKKWNAKKGVVIVMDIDTGELLA
FT                   LASTPTYDPNKYWDYSPSLFKEWSVQELFEPGSTFKPINLALALEEGVISPNGEVNDDG
FT                   LVTVGGWPLSNWDRRPNGILTFPEVLQVSSNVGMVKIMNKLNASIYWQWLRRLGIDEIP
FT                   DTDLPGAVSGQIKSKQTFVNQPIEPAVASFGQGFSVTPLKLAQLHALIANGGRLVTPHI
FT                   TKGLKGDYESYFNSPSEPKQVLSPEVTKTVLGWMETVVSFYDESGIEVDVPGYRIGGKT
FT                   GTAQKSQDGFNYNSKICSFVASLPIDDPRYVVLAVIDEPQKPNAYGSTVALPVAKKIIE
FT                   TLLVIEKIPPSISKKEHLASKS"
FT   gene            522100..523098
FT                   /gene="tal"
FT                   /locus_tag="NATL1_05761"
FT   CDS_pept        522100..523098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="NATL1_05761"
FT                   /product="Transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="COG176 Transaldolase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75138"
FT                   /db_xref="GOA:A2C0X8"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0X8"
FT                   /protein_id="ABM75138.1"
FT                   /translation="MESLLNQLSSMTVVVADTGDLEAIKKYHPRDATTNPSLILAAAQM
FT                   PAYQSLIDQALTTSREMLGTSAAKVDVVKEALDELCVVFGKEILKLIPGRVSTEVDARL
FT                   SFDTDATIEKARKIIAKYNADGISNDRVLIKIASTWEGIKAAEVLEKENIHCNLTLLFN
FT                   FYQAVACAEAGVTLISPFVGRILDWYKSATGRDSYPATEDPGVVSVTKIFNYFKSNGYK
FT                   TEVMGASFRNIEEITELAGCDLLTISPKLLQQLNETHTDLPIKLNAQKPLVIEEKIHLD
FT                   QTSFELMMAGDKMATEKLDDGISGFSKAIDKLENQLNERLELIEGGVALTL"
FT   gene            complement(523102..524232)
FT                   /gene="fixC"
FT                   /locus_tag="NATL1_05771"
FT   CDS_pept        complement(523102..524232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="NATL1_05771"
FT                   /product="NAD binding site"
FT                   /note="COG644 Dehydrogenases (flavoproteins) [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75139"
FT                   /db_xref="GOA:A2C0X9"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0X9"
FT                   /protein_id="ABM75139.1"
FT                   /translation="MTLIDVAIIGGGASGTTTAFHLASKSKKVCILEKNVSSPEKICGG
FT                   GMSAAVQNWFPFRLLPIVDEVITNVEFSWCNTDKVVAKLSGSSPFWIVKRERLDSFLLD
FT                   QALNSGCNLLTTFNVVDIRKQSNVWHITALDGRQIEARAVVIADGSQSPWSKTFNLGPP
FT                   QQKFASTFSGRIKRRGNLRTETARFEFGLVKNGFAWAFPLDNEVNIGMGTFLDNKNSLP
FT                   VNEILKSFLPDLGFDPSEVIGHEKKLRIWNGHYKLNGEGILLVGDAASLCDPFLAEGLR
FT                   PALMSGFEAAKSLIYWLDGEVSCLDAYTKTMQINWGNSMAWGKRISQVFYRFPKVGYQL
FT                   GVKRATAPKRIAQILSGEMSYEDIAKRVIKRLLFQN"
FT   gene            complement(524229..524777)
FT                   /gene="frr"
FT                   /locus_tag="NATL1_05781"
FT   CDS_pept        complement(524229..524777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="NATL1_05781"
FT                   /product="Ribosome recycling factor"
FT                   /note="COG233 Ribosome recycling factor [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75140"
FT                   /db_xref="GOA:A2C0Y0"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0Y0"
FT                   /protein_id="ABM75140.1"
FT                   /translation="MSNQELKNTMSKSVEAAQRNFNTIRTGRANTSLLDRISVEYYGAE
FT                   TPLKSLATITTPDSQTIAIQPFDLGSLASIEKAIATSDLGFTPNNDGKIIRINVPPLTE
FT                   ERRKEFCKLASKYAEEGKVALRNIRREAIDRVKKSEKDGDLSEDQSRDEQEKIQKETDN
FT                   FIKDIEKKLSEKEAEILKV"
FT   gene            complement(524828..525541)
FT                   /gene="pyrH"
FT                   /locus_tag="NATL1_05791"
FT   CDS_pept        complement(524828..525541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="NATL1_05791"
FT                   /product="uridylate kinase"
FT                   /note="COG528 Uridylate kinase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75141"
FT                   /db_xref="GOA:A2C0Y1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0Y1"
FT                   /protein_id="ABM75141.1"
FT                   /translation="MTYSRALIKLSGEALMGDKPYGIDPEIVQSIAKDVSKVVENGTQI
FT                   AIVVGGGNIFRGLKGSAAGMDRATADYVGMLATVMNAITLQDGLERAGVPTRVQSAIDM
FT                   QQIAEPYIRRRAIRHLEKGRVVVFGGGCGNPFFTTDTTAALRAAEINAEVVFKATKVDG
FT                   VYDRDPKKFTDAVKYDNLTFQDVLANEIGVMDSTAIALCKDNKIPIVVFNIFQPGNIAK
FT                   AISGEPIGSRISNSS"
FT   gene            complement(525639..526331)
FT                   /gene="cobO"
FT                   /locus_tag="NATL1_05801"
FT   CDS_pept        complement(525639..526331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /locus_tag="NATL1_05801"
FT                   /product="possible cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="COG2109 ATP:corrinoid adenosyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75142"
FT                   /db_xref="GOA:A2C0Y2"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR025826"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Y2"
FT                   /protein_id="ABM75142.1"
FT                   /translation="MKNKITKEDSRLNKLDKSAEKIGMGGNLIPNITEEKYKERMQKRK
FT                   EVQTQRLKERKKEKGLIIVNTGQGKGKTTAALGMGLRTIGHNHNVAIIQFIKGGWEPGE
FT                   SLAFKIFGDKLKFHACGEGFTWETQDRNRDINLVKSSWRKAVSYIKDPNYKLIILDEII
FT                   VAIKLGYIDEDEIINGINLRPELTHIVLTGRGASEKLIDSADLVTEMKLIHHPFREQGI
FT                   KAQEGIEY"
FT   gene            complement(526414..527574)
FT                   /locus_tag="NATL1_05811"
FT   CDS_pept        complement(526414..527574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05811"
FT                   /product="Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75143"
FT                   /db_xref="GOA:A2C0Y3"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Y3"
FT                   /protein_id="ABM75143.1"
FT                   /translation="MDENQKLLDINQDLESKGINLRIEKRGKVLNIRGSLPDKKSHDLS
FT                   KVQRISLKLPHDINGLEEARKAIELIDFQLKKNQFCWSNWIKEKALSSTKTNKTVISNE
FT                   IESFKRQFFSDTSRSKSSAGMISTWQSAYKPYLNRLIGVSHKSTLKLSEELLVKILLSY
FT                   KENSRSRQQCGIALSALARHLKVELPKNWKQLQSGYGIHESNFRELPSDKEIINSFQLI
FT                   PNPKWRFVFALMAIYGLRNHEVFFSDLSCLKKGGDKILRVFPNTKTGEHQVWPFHPEWV
FT                   GLFELGNITDTSDLLPDIKTDLKETTLQHIGRRVSEQFRRYEISFTPYDLRHAWAVRTI
FT                   LIGLPNTVAAKMMGHSVSIHTKTYHHWITRRDQQIAVDSALSRVKY"
FT   gene            527646..528821
FT                   /gene="hemH"
FT                   /locus_tag="NATL1_05821"
FT   CDS_pept        527646..528821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="NATL1_05821"
FT                   /product="Ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="COG276 Protoheme ferro-lyase (ferrochelatase)
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75144"
FT                   /db_xref="GOA:A2C0Y4"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0Y4"
FT                   /protein_id="ABM75144.1"
FT                   /translation="MARVGVLLLNLGGPERIKDVGPFLYNLFSDPEIIRLPVRAFQKPL
FT                   AWLISLLRSSKSQEAYRSIGGGSPLRRITEQQARELQSYLRNIGIDATTYVAMRYWHPF
FT                   TESAVADMKADGVSEVVVLPLYPHFSISTSGSSFRELKRLKDSDDEFAELSIRCIRSWF
FT                   DHPAYVSSMAELIKKQILACDLPQESHVFFTAHGVPKSYVEEAGDPYQDQIQNCSLLII
FT                   DQLENSLGFTNSFSLAYQSRVGPEEWLKPYTEEVLEKLGKSGVKELVVVPISFVSEHIE
FT                   TLQEIDIEYKEIAQKNGIVNFKRVPALDIYPLFIEGLADLVSSCLNGEGISLEEASKLP
FT                   ERVKLYPQEKWQWGWNNSSEVWNGRVAMIVFLCFLMELIIGGGPLHQIGLL"
FT   gene            528967..530730
FT                   /gene="ilvB"
FT                   /locus_tag="NATL1_05831"
FT   CDS_pept        528967..530730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="NATL1_05831"
FT                   /product="Acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="COG28 Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase] [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75145"
FT                   /db_xref="GOA:A2C0Y5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Y5"
FT                   /protein_id="ABM75145.1"
FT                   /translation="MTLTSTPNQIEDSGTQTQHEMSGADALMDSLRRHGVDTIFGYPGG
FT                   AILPIYDAVFKAEQEGWLKHILVRHEQGGTHAADGFARATGKVGVCFGTSGPGATNLVT
FT                   GIATSQMDSVPLVVITGQVPRPAIGTDAFQETDIFGITLPIVKHSWVVRDPSEIAKVVA
FT                   QAFLIASSGRPGPVLIDIPKDVGQEMFKYLPVEPGSIKPLGFELPFAPEHKAISSALDL
FT                   IENAEQPLLYVGGGVISSGAHETLAAIANRYQIPVTTTLMGKGAFDERDPLSVGMLGMH
FT                   GTAYANFAVTECDLLIAIGARFDDRVTGKLDTFAPKAKVIHFEIDPAEINKNRVVEVSV
FT                   LGDVGISLVKLLDLSNQRKTNPRTSQWLNKIKNWKNNFPLITPPKEGEIYPQEVLIALR
FT                   DLAQDAYITTDVGQHQMWAAQYLLNGPRQWISSAGLGTMGFGMPAAMGVKVALPKEKVI
FT                   CIAGDASILMNIQELGTIAQYKLNLKVIIINNHWQGMVRQWQESFYDERYSASNMSVGE
FT                   PDFISLSKAFGIEGIVISERENLIPQLQKALENEGPVLVNVNVRKGENCYPMVPPGKSN
FT                   AEMVGISEIKK"
FT   gene            530745..531092
FT                   /locus_tag="NATL1_05841"
FT   CDS_pept        530745..531092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05841"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75146"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Y6"
FT                   /protein_id="ABM75146.1"
FT                   /translation="MNKFFTKILILLVSLFWFHSAVDAAEVLQVTSSSVLLIGDHNRTY
FT                   TVKLACTEITPDLEEESLKWLKKQLPRHTKVNLKPKGSVNGVLVSKVIPFDSGIDITEK
FT                   YINEGLATNKC"
FT   gene            complement(531392..532279)
FT                   /locus_tag="NATL1_05851"
FT   CDS_pept        complement(531392..532279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05851"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75147"
FT                   /db_xref="GOA:A2C0Y7"
FT                   /db_xref="InterPro:IPR009472"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Y7"
FT                   /protein_id="ABM75147.1"
FT                   /translation="MIASKRSDLKKTDWEIDFYSRPIIDENGKKRWELLITSTNNFKDK
FT                   KTFKWEKICPASSVNSIWLKDAFDEAIDEAYSQGWDKPSVIRCWRSSMKTMIKRAADQI
FT                   GIELISSRRTYSLLEWLIERERSFYPQQKGYTGVNLAPPSNPITNQAIPLPEEVRGESW
FT                   SFASLSLNTLREADEWEIEFSNLIPIKDSINENISIPGIRLFSPKRSLALAAWLGGLEP
FT                   AKLLIEGTQIILEAGQADRWLVTDVEEEAKKVIENNFQNTKLYADGLQFISVQKSPEEN
FT                   SLDGFWMLKDIEEY"
FT   gene            complement(532303..533700)
FT                   /gene="rps1b"
FT                   /gene_synonym="nbp1"
FT                   /gene_synonym="rpsA2"
FT                   /locus_tag="NATL1_05861"
FT   CDS_pept        complement(532303..533700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps1b"
FT                   /gene_synonym="nbp1"
FT                   /gene_synonym="rpsA2"
FT                   /locus_tag="NATL1_05861"
FT                   /product="30S ribosomal protein S1 protein B, putative
FT                   Nbp1"
FT                   /note="COG1098 Predicted RNA binding protein (contains
FT                   ribosomal protein S1 domain) [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75148"
FT                   /db_xref="GOA:A2C0Y8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Y8"
FT                   /protein_id="ABM75148.1"
FT                   /translation="MLKSASLKNDRNLLIIKKQLTLDCKNVSLITKGIMAGSDPQPKKA
FT                   TPPRPAINAPRKPLQVMHISRKPEEEIINEGSSEKEFSEQPKDRRFDEKVLAPKEISYL
FT                   KKAPEQQKSIGQDSSDDFQSATMEDLLRSENNTNYKNNIEAFDDQNIFEQKSRTVDEFD
FT                   FDEDEFLAALEENQPIGTTGEIAKGSVIAVESDGIYVDIGGKAPGFMPKNECGLGVITN
FT                   LKERFPKGLKVEVLVTREQNADGMVTISCRALELRKSWDKVQNLAKEGKVIRVKINGFN
FT                   RGGVTCDFEGLRGFIPRSQLEDGENHQSLVSKTISTAFLEVNPERRKLVLSEKKAAIAS
FT                   RFSELEIGQLIEGEILTIKPYGFFVDLRGVSGLLHHSMVTNGSMRSLREVFQPGESIKA
FT                   LITDLDPSRGRIGLNTALLEGPPGELITDKTKVMEEANERAIKARNSLNKEKVDPQKEK
FT                   EDINLSS"
FT   gene            533701..534498
FT                   /locus_tag="NATL1_05871"
FT   CDS_pept        533701..534498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05871"
FT                   /product="Creatininase"
FT                   /EC_number="3.5.2.10"
FT                   /note="COG1402 Uncharacterized protein, putative amidase
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75149"
FT                   /db_xref="GOA:A2C0Y9"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Y9"
FT                   /protein_id="ABM75149.1"
FT                   /translation="MTWPEASKAASENGSTLVWPFGACEQHGPHLPLITDTFFAENILI
FT                   KTLDRLPENMPIWMMPSQSIGFSPEHQAFPGTLSLSADVLLSMVTDVGQQIASMGFNRL
FT                   VFFNAHGGQIGLLQAVSRQLRIQCPSIAVLPCFLWSGVPELDQLLPEKEVEEGLHAALA
FT                   ETSLMLHMAEDLVRNDSYLEIKNVDKQIVTTPKGWSLEGASPCAWLTEDLSSSGVIGDA
FT                   SSSNSELGAALENALVDHWKSLFTSLLESDWPPIRSERPVSSS"
FT   gene            534573..535298
FT                   /locus_tag="NATL1_05881"
FT   CDS_pept        534573..535298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05881"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75150"
FT                   /db_xref="GOA:A2C0Z0"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR022612"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Z0"
FT                   /protein_id="ABM75150.1"
FT                   /translation="MQAFASNNLTVEKEELSSDSLPDFTSESYKDAYSRINAVVIEGEQ
FT                   EAYSNFLDLAKLIPEHADELVRLGKMEKKHMNGFCACGRNLAVKPDMPFAKTFFSKLHN
FT                   NFLEAFKVGDTTTCLLIQCILIESFAISAYHVYIRVADPFAKRITEGVVQDEYLHLNYG
FT                   QEWLKANLETVKKDLMRANKENLPLIKSMLDEVSNDAEVLHMDKEELMEEFMIAYQDSL
FT                   LEIGLDNREIARMALAAVI"
FT   gene            535445..536485
FT                   /locus_tag="NATL1_05891"
FT   CDS_pept        535445..536485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05891"
FT                   /product="Predicted dehydrogenase"
FT                   /note="COG5322 Predicted dehydrogenase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75151"
FT                   /db_xref="GOA:A2C0Z1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR016836"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Z1"
FT                   /protein_id="ABM75151.1"
FT                   /translation="MFGLIGHSTSFEDAKRKALGLGYDHIAEGDLDVWCTAPPQLVENV
FT                   KVVSAIGKTIEGAYIDSCFVPEMLSRFKTARRKVLNAMELAQKKGISITALGGFTSIIF
FT                   ENFNLLQNQQVRNTTLDWQRFTTGNTHTAWVICRQLEQNAPRIGIDLSKSKVAVVGATG
FT                   DIGSAVCRWLSNRTGVSELLLVARQQKPLLELQSQLGGGRILSLDDALPEADIVIWVAS
FT                   MPKTLEIDPSKIKRPCLMIDGGYPKNLGEKFSGPGIHVLKGGIVQFFKDIGWSMMELAE
FT                   MENPKREMFACFAEAMLLEFENCHTNFSWGRNNITLEKMDFIGKASERHGFSAVGLKSN
FT                   IQTLTV"
FT   gene            536506..537495
FT                   /gene="accA"
FT                   /locus_tag="NATL1_05901"
FT   CDS_pept        536506..537495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="NATL1_05901"
FT                   /product="acetyl-CoA carboxylase, alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG825 Acetyl-CoA carboxylase alpha subunit [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75152"
FT                   /db_xref="GOA:A2C0Z2"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0Z2"
FT                   /protein_id="ABM75152.1"
FT                   /translation="MARRFLLEFEKPLVELENQIDQIRELARDSEVDVSQQLLQLETLA
FT                   ARRREEIFHALTPAQKIQVARHPQRPSTLDYIQMFCDDWVELHGDRNGTDDQALIGGLA
FT                   RIGEKSVLLIGQQKGRDTKENVARNFGMAKPGGYRKALRLMDHADRFNLPIISFIDTPG
FT                   AYAGLIAEEQGQGEAIAVNLREMFRLTVPIIATVIGEGGSGGALGIGVADRLLMFEHSV
FT                   YTVASPEACASILWRDAGKAPEAASALKITGPDLMKLGIVDEVLKEPSGGNNWAPLQAG
FT                   DTLKNALEKHLSELLALSPDELRNNRYSKFRKMGKYLESQSIESEISV"
FT   gene            537507..538229
FT                   /locus_tag="NATL1_05911"
FT   CDS_pept        537507..538229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05911"
FT                   /product="putative short-chain dehydrogenase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG300 Short-chain dehydrogenases of various
FT                   substrate specificities [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75153"
FT                   /db_xref="GOA:A2C0Z3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Z3"
FT                   /protein_id="ABM75153.1"
FT                   /translation="MLLTFLSTVLITGASRGIGRATAKAFADSGWDLLLLARSEGALAR
FT                   LVEEIDNKKVKVFYKSIDLNNPKNISKGIVELMNNGLIPSVLINNAGVAWTGDLLSMPL
FT                   EKWEWIMQMNLTSIFQVCSEVVPLMRKKGGLVINVSSHASRNVFPQWGAYCVSKAALAS
FT                   FTKCLAEEERKNFIRACTLTLGSVNSSLWDSDSVGMQFDRDAMLSVDQVACELLHLASQ
FT                   PTNQIIEDVTLMPSAGAF"
FT   gene            complement(538226..538900)
FT                   /gene="trpF"
FT                   /locus_tag="NATL1_05921"
FT   CDS_pept        complement(538226..538900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="NATL1_05921"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="COG135 Phosphoribosylanthranilate isomerase [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75154"
FT                   /db_xref="GOA:A2C0Z4"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Z4"
FT                   /protein_id="ABM75154.1"
FT                   /translation="MIRKSSSKKSTAIKICGLTKTSQARSIAELKINAIGVIGVKNSPR
FT                   FVPEEECMKIFNEVEKVSSSIEKVLVIANAKLEDVKCINNRSTPPSVIQLHGNESVDYC
FT                   RELKNEFPGIKIWKAFRLKAINDLENISQYEKNIDAILIDAWDGKSLGGTGNRVPIELL
FT                   LNKTFKAPWILAGGISAEIIPEIFSKLRPDGIDASSRLEISPGIKDLKKVASLVREIRE
FT                   QN"
FT   gene            538982..540199
FT                   /locus_tag="NATL1_05931"
FT   CDS_pept        538982..540199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05931"
FT                   /product="Zn-dependent proteases"
FT                   /note="COG1994 Zn-dependent proteases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75155"
FT                   /db_xref="GOA:A2C0Z5"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Z5"
FT                   /protein_id="ABM75155.1"
FT                   /translation="MKIRGIPLRIHPSWFLVYLYFTLSSKDQFETLLNGQATIWNGWVI
FT                   GAFTSSLLFLSVLLHELAHSFVAIGEGLKVRDITLFFLGGMASLEKECPTSKGSLKIAI
FT                   SGPVVSLLLAFLMILLSNNLSVSNFILSNLFKQVGSLNLLIGVFNLLPIIPLDGGVILK
FT                   SLIWYFTGSKRAGIKVAIGSARLISFLAIFIGFLSLVRGNLYLAICFSIIGLFVFSSSK
FT                   SQSQIIQIQKILSESYVNQVCSRSFRVLEDDLPVKVLSKYSSFNKDNFFNEVWILLCRE
FT                   GRWVGYVNEKILKNISVQNWDKKFLYEFSQPINELPSISEKESLWKAILKIEKTKDGRL
FT                   LVLSFSGLPLGTLDRVDIGKAVLKKIGLNLPDQLIKIARKDNIYPLGLNLLNIAQSMDS
FT                   SDLLED"
FT   gene            complement(540196..540945)
FT                   /gene="lplA"
FT                   /locus_tag="NATL1_05941"
FT   CDS_pept        complement(540196..540945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /locus_tag="NATL1_05941"
FT                   /product="Biotin/lipoate A/B protein ligase family"
FT                   /note="COG95 Lipoate-protein ligase A [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75156"
FT                   /db_xref="GOA:A2C0Z6"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Z6"
FT                   /protein_id="ABM75156.1"
FT                   /translation="MNNLEEVLYLNPLELSGPEQMGIDLFLLEKSLAENNFNMAVRFYT
FT                   WDGDWLSIGKNQKELPKKWIELLKNEQLKIVRRPSGGNAVLHSRGLTYALIWKYPPRNK
FT                   KESYLKTTQWLKDGIKKAGVDLFYGNQPVNISNSNCFSTSTLADLVDQDKNKHIGSAQY
FT                   WRNGHLLQHGEILMEPSKQLWKKVFNADPPKIKNEIKDKDKVISFLKESLGKTWPNSQI
FT                   STYTLDQKDKEIIKRFAKNKFKKINNY"
FT   gene            541083..541508
FT                   /locus_tag="NATL1_05951"
FT   CDS_pept        541083..541508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05951"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75157"
FT                   /db_xref="GOA:A2C0Z7"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Z7"
FT                   /protein_id="ABM75157.1"
FT                   /translation="MGLSNLILGQPQRIEEQFRRKRSKKINKSNPSVNKKIDAFTQVSE
FT                   FQKEEVRRELLYSNVGLILKFGLFIVFATSLMNLGLASHQRVNRNLELSNLLEKESKKL
FT                   HKLRLRFDEMFTNGGEQSFFKEQDQWITPNSVRVIWR"
FT   gene            541577..542590
FT                   /locus_tag="NATL1_05961"
FT   CDS_pept        541577..542590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_05961"
FT                   /product="Light dependent protochlorophyllide
FT                   oxido-reductase"
FT                   /EC_number="1.3.1.33"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75158"
FT                   /db_xref="GOA:A2C0Z8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR005979"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C0Z8"
FT                   /protein_id="ABM75158.1"
FT                   /translation="MALVQAAPGTVLITGTTSGVGLYATKSLVERGWRVITANRCSVRA
FT                   EASASAVGLPTNSPRQLKHIQIDLGDLDSVRNGAKSLLEDLEKPLDALVCNAAVYLPRL
FT                   KKPLRSPQGYEISMATNHFGHFLLIQMLLENLSKSSRPVWKGRSWGVESSRVVILGTVT
FT                   ANNKELGGKIPIPAPADLGNLSGFEEGFCDPISMASGKRFKPGKAYKDSKLCNMITTQE
FT                   LHRRFNSSPILFSSLYPGCVANTRLFRNTPKLFQWLFPWFQKLITGGFVSEALAGDRVA
FT                   QVVSDPQFAISGVHWSWGNRQRKNRQQFSQELSDRVTDPVTSRKVWELSMRLVGLK"
FT   gene            complement(542607..543497)
FT                   /gene="chlL"
FT                   /locus_tag="NATL1_05971"
FT   CDS_pept        complement(542607..543497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlL"
FT                   /locus_tag="NATL1_05971"
FT                   /product="Protochlorophyllide reductase iron-sulfur
FT                   ATP-binding protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="COG1348 Nitrogenase subunit NifH (ATPase) [Inorganic
FT                   ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75159"
FT                   /db_xref="GOA:A2C0Z9"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005971"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C0Z9"
FT                   /protein_id="ABM75159.1"
FT                   /translation="MTSTITRKEDGEGSVQVKQDPKAQIQEGALVIAVYGKGGIGKSTT
FT                   SSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPEDFMF
FT                   KGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAA
FT                   PLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKNYKVRLGGVIANRSAELDQIEKFNE
FT                   RTGLKTMAHFRNVDAIRRSRLKKCTIFEMDSEEEGVVEVQNEYLSLAQKMIDNVEPLEA
FT                   EPLKDREIFDLLGFD"
FT   gene            543854..545113
FT                   /gene="chlN"
FT                   /locus_tag="NATL1_05981"
FT   CDS_pept        543854..545113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlN"
FT                   /locus_tag="NATL1_05981"
FT                   /product="Light-independent protochlorophyllide reductase
FT                   subunit N"
FT                   /note="COG2710 Nitrogenase molybdenum-iron protein, alpha
FT                   and beta chains [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75160"
FT                   /db_xref="GOA:A2C100"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005970"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C100"
FT                   /protein_id="ABM75160.1"
FT                   /translation="MSGATLLKESGPKEVFCGLTSIVWLHRRMPDAFFLVVGSRTCAHL
FT                   IQSAAGVMIFAEPRFGTAILEERDLAGLADAHDELNRVVKNLLARRPEIKTLFLVGSCP
FT                   SEVIKIDLSRVAENLNIELKGQVTVLNYSGSGIETTFTQGEDGALKALIPLMPKSDQKK
FT                   LLLVGTLANAVEDRLVSIFNRLGIDNVESFPPRQSTELPSIGPETKVLLTQPYLTDTAR
FT                   ELKNKGAEIIEAPFPLGVTGSTLWIQAAANSFGIDKSIVDSILNPLISRAKKALEPHVE
FT                   KLSGKKLFLLPESQLEIPLARFLSNECGMEIVEIGTPYLNRDLMKAEIDLLPPDCRIVE
FT                   GQHVEKQLDRVRDSSPDLVVCGMGLANPLEAEGISTKWSIEMVFSPIHGIDQASDLAEL
FT                   FSRPLRRHDILNPTKTLTSN"
FT   gene            545118..546695
FT                   /gene="chlB"
FT                   /locus_tag="NATL1_05991"
FT   CDS_pept        545118..546695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlB"
FT                   /locus_tag="NATL1_05991"
FT                   /product="Light-independent protochlorophyllide reductase
FT                   subunit B"
FT                   /note="COG2710 Nitrogenase molybdenum-iron protein, alpha
FT                   and beta chains [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_05991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75161"
FT                   /db_xref="GOA:A2C101"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005969"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C101"
FT                   /protein_id="ABM75161.1"
FT                   /translation="MELTLWTYEGPPHIGAMRIATSMKKLHYVLHAPQGDTYADLLFTM
FT                   IERRGSRPPVTYTTFQARDLGGDTAELVKGHIKEAVDRFKPEALLVGESCTAELIQDQP
FT                   GSLAKGMGFDIPIVSLELPAYSKKENWGGSETFYQIVRSLLKDHSRESKQSWQEEKRRP
FT                   RVNLLGPTLLGFRCRDDVLEIQKLLGQYGIDVNVVAPLGASPADILRIPNADVNVCLYP
FT                   EIAESTCIWLERNLNIPFTTTVPLGVGATQDFLKELHKVLEMEIPQSVNESNNSKLTWY
FT                   SNSVDSNYLTGKRVFIFGDGTHALAAARIANEELGFKVVGLGTYSREMARKVRPAAKAL
FT                   GLEALITNDYLEVEDAIKETSPELVLGTQMERHSAKRLGIPCAVISTPMHVQDVPARYS
FT                   PQMGWEGANVIFDDWVHPLMMGLEEHLIGMFKHDFEFVDGHQSHLGHLGGKGTQNTTKE
FT                   AIKTNLQDSVITDGDPIWTHEGEKELSKIPFFVRGKVRRNTENYARQAGCREINEETLY
FT                   DAKAHYKA"
FT   gene            complement(546707..547072)
FT                   /locus_tag="NATL1_06001"
FT   CDS_pept        complement(546707..547072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06001"
FT                   /product="conserved hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75162"
FT                   /db_xref="UniProtKB/TrEMBL:A2C102"
FT                   /protein_id="ABM75162.1"
FT                   /translation="MSATQPKDPKNNNSNAEINPEQALGLVSLGLMQKLSDKGLADLNW
FT                   LKEDEKCDTYELRQRLELTSLAIETGAPLSTTEVSKLLGVRPGSSKVERGGLIAKKLSR
FT                   NVWRLIKSSQESSHWRN"
FT   gene            547174..547950
FT                   /locus_tag="NATL1_06011"
FT   CDS_pept        547174..547950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75163"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A2C103"
FT                   /protein_id="ABM75163.1"
FT                   /translation="MTRFATFENNERRPGGSQRITGAEVNKYLVDDPKRVITTDSEKSL
FT                   VARQASHVKQIELRTYVFLDSLQPQLAAYMGTASSGFLPIPGDACLWMEVSPGMAVHRV
FT                   TDIALKASNVRLGQMIVERAFGSLALYHRDQSTVLHSGDVVLDAIGSTIDRRTDPQVTW
FT                   TEVIRSITPDHAVLINRQNRRGSMIQSGMSMFILETEPAGYVLMAANEAEKASNITIVD
FT                   VKGVGAFGRLTLAGKEGDVEEAAAAAMRSIDQINRS"
FT   gene            complement(547947..548537)
FT                   /locus_tag="NATL1_06021"
FT   CDS_pept        complement(547947..548537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06021"
FT                   /product="HAM1 family protein"
FT                   /EC_number="3.6.1.15"
FT                   /note="COG127 Xanthosine triphosphate pyrophosphatase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75164"
FT                   /db_xref="GOA:A2C104"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A2C104"
FT                   /protein_id="ABM75164.1"
FT                   /translation="MKKPLITIASGNPKKVAEIEAMLGPLPIEVKKQPSSLDVEETGKT
FT                   YLENAILKAKAAAALTNSWTIADDSGLEIDSLGNAPGIFSARLANTNEKKIEKILTALG
FT                   DSPYRSAKVCSVMVLCSNTGEIIQNTIGICWGEILKEPAYPNGEFESLFWVRETNCTYG
FT                   ELNNAQLSKHGSRGKAARELAPYLLKAIGIKNN"
FT   gene            548895..549206
FT                   /gene="ccmK"
FT                   /locus_tag="NATL1_06031"
FT   CDS_pept        548895..549206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmK"
FT                   /locus_tag="NATL1_06031"
FT                   /product="carboxysome shell protein CsoS1"
FT                   /note="COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein [Secondary metabolites
FT                   biosynthesis, transport, and catabolism / Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75165"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A2C105"
FT                   /protein_id="ABM75165.1"
FT                   /translation="MASETMGIALGMIETRGLVPAIEAADAMTKAAEVRLIGREFVGGG
FT                   YVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARPHREVEPALGNGNFLGQKD"
FT   gene            549278..550690
FT                   /gene="rbcL"
FT                   /locus_tag="NATL1_06041"
FT   CDS_pept        549278..550690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcL"
FT                   /locus_tag="NATL1_06041"
FT                   /product="Ribulose bisphosphate carboxylase, large chain"
FT                   /EC_number="4.1.1.39"
FT                   /note="COG1850 Ribulose 1,5-bisphosphate carboxylase, large
FT                   subunit [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75166"
FT                   /db_xref="GOA:A2C106"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C106"
FT                   /protein_id="ABM75166.1"
FT                   /translation="MAKKYDAGVKEYRDTYFTPDYVPLDTDLLACFKCTGQEGVPKEEV
FT                   AAAVAAESSTGTWSTVWSELLVDLEFYKGRCYRIEDVPGDKDAFYAFIAYPLDLFEEGS
FT                   ITNVLTSLVGNVFGFKALRHLRLEDIRFPMAFIKTCGGPPSGIVVERDRLNKYGRPLLG
FT                   CTIKPKLGLSGKNYGRVVYECLRGGLDLTKDDENINSQPFQRWRERFEFVAEAVKLAQQ
FT                   ETGEVKGHYLNCTATTPEEMYKRAEFAKELDMPIIMHDYITGGFTANTGLANWCRENGM
FT                   LLHIHRAMHAVIDRHPQHGIHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDN
FT                   LRESFVPEDRTRGNFFDQDWGSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQFGGGTH
FT                   GHPWGSAAGAAANRVALEACVKARNAGREIEKESRDILLEAAKHSPELAIALETWKEIK
FT                   FEFDTVDKLDVQ"
FT   gene            550791..551132
FT                   /gene="rbcS"
FT                   /locus_tag="NATL1_06051"
FT   CDS_pept        550791..551132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcS"
FT                   /locus_tag="NATL1_06051"
FT                   /product="Ribulose bisphosphate carboxylase, small chain"
FT                   /EC_number="4.1.1.39"
FT                   /note="COG4451 Ribulose bisphosphate carboxylase small
FT                   subunit [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75167"
FT                   /db_xref="GOA:A2C107"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/TrEMBL:A2C107"
FT                   /protein_id="ABM75167.1"
FT                   /translation="MPFQSTVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPV
FT                   IEHVQPSGSMQTYWSYWKLPFFGEKDLNLVVSELEACHRAYPDHHVRIVGYDAYTQSQG
FT                   TCFVVFQGR"
FT   gene            551232..553622
FT                   /gene="csoS2"
FT                   /locus_tag="NATL1_06061"
FT   CDS_pept        551232..553622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csoS2"
FT                   /locus_tag="NATL1_06061"
FT                   /product="carboxysome shell protein CsoS2"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75168"
FT                   /db_xref="InterPro:IPR020990"
FT                   /db_xref="UniProtKB/TrEMBL:A2C108"
FT                   /protein_id="ABM75168.1"
FT                   /translation="MAKQTSRQLVLERRQALSQGGKNASIKGGSTANRVRSSADARATR
FT                   TNSGFVKPNKSMASANNSSSQSSTSGFQLSTSGSASSSRSYRSSVAQPSRQLVIARREA
FT                   LSRRGKSADNTKDITRVELERKKVQSAPSYDAKNAEHCCPECEQKALEETSNTTQKPEI
FT                   SLKLNKRTTDHRSTVKRKAITNSSRAFVLARREALSKHGKSAGKQPTTAASVARQGNPD
FT                   LTTKEIAQRVRELKSKTGATGSKRTSVTRPCGPNKNGAKQNASVPDAHWKVGISETSTG
FT                   QIVTGTQANRSLKTTGNEASTCRSITGTQYLGSEVIDSFCNGSNTQISQPAKVAVTSTS
FT                   HGNLVTGNEVGRSEKVTGDEPGTCKNLTGTEYISANQSNNYCGGVTPSPSKIGYSQTID
FT                   GQKVSGTMTGRSALVTGNEAGSNKGLTGDQYLGSDPLPSGRPAEKVGSLTTIRGNGVTG
FT                   TDVSRRENVTGNEAGSCKNVTGDEYVGAGQFDSFCGSKPAPDPAKVGLSITNKTQSVSG
FT                   TMTGRSHLVTGDEPGTCKAVTGTPYAGLDQANQWCDNSASSEVEARTPRKTGTPGARLT
FT                   GQQPGIGGKMTGAHKGACEPLTGTPYVGGDQLADNCGISTSPEGYAHQETTEKAAAWTS
FT                   FSVKSPARQAHIQNEINAGVTGTSYEDSSRITGPFDMAANKVTGTEQFRFDRKPSNSTN
FT                   NKVDQIVNEESKQRPTSQITGEGQSAGLNITGDDWARGEHVTGTEGASAKRRNPSRPGP
FT                   MSAMNAAELKRNQEVPEPDFLITGSSGNTRDGQLVTFSGGARG"
FT   gene            553630..555189
FT                   /gene="csoS3"
FT                   /locus_tag="NATL1_06071"
FT   CDS_pept        553630..555189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csoS3"
FT                   /locus_tag="NATL1_06071"
FT                   /product="carboxysome shell protein CsoS3"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75169"
FT                   /db_xref="InterPro:IPR014074"
FT                   /db_xref="UniProtKB/TrEMBL:A2C109"
FT                   /protein_id="ABM75169.1"
FT                   /translation="MAYRNLAKKSRRGPTAPMKRFVDLETKNLNSEVIKTTNSFSDEIK
FT                   TISSFSTDHPLTNSQENQKLNQYENKVKGRFDNIVPLLKRVSSLQNDLNFVERAQNLCR
FT                   SELGYELPLHILEKAWVGSVDISALFAWCVFQSHQLTSNEFFNSDPIEGSENSQYAKSF
FT                   QSFLYQCGFHLLDITPCADGRLAHAISYALRIPFSSVRRRSHAGALFDIEKTVNRWIKT
FT                   EHSRYRESTPNSATEPTRYLKSVIYHFSSVDPTHQGCAAHGSNDELAASEGLQRLLDFR
FT                   EAVENSFCCGASVDLLLIGIDTDTDAIRVHTPSKTNEVDLKSWVCANQIYKETQFLKAE
FT                   EALQKIQENIKRVCPGETDPNMVMFITRLISNNISQIDYVKNFHSGSYQDAGHAERFIG
FT                   VGIGFKEVHLRNLTYFAHLETVEQGAPDLDVGVKIFTGLNISRSLPIPIVIRFDYSGSV
FT                   PHARNRALSDCHRINEAIKSRYRDLIDNGSLHTFLTIRDRDKKAPAEVVGSSLDPVTQE
FT                   AH"
FT   gene            555190..555465
FT                   /locus_tag="NATL1_06081"
FT   CDS_pept        555190..555465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06081"
FT                   /product="putative carboxysome peptide A"
FT                   /note="COG4576 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein [Secondary metabolites
FT                   biosynthesis, transport, and catabolism / Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75170"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR014076"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A2C110"
FT                   /protein_id="ABM75170.1"
FT                   /translation="MLICKVLKPLVSTNRIPGFEHKHLQVVLDGSSKKVAVDAVGCKPD
FT                   DWVICVGSSAAREAAGSKSYPSDLTIVGIIDHWDPETQQQISGGAK"
FT   gene            555465..555716
FT                   /locus_tag="NATL1_06091"
FT   CDS_pept        555465..555716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06091"
FT                   /product="putative carboxysome peptide B"
FT                   /note="COG4576 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein [Secondary metabolites
FT                   biosynthesis, transport, and catabolism / Energy production
FT                   and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75171"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR014077"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A2C111"
FT                   /protein_id="ABM75171.1"
FT                   /translation="MEIMQVMGRLVCTQRVEGLGHMHLRILCNNKGKRLVAVDPVGARE
FT                   GNWVFTATGTAARWGCPDPNVQTDLTIGGIIDHWNPDD"
FT   gene            555761..556309
FT                   /locus_tag="NATL1_06101"
FT   CDS_pept        555761..556309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06101"
FT                   /product="carboxysome structural protein CsoS1"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75172"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A2C112"
FT                   /protein_id="ABM75172.1"
FT                   /translation="MTNSSNRRPKSSNKTIKPKDQVVDVTPLNSTTKSKTSSRIQSSSA
FT                   EKASNTKSIPSAKNLSNASEGGGSFNARIGQNKAFETKSNFGIALGMIETRGLVPAIEA
FT                   ADAMTKAAEVNLIVKELVGGGYVTVMVRGETGAVNASVRAGADACERVGDGLVAAHIIA
FT                   RPHGEIEPALRGSGAKRRS"
FT   gene            556385..556648
FT                   /locus_tag="NATL1_06111"
FT   CDS_pept        556385..556648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75173"
FT                   /db_xref="GOA:A2C113"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:A2C113"
FT                   /protein_id="ABM75173.1"
FT                   /translation="MEGWRQKKRPECLEKRFEFQSYEKNRDFLDALGEYCEKVNRFPDI
FT                   SFGKTYANITIRPEENNVKEEISKDDHDFASEIDFLNKQEEN"
FT   gene            complement(556645..556875)
FT                   /locus_tag="NATL1_06121"
FT   CDS_pept        complement(556645..556875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06121"
FT                   /product="conserved hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75174"
FT                   /db_xref="InterPro:IPR021483"
FT                   /db_xref="UniProtKB/TrEMBL:A2C114"
FT                   /protein_id="ABM75174.1"
FT                   /translation="MSTAKLTIGELEAGYPLYCKALRRLLQQGRTADQIQRTVCWSHLE
FT                   TLNRCLPGRYKTPSYLMALIKRDLEQPKEED"
FT   gene            complement(556964..557371)
FT                   /gene="tdcF"
FT                   /locus_tag="NATL1_06131"
FT   CDS_pept        complement(556964..557371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdcF"
FT                   /locus_tag="NATL1_06131"
FT                   /product="Putative translation initiation inhibitor, yjgF
FT                   family"
FT                   /note="COG251 Putative translation initiation inhibitor,
FT                   yjgF family [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75175"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A2C115"
FT                   /protein_id="ABM75175.1"
FT                   /translation="MKSSSIEAIETKFAPKPVGPYNQAILVENYLYCSGQIALDPSTGV
FT                   MVGNGNIEEETRQVLKNLMAVVEAAGGRSSAVIRTTIYLTDLNDFAKVNEIYAETFNKT
FT                   VSPARACVEVSKLPKGGKIEIDCIAWLENKK"
FT   gene            complement(557417..558172)
FT                   /locus_tag="NATL1_06141"
FT   CDS_pept        complement(557417..558172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06141"
FT                   /product="Putative hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="COG491 Zn-dependent hydrolases, including
FT                   glyoxylases [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75176"
FT                   /db_xref="GOA:A2C116"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C116"
FT                   /protein_id="ABM75176.1"
FT                   /translation="MLGEKSDFTIHPINVLQDNIVWVWVHNCNAVVVDPSISGPVEKWL
FT                   LEKNLSLKAILQTHHHDDHIGGTQKLIKTWPEAKVVASKKEHKRIPFQTFSVDDNDIFN
FT                   LMDAEIKVIEVHGHTDNHIAFYISKQNAKCNILFPGDTLFGGGCGRLLEGSPVQMFESL
FT                   YKLNSLPENTEIYPAHEYTESNLKWALSLEPGNISIIERLKLIQKKLQKGMSSLPSTLS
FT                   EERKTNLFLIAENVEKFTMLRKHKDRWKC"
FT   gene            558223..558885
FT                   /gene="hisG"
FT                   /locus_tag="NATL1_06151"
FT   CDS_pept        558223..558885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="NATL1_06151"
FT                   /product="possible ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="COG40 ATP phosphoribosyltransferase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75177"
FT                   /db_xref="GOA:A2C117"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C117"
FT                   /protein_id="ABM75177.1"
FT                   /translation="MFTVALAKGALLQESVSMFSDVGLDFSAVLDDSNRQLMVPSACGR
FT                   AKALLVRNSDVPVYVSYGQAQLGIVGFDVLQEQKLQVSNLVDLGFGECHMSVAVKSSSG
FT                   YLSASDLPPNCRVASKFTNCAKHFFDQIDLPVQLVHLSGSVELGPITGMAEAIVDLVAT
FT                   GRTLRDNGLVEIEELFKSSARLVGHPLSLRLDKGPLQEIIDSIQIQSQTNLLSDGKK"
FT   gene            558872..560668
FT                   /locus_tag="NATL1_06161"
FT   CDS_pept        558872..560668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06161"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75178"
FT                   /db_xref="GOA:A2C118"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A2C118"
FT                   /protein_id="ABM75178.1"
FT                   /translation="MAKNDFRRIKKLGKYLKREKKRLILILLILIPVALAGSIQPLLVG
FT                   QAISVLRGENTIAFFNNLPKELTINLIIGILFITVLLRLGLQGFQSYNIQSVGQRLTAR
FT                   IRNDLFAHSMSLSLRFHDKMPVGKLLTRLTSDVDALSEVFGSGAVGVLADFVSLIVISI
FT                   TMILIEWRLGLLLLIVQIPVTLFILWLQKRYRKQNYKVREELSQLNANFQENLQGLEVV
FT                   QMFRRQSLNGQNFFKTGTNYKHAVNGTIFYDSSISAFIEWVSLAAVALVISLGGYMVTA
FT                   GAMGLGTLTTFILYSQRLFEPLRQLAERFTQIQGGLTAVERISELLEKKIEIYDHFNHK
FT                   AENKELLNSKKTVLGEVLFENVSFFYREDEPIIKDLSFKIKPGDHVALVGPTGSGKTTL
FT                   IRLLCRLYEPQKGNIYIDGQNIKSIPIDQLRKQLGVVLQDTFLFSGNVADNLRLDSSID
FT                   NQRLKDVCSDLGLDNLLKKLPNGLDTYIRERGGNLSSGERQLLSIARVAIRDPKILIMD
FT                   EATAFMDPSTEATLQRDLDRLLEKRTALVIAHRLATIEASDRILVMRKGSLIEEGTHEE
FT                   LRALGGLYSQLAELQEKGLATI"
FT   gene            560682..561224
FT                   /locus_tag="NATL1_06171"
FT   CDS_pept        560682..561224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06171"
FT                   /product="possible acetyltransferase"
FT                   /note="COG456 Acetyltransferases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75179"
FT                   /db_xref="GOA:A2C119"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2C119"
FT                   /protein_id="ABM75179.1"
FT                   /translation="MINLGSTKIGMSGWKNEKLLSDETLKNIYGKQAFQYFNQTNSSLF
FT                   VFSHSKSFDLIELEQLLQAVGWGRRPLRRVKRALDNSLLKVGLWQHDPKFPRLIGFARC
FT                   TGDGIIDATIWDVAINPVYQGYGLGKQLMEYLMKSLKREGISRVTLFADSDVITFYKRQ
FT                   GWILEPKGNKCAFWYSN"
FT   gene            complement(561248..561952)
FT                   /locus_tag="NATL1_06181"
FT   CDS_pept        complement(561248..561952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06181"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /note="COG463 Glycosyltransferases involved in cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75180"
FT                   /db_xref="GOA:A2C120"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2C120"
FT                   /protein_id="ABM75180.1"
FT                   /translation="MARSQKIPDLSIIIPTLNEADHLPLLLADLNEWPYNFELIIVDGG
FT                   SIDLTISIAQIQGIDVIKSSKKNRGYQLKKGASKARGDWLLFLHADSRLSPSWFKRLSQ
FT                   IIQNKKSENFAWYFDFKIKKHNLEFRFLEIAVALRSHLLQHPYGDQGLLIHKDLYSNTG
FT                   GYSSLKIMEDIDLITRITKKTKLKRIRENIYTDDIKWRNSNIIKRAIKNAKLRNMWRQG
FT                   CDIDYLSKEYNS"
FT   gene            complement(561901..562632)
FT                   /locus_tag="NATL1_06191"
FT   CDS_pept        complement(561901..562632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06191"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3222 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75181"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2C121"
FT                   /protein_id="ABM75181.1"
FT                   /translation="MNRAISKTENTKRLYVNSKPTIVLMTKWHAIFRCKSRLAKDIGAF
FT                   KAAKIQEKLTNHTINVAKEIQKEGLADIKVAIDGIGIKAAKKWALLNKIKAVEIQGPGN
FT                   LGTKMKRQFSKIHSEKNLSHQIQNPILIIGSDLPSISHFELIQAIQILNHKEMVLGPSN
FT                   DGGYWLIGLSNKLLNPLCAWPFSGISWGSDKVLKETIRLASLNQIDYQLLQTKNDLDNI
FT                   MDLSPWLDHKKFRISASSYQL"
FT   gene            562863..564257
FT                   /gene="dnaA"
FT                   /locus_tag="NATL1_06201"
FT   CDS_pept        562863..564257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="NATL1_06201"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COG593 ATPase involved in DNA replication initiation
FT                   [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75182"
FT                   /db_xref="GOA:A2C122"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C122"
FT                   /protein_id="ABM75182.1"
FT                   /translation="MPTRDELWTKVQKLLQKNLSKPSYETWIRPAEFFDFKDGCLTLLA
FT                   PNSFSSDWLRKNYSQTIEEIASETFGHEVKVHIKVKEEFSSNKSNKKKNFSNVEANSIA
FT                   TSENSDVKSKQTPIKKFLPSLNLRYVFNRFVVGPNSRMAHAAAMAVAEAPGREFNPLFI
FT                   CGGVGLGKTHLMQSIGHYRLEIDPGAKVAYVSTETFTNDLIVAIRKDGMQAFRNRYREA
FT                   DLILVDDIQFIEGKEYTQEEFFHTFNALHEAGRQIVLTSDRPPSQIPRLQERLISRFSM
FT                   GLIADIQAPDLETRMAILQKKAEHERMRLPRDLIQFIAGRFTSNIRELEGAFTRAVAFA
FT                   SITGLPMTVESVAPMLDPTGQGVEVKPKQVLEKVAEVFGVTEEEMRSPSRRRPVSQARQ
FT                   VGMYLMRHGTDLSLPRIGESFGGKDHTTVMYAIEQVEKKLSSEPQLASQVQKVKDLLQI
FT                   DSRKRR"
FT   gene            complement(564292..565533)
FT                   /locus_tag="NATL1_06211"
FT   CDS_pept        complement(564292..565533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06211"
FT                   /product="Glutathione S-transferase"
FT                   /note="COG625 Glutathione S-transferase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75183"
FT                   /db_xref="GOA:A2C123"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A2C123"
FT                   /protein_id="ABM75183.1"
FT                   /translation="MNPTRNAMSWEELAIYAADPIDQINGLNNPYSTLRLFNKSESQAI
FT                   VTLYRDNHAWCPYCQKVWIWLELKNIPYRIKKVTMRCYGEKEKWYLKKVPSGMLPAIEI
FT                   ENHVITESDEILFVLEEIYGPLGQSLNENKVLEHRRLERELFSSWCNWLCRNSLFQAQE
FT                   EQKKENFKNVANKFEKELQKNASGWLTPVSTKNGEKPGSADVIFIPYVERMNASLAYYK
FT                   GYSLRDEHPIINTWLKNLEKLEEYRGTQGDFHTHAHDLPPQMGGCFTYSNKNQQLFAQE
FT                   IDIGSGLGQLELVDFKVDQKSEQHFEALALERVIRHKERIVSVSPMKNKLFDQPLRAAL
FT                   TSMISKKDCLPEQNSASALRYLRDRISVPRDMPLLSGRLFRQALERTANIDGSDPGPEI
FT                   PTRNRLDQNPIQFN"
FT   gene            565575..566936
FT                   /gene="gor"
FT                   /locus_tag="NATL1_06221"
FT   CDS_pept        565575..566936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="NATL1_06221"
FT                   /product="probable glutathione reductase (NADPH)"
FT                   /EC_number="1.8.1.7"
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75184"
FT                   /db_xref="GOA:A2C124"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2C124"
FT                   /protein_id="ABM75184.1"
FT                   /translation="MKSSFDLIVIGAGSGGLAAAKKAASYGASVAIVEGDLVGGTCVIR
FT                   GCVPKKLLVCGSSLLESFLSATSYGFDFDNLKIKSEVLLANVRKEVHRLNELHENFLNK
FT                   ANVELFKGWGEFRNSNCVEVKDRKNGETLNELYGERILIAVGGRPKRPSIEGASLGWTS
FT                   DDMFLLKSFPKKITIVGAGYIACEFACILHGLGVEVTQLVRGDRILRGFDFELSSSLTE
FT                   AMKNKGVNISFGEKISSLKGTPGSLIIKTNAGKEFDSNGLLFATGREPFLDGLKLEQAG
FT                   IEILENKIKVDSEGKTNISNIFAIGDVTDRINLTPVAIDEGRKFADRNYGESDHKVNYN
FT                   FVPYAVFSQPEIASVGMTEEKAIQSIGKDNIKVYRSIFRPLSKSLPKTGSKCILKLIVD
FT                   KNNNKVLGCHMIGDNASEIIQMASISLMLGAKKTDFDNTMALHPTIAEEFVTMR"
FT   gene            complement(566950..568044)
FT                   /gene="ecm27"
FT                   /locus_tag="NATL1_06231"
FT   CDS_pept        complement(566950..568044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecm27"
FT                   /locus_tag="NATL1_06231"
FT                   /product="putative CaCA family sodium/calcium exchanger"
FT                   /note="COG530 Ca2+/Na+ antiporter [Inorganic ion transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75185"
FT                   /db_xref="GOA:A2C125"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A2C125"
FT                   /protein_id="ABM75185.1"
FT                   /translation="MPSILLSFLELIAGILLLFSGGEFFIQGSVALALILGIPQLVIGL
FT                   TIVSLGTSAPELFVSVNSSLNGSDSLALSNIVGSNIFNVMVVLGGSALLRPLRVESRLV
FT                   RRDIPLLLAVSTAVWGMAASELITWQFGVALIVALIINTTWEIRTAREEPQKTQEAEPE
FT                   INIEKDSTSLLNAGVKLLGGIFLLTLGSRLLIEGASTIAGLLGISEAIIGLTIVSLGTS
FT                   LPELITSLVAAIRGQTDLAIGNVIGSCLLNQLLVLGSCSVLSGGSGLVVESLLITKDIP
FT                   IMVITTLACMPIFWTKGIISRGEGGVLLGLYMLYIADKIIPLTLPTLHTAFKELVFIAI
FT                   SLSITIIIYKTIAYWLRLRKRSNN"
FT   gene            568193..569257
FT                   /locus_tag="NATL1_06241"
FT   CDS_pept        568193..569257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06241"
FT                   /product="Dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="COG418 Dihydroorotase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75186"
FT                   /db_xref="GOA:A2C126"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A2C126"
FT                   /protein_id="ABM75186.1"
FT                   /translation="MIASVNQISLLKPDDWHLHLRDGKILKGVLSHTADVFCRAIIMPN
FT                   LDPPITTLSQAQEYKKRIIQSIPEGVSFTPLMTAYLTDDMPANVLERGFREGVFHGAKL
FT                   YPANVTTNSSYGVTDISKVGNLFETMERIGMPLLIHGEVTDFNVDVFDREAVFIERHLE
FT                   PLLRTFSSLKVVLEHITTIDAIDFVENSEFDIAATITPHHLHINRNAMFNGGLRSDFYC
FT                   LPTAKREIHRIALRQAATSGKTCFFLGTDSAPHTRRFKESSCGCAGIFNAPFALESYLK
FT                   VFEEENALDRFEAFSSINGATFYGLPLNTERITLIRKDISVPQMIDVGLDGNPNDFVKP
FT                   FHSGETLSWAIKDV"
FT   gene            complement(569395..569480)
FT                   /locus_tag="NATL1_tRNALeuVIMSS1309198"
FT                   /note="tRNA-Leu"
FT   tRNA            complement(569395..569480)
FT                   /locus_tag="NATL1_tRNALeuVIMSS1309198"
FT                   /product="tRNA-Leu"
FT   gene            569690..569959
FT                   /locus_tag="NATL1_06251"
FT   CDS_pept        569690..569959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06251"
FT                   /product="NADH dehydrogenase subunit NdhL (ndhL)"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75187"
FT                   /db_xref="GOA:A2C127"
FT                   /db_xref="InterPro:IPR019654"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C127"
FT                   /protein_id="ABM75187.1"
FT                   /translation="MSLISIVCLIPFGLIGAVNPIITLSAYAVLGGMYLFVVPLFLFYW
FT                   MNNRWNVMGKFERLFIYGLVFLFFPGMVLFAPFLNLRMNGKEES"
FT   gene            569963..570295
FT                   /locus_tag="NATL1_06261"
FT   CDS_pept        569963..570295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75188"
FT                   /db_xref="GOA:A2C128"
FT                   /db_xref="InterPro:IPR021562"
FT                   /db_xref="UniProtKB/TrEMBL:A2C128"
FT                   /protein_id="ABM75188.1"
FT                   /translation="MTRAQVFQIGFIVFVLGGLGYEVFQLLGFESISAGIAAQSILILI
FT                   IFAWTASYLFRVFSGNMTFMEQRKRYREAYEKLTDEKIREKFEAMTDDEKNELLKSVEE
FT                   ESIEQT"
FT   gene            570379..571179
FT                   /gene="trpA"
FT                   /locus_tag="NATL1_06271"
FT   CDS_pept        570379..571179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="NATL1_06271"
FT                   /product="Tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="COG159 Tryptophan synthase alpha chain [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75189"
FT                   /db_xref="GOA:A2C129"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C129"
FT                   /protein_id="ABM75189.1"
FT                   /translation="MKSTNISRSFSKIKKEKRIALMPFLMAGDPDLETTAKILLELQAN
FT                   GADMIELGIPYSDPLADGPIIQLAASRALSAGTSPDRVFKMLFELRDQLKIPIILFTYS
FT                   NPLINKGLEEFCWQASKVGVSGLVVPDLPLEEAEKLSDIAESKEIDLVLLVAPTTPKDR
FT                   MKKIAATSNGFTYLVSVTGVTGERSSLEDNVGSLVQQLKDSSSSPIAVGFGISDVKHIE
FT                   QVREWGADGAIVGSALVKRIANASIEMKVEEAGSFCKELRAATN"
FT   gene            571272..571541
FT                   /locus_tag="NATL1_06281"
FT   CDS_pept        571272..571541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06281"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG2350 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75190"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A2C130"
FT                   /protein_id="ABM75190.1"
FT                   /translation="MDQFVLWGSYCEDALLKRTPFREEHLQRLSLLKEKGILITLGPTK
FT                   CNRYVFGIFKSEDIEYIRSLIKEDVYWREGIWTDFEIYSWTQAF"
FT   gene            complement(571517..571888)
FT                   /locus_tag="NATL1_06291"
FT   CDS_pept        complement(571517..571888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06291"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75191"
FT                   /db_xref="GOA:A2C131"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A2C131"
FT                   /protein_id="ABM75191.1"
FT                   /translation="MKKYTNFFFIKLRGFFLISICCTCFYLSLPKELNAIEADSGKNLF
FT                   NHNCAGCHINGGNIIRRSKNLKISSLKRNGIDNPEAIANIARQGVGIMSGYEDELGDNG
FT                   DQIVANWVWEQAQKAWVQE"
FT   gene            complement(571902..572246)
FT                   /locus_tag="NATL1_06301"
FT   CDS_pept        complement(571902..572246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06301"
FT                   /product="conserved hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75192"
FT                   /db_xref="UniProtKB/TrEMBL:A2C132"
FT                   /protein_id="ABM75192.1"
FT                   /translation="MVSTMSKERWSKDIEEDLVLLIKDWLRQTGRTQSELCRSLNLPSA
FT                   RMPTLIESLKKDFSSGGIPKIANRLCEVEELWTNGEEGKTKKSFELNSSGQLDLLDEIC
FT                   EDLSKINFNK"
FT   gene            complement(572231..572596)
FT                   /locus_tag="NATL1_06311"
FT   CDS_pept        complement(572231..572596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75193"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:A2C133"
FT                   /protein_id="ABM75193.1"
FT                   /translation="MVSSRNSNKEVFEAEVLESSVIDEGVLKKILLRAGRVIAQPALEG
FT                   FELIMDNSTPPQVRLSIMGALTYLIVPFDLIPDFIPASGFSDDLVALTAVISLWQHHIT
FT                   PEIKFRAKSKLDKWFPL"
FT   gene            complement(572599..573522)
FT                   /locus_tag="NATL1_06321"
FT   CDS_pept        complement(572599..573522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06321"
FT                   /product="Putative type II alternative sigma factor,
FT                   sigma70 family"
FT                   /note="COG568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32) [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75194"
FT                   /db_xref="GOA:A2C134"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2C134"
FT                   /protein_id="ABM75194.1"
FT                   /translation="MSSLSDFLGEIGRHELLTPEQELTLGREVQAMVALNERCQQAGGN
FT                   GPECEYSSAEKKRFKAGERAKNQMITANLRLVVNLAKRYQGKGLDLLDLIQEGTLGLTR
FT                   AVEKYDPKRGHRFSTYAYWWIRQGLNRALSTQSRTIRIPVNINEKLTKLRAAKSRLMQE
FT                   LGVHPSTNQIAIQMKIPLEEVEELLACELRSITVSLQGAVKSKADPSELVDILPSEEVP
FT                   PMELAELAERSASAWSLLDKSNLTPKERTILSLRFGLDGSNEWRTLAEVARQMNCSREY
FT                   CRQVVQRALRKLRKTGIQSGLLETSI"
FT   gene            complement(573815..573934)
FT                   /locus_tag="NATL1_06331"
FT   CDS_pept        complement(573815..573934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06331"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75195"
FT                   /db_xref="UniProtKB/TrEMBL:A2C135"
FT                   /protein_id="ABM75195.1"
FT                   /translation="MVERQRIKLIKSLEREKNKSTDFLKSLVIYRLPKIRSSA"
FT   gene            complement(573986..574627)
FT                   /gene="hisI"
FT                   /locus_tag="NATL1_06341"
FT   CDS_pept        complement(573986..574627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="NATL1_06341"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /EC_number="3.6.1.31"
FT                   /note="COG139 Phosphoribosyl-AMP cyclohydrolase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75196"
FT                   /db_xref="GOA:A2C136"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:A2C136"
FT                   /protein_id="ABM75196.1"
FT                   /translation="MFFIDNLHFDQNGLIPAIAQDWIDGAVLMMAWMNKESITKTLESG
FT                   EVHYWSRSRKELWHKGKTSGHFQKLKGIRTDCDSDTILLSIEQIGSIACHTGERSCFFK
FT                   DLETNKDVLHPPSNACSELFNVIESRKSNPEEGSYTNTLLKEGDNKILKKIGEETAEFI
FT                   MACKDKNPISVANEAADLLFHMQVSLANQNVSWEEVLKVLVKRRGAPRRN"
FT   gene            574705..575175
FT                   /locus_tag="NATL1_06351"
FT   CDS_pept        574705..575175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06351"
FT                   /product="6-pyruvoyl-tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75197"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A2C137"
FT                   /protein_id="ABM75197.1"
FT                   /translation="MTIKDITFNCSKHFKDYPCSHRQWKHKGHCRFVHGYSRSFTFCFA
FT                   SNKLDENGFVVDFSSLRPLEEQLKDHFDHTFLVNFDDPFLETWKELHSKEVLDLRVMNN
FT                   VGMESTAELVWGWANDLLFSREKGRSCCWKAIAHENAVNSASYTFLPEWFNP"
FT   gene            complement(575221..577812)
FT                   /gene="clpB"
FT                   /locus_tag="NATL1_06361"
FT   CDS_pept        complement(575221..577812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="NATL1_06361"
FT                   /product="ATP-dependent Clp protease, Hsp 100, ATP-binding
FT                   subunit ClpB"
FT                   /EC_number="3.4.21.92"
FT                   /note="COG714 MoxR-like ATPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75198"
FT                   /db_xref="GOA:A2C138"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A2C138"
FT                   /protein_id="ABM75198.1"
FT                   /translation="MKVNPDDFTNIAWQGIIDAKDLALTEKHQTLETEHLFWSLLKKNE
FT                   IAIKIIERSGGVIKNLLTEIENFIKNQPKMLQAQESIFFGKNISLSISRAKNIQQSFKD
FT                   DFISSEHLVISLFDDERICNRLFGQNHVDKNSLLEAINVLRGDKKVTQKNAENSYEALQ
FT                   KYGLDLTSAARDGKLDPVIGRDEEIRRTIQILSRRTKNNPVLIGEAGVGKTAIIEGLAQ
FT                   RIINGDVPTALENRQLISLDMGALIAGAKFRGEFEERLKSVLKNVTDSEGKIILFIDEI
FT                   HTVVGAGASGGAMDASNLLKPMLARGELRCIGATTINEHRENFEKDPALERRFQQILVK
FT                   QPSVQDTISILRGLKERYEVHHGVRISDNALIAAAILSDRYIPERFLPDKAIDLIDESA
FT                   SRLKMEITSKPEEIDEIDRKIIQLEMEKLSLEGESDTSSKERLELITTELALLTKNQIE
FT                   VTKKWKQEKESIEEISTLKEDIEKVQLEIEKAKRNYDLNRAAELEYGTLVNYQQNLKSK
FT                   ELNLKNSTENAEKSLLREEVLADDVAEIIAKWTSIPVKRLAQTEIEKLLNLESQLQKRV
FT                   IGQDKAVQSISSAIQRSRTGLSDPSRPIASFLFLGPTGVGKTELSKALASQLFDSENAL
FT                   IRIDMSEYMEKHSISRLIGAPPGYVGYEAGGQLTEAIRRKPYCVLLFDEIEKAHKDVFN
FT                   VLLQILDEGRVTDGQGRTTNFKNTIIILTSNLGSELISDNDVTNDPSTNIDELINQELK
FT                   SNFRPEFLNRLDEIINFEPLKKETLLKVVDLQLNRLRERLEAKGIELEINDDVLSLITE
FT                   LGYNPSYGARPLKRVIQKELESEIAKYILKGKYKEGSTIKIESKESKLIFH"
FT   gene            complement(578194..578544)
FT                   /gene="petE"
FT                   /locus_tag="NATL1_06371"
FT   CDS_pept        complement(578194..578544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petE"
FT                   /locus_tag="NATL1_06371"
FT                   /product="plastocyanin"
FT                   /note="COG3794 Plastocyanin [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75199"
FT                   /db_xref="GOA:A2C139"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR001235"
FT                   /db_xref="InterPro:IPR002387"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/TrEMBL:A2C139"
FT                   /protein_id="ABM75199.1"
FT                   /translation="MIRSISTALFAFFAFLVIGVSNVNASTVEVKLGTDAGMLAFEPST
FT                   LNISAGDTVKFVNNKLAPHNAVFDGNDDLSHPDLAFAPGESWERTFSTAGTYDFYCDPH
FT                   RGAGMVGKIVVN"
FT   gene            complement(578598..579584)
FT                   /locus_tag="NATL1_06381"
FT   CDS_pept        complement(578598..579584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06381"
FT                   /product="Nucleoside-diphosphate-sugar epimerases"
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75200"
FT                   /db_xref="GOA:A2C140"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C140"
FT                   /protein_id="ABM75200.1"
FT                   /translation="MKNEIILITGASGCVGQYIANWLIENSTSELFLWVRDPKKITSIN
FT                   LENPRIKILVGDLRESNKFKKEISEVNRVIHTATAWGDPKRAKEVNIDAVKNLLNLLNP
FT                   SNIKQIIYFSTASVLDRNLNLLPEAFTYGTEYIQTKAQCLRELESHQLATKIIAVFPTL
FT                   VFGGRLDGKSKFPTSYLTEGLRDALRWIWLARWIKLSSRFHFIHAADIAFICGHLATSD
FT                   FEPIQPFSATKIKKLVLGQPYTSIDVVIQTLLIWKGMRRVPQIPVLNWLIELLTVLLPI
FT                   QMTNWDRFSLRQKHFIHEPVTSPETFGGISHAKTLSQVLHNSGLTKH"
FT   gene            complement(579581..580639)
FT                   /gene="hemE"
FT                   /locus_tag="NATL1_06391"
FT   CDS_pept        complement(579581..580639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="NATL1_06391"
FT                   /product="Uroporphyrinogen decarboxylase (URO-D)"
FT                   /EC_number="4.1.1.37"
FT                   /note="COG407 Uroporphyrinogen-III decarboxylase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75201"
FT                   /db_xref="GOA:A2C141"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C141"
FT                   /protein_id="ABM75201.1"
FT                   /translation="MNETTPLLLRAARGEHVERPPVWMMRQAGRYMKVYRDLRDNHPSF
FT                   RERSENPDLSYEISMQPFTAFQPDGVILFSDILTPLPGMGINFDIVESKGPLINDPIRS
FT                   LKQVKDLKPLQPEESMSFVGEVLGRLRESVGNKAAVLGFVGAPWTLAAYVVEGKSSKNY
FT                   AVIKAMAFQEPELLHQLLNHFAESIANYLSYQIQSGAQVVQMFDSWAGQLSPQDYDEFA
FT                   APYQQKVVNLVKEKHPDTPMILYISGSAGVLERMGQTGVDIVSLDWTVDMADGLKRLPQ
FT                   SVGVQGNVDPGLLFGTPDAIRSRIVDVVKKAKGRKHILNLGHGILPGTPEENARVFFEA
FT                   GKNVNELIKVSS"
FT   gene            complement(580801..583068)
FT                   /gene="glgB"
FT                   /locus_tag="NATL1_06401"
FT   CDS_pept        complement(580801..583068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="NATL1_06401"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="COG296 1,4-alpha-glucan branching enzyme
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75202"
FT                   /db_xref="GOA:A2C142"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C142"
FT                   /protein_id="ABM75202.1"
FT                   /translation="MTVSILLDSLKDDGQRLSECRHESPFSILGPQPFKDKWIIRIWMP
FT                   EASEVELITQQTKIKLQNPNHEWIFEGVLEKDPGNDYQIKVNRGGIEHVQHDPWSFRKE
FT                   WMGEIDRHLFAEGNHHHIWRKMGAHLTEINKKQGVMFCLWAPHAKSVSVIGDLNSWDGR
FT                   HHPMQKRLGGIWELFIPGLSEGDLYKYEIRTEKGHCYEKADPYGFQHEVRPAKSSVISK
FT                   IDSFQWNDQSWISNRDNRDPLEQPISVYEMHLGSWMHASSDDPFINSNGEHRAPVPAAD
FT                   MKPGSRLLTYKELANKVIPYVKERGFTHIELMPISEHPFDGSWGYQVTGWYAPTSRFGS
FT                   PDEFRAFVDSCHKEGIGIILDWVPGHFPKDQHGLAYFDGSHLYEHSDPRVGEHKEWGTL
FT                   IFNYSRNEVRNFLVANLIFWFDQFHIDGIRVDAVASMLYKDYLRPEGEWIPNEDGGNEN
FT                   FEAVRFLQQANHVLFQHFPGALSIAEESTTWSGVTKPTDMDGLGFNLKWNMGWMHDMLD
FT                   YFEIDPWFRQFNQNNITFSICYNFTENFMLALSHDEVVHGKSHLLHKMPGDDWQKYANT
FT                   RALLAYMWTHPGKKTIFMGMEFGQRQEWNVWDDLQWDLLNYEPHKGIQKLVDDLNNLYK
FT                   REPALWRNDFDEYGFQWIDCDDNKNSVISFMRREKTDGEWLVIVANFTPQNHSNYRIGV
FT                   PVDGFYEEIFNTDASQYGGSNLGNMGGKSTDLYNIHGYENSIDLCLPPLSVLVLKHKSK
FT                   KN"
FT   gene            complement(583125..584702)
FT                   /locus_tag="NATL1_06411"
FT   CDS_pept        complement(583125..584702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06411"
FT                   /product="Predicted acyl esterases"
FT                   /note="COG2936 Predicted acyl esterases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75203"
FT                   /db_xref="GOA:A2C143"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2C143"
FT                   /protein_id="ABM75203.1"
FT                   /translation="MNSIRYRDEDLQLRDGTVLKSRIWSPQGNGPWPVLLMRQPYGREI
FT                   ASTITYAHPSWWASKGYLVVIQDVRGQGGSGGEFSGFNQEASDTSQTHNWVRSLPECNG
FT                   LLGTYGFSYQGLTQLIAEEGTPPPDCIIPAMTGLSEDEHWSCEGGAFWWHLGIGWGLQL
FT                   AAQKAQREKNWKGWHEIRENLESKKYLYNGHDLLEKYDPEGMAYKWLNLSSSKTPQWKT
FT                   HKPLSSWLKKPLLLIGGWWDPHLKGILDIFEKAKKAGGNPKLLIGPATHLQWWEGAQRT
FT                   QLDFFDSHLKEKNKESHFSHINLWNLTTKSWELSVQNKTPTWSLRSEGLASINHLEGFL
FT                   APNSDLEADSEVKLVHDPWRPIPSIGGHLSDTPGEANRYQLDIRPDVAVFTSDSISKDL
FT                   RLEGIPTLFLETNCDRECFDLFVALSIIPKAVENTVTQLSTGVLRIADCDKGITSAREI
FT                   RLQPILATFKKGDRLRISISGSGWPAIGINPGQSKYLCEGPSPNCLVTTISLLLLNSKL
FT                   KFESLISS"
FT   gene            complement(584710..584979)
FT                   /locus_tag="NATL1_06421"
FT   CDS_pept        complement(584710..584979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06421"
FT                   /product="conserved hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75204"
FT                   /db_xref="UniProtKB/TrEMBL:A2C144"
FT                   /protein_id="ABM75204.1"
FT                   /translation="MNGLLITLIFASFGINQGVIAQSRLLEGVKRNPDEAKSICESFRK
FT                   LNKENISAGSQKSIQKISIQKNISEGDAEILSMYVRGLYCPETF"
FT   gene            complement(585026..585442)
FT                   /locus_tag="NATL1_06431"
FT   CDS_pept        complement(585026..585442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06431"
FT                   /product="conserved hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75205"
FT                   /db_xref="InterPro:IPR025567"
FT                   /db_xref="UniProtKB/TrEMBL:A2C145"
FT                   /protein_id="ABM75205.1"
FT                   /translation="MSNKSLLKDLPKSFYQEEKILISNNIKTWDSLLSISDEEINNLIY
FT                   GSLGSVRNLKRLKCIAYFICTLDIQLSEAALLMHSGLISNKAISRLTPQELVQKTGRFE
FT                   RTLRTGRIPIIDLKKAHFLIEKAKKNLFNVPKCH"
FT   gene            complement(585435..585974)
FT                   /locus_tag="NATL1_06441"
FT   CDS_pept        complement(585435..585974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75206"
FT                   /db_xref="GOA:A2C146"
FT                   /db_xref="InterPro:IPR019664"
FT                   /db_xref="UniProtKB/TrEMBL:A2C146"
FT                   /protein_id="ABM75206.1"
FT                   /translation="MSMIEVIQDVTKWLAWGGAGLGVLTILAYLFNWGIKFRLTGTTIF
FT                   TLLLSASCWAFEQSYTPPFNVEGYKYAPIVYDNGFDLVVAQASNDFPKEAIKPTLLQIA
FT                   GNLKGGGRNGAQVKVRLRRIESAGDGISKPIILGELINDLKESKIIELPDRNYSASEYL
FT                   SNDADIEEIPSLETDE"
FT   gene            586042..590001
FT                   /locus_tag="NATL1_06451"
FT   CDS_pept        586042..590001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06451"
FT                   /product="conserved hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75207"
FT                   /db_xref="GOA:A2C147"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A2C147"
FT                   /protein_id="ABM75207.1"
FT                   /translation="MGDEWSSKRLKRWGLAGTFAALGGVLIWSGADLLVDRTISRFSPQ
FT                   IEKTLSNSLGHPLKIGSYRGLRPWGVELGPTRLLPGIKDSSSVNISNLTIKFAPFASLL
FT                   NWKPVAIFNPKGTEIILNKNDTGSFWVVPQKDNPKQINLQLKFNLKEPTKIVFNAGDTT
FT                   LLAKGNLSLNLGEKKIFGAINLESKEQGSLYLSGKGYWDGIEFQTKVKINKLSLSIFER
FT                   ILGNNSNFIAEGNINGSLKLGVKKGLIRCNGGLLLNNLTLKGGPLSDTLSTNNSKIECD
FT                   KNKLKLIDSNWNYGYWDISNSSEIPFYKKDKTYINSETTIKIKDFDHKPLSLKLKLPIS
FT                   VVDRQFIPGELNANFNLESFPLGALNPILNASLSGKLNTKGDFQGPLSSLNSTINLSLE
FT                   NPQVNGIRLREKWRGSFTRIPSEKKWGSLRMKSEGASIPGNLQINFNKDGNFNDLNLNR
FT                   LGGEISLNPKSNAFEWEANKFKLDRVEVAFPPEKSFKRIFGEVTGNGLFSLDPLFLNGD
FT                   LSLDYFRLLGFKLKNASIKGQIKNSETNLTGELIPSENGKIKFDINNGSEFSLSAQVKD
FT                   VSASWITATALEFPKLGLKYSDAIGKAEDLEKFIIGYPISSIDSQFEALTRSQDSYREE
FT                   ISKVNSKSIINPYDLKGDINADIKLSGPNLSDLNLEAKAFGKVWTNKLKIINSNKIRPF
FT                   KVTLNGNLASGLGDFSLLNLNFSLLSLVAPIPSAVDGYFGLKGKYSLANSTPKVTADLI
FT                   IKDTVIYNRKIILDNGNIIFKDNNLEFDITLRDKSSANPVKLGGTYPLISSYPIDLKIE
FT                   SHGDGLAFLTGLTKGNVSWTSGTADLSLLIRGTPAKPVANGFLVLKNSELLFQDKEINN
FT                   LNSTIVFDFNRLEIRDLKANMGANGIISSQGGISLFDSQLSESEPLALSIEKTRIKTAF
FT                   TDIRASSSLVVKGSILKPQLSGEVFISEGSIFAKRANNPSKTSSEKSDRYKDSKVRIIR
FT                   RLPEQNWNQKEPLVLFIKDEDAPASRIVSAGLPNGFESLTFDNLKLALGPSLRLVSQPL
FT                   ASFETNGFLILNGAFDETLDVSGVIKLDSGYVNLFTTTFNLDQSEPNVAVFVPSMGLVP
FT                   YVDVTLNSRVPDNVRDVSNFSSNGMASFGIGGSRFVNVEVAASGPADRISENFQLRSTP
FT                   SLGRSELIGLLGGNSLANLISSGGNGDVLASFLNRSFASYLQGNINGFLSDRLQISLYP
FT                   AYINGSDSEDDTSDSSSSSADQEDTNLPGQQAWVTEIGVDLNDKINFSVQAAPNRKDIP
FT                   PKGNITFQMNPNVGLLGSFDKNGNWQSQLQLYFRY"
FT   gene            590149..591465
FT                   /gene="proA"
FT                   /locus_tag="NATL1_06461"
FT   CDS_pept        590149..591465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="NATL1_06461"
FT                   /product="Gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="COG14 Gamma-glutamyl phosphate reductase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75208"
FT                   /db_xref="GOA:A2C148"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C148"
FT                   /protein_id="ABM75208.1"
FT                   /translation="MSTNFSVPEPTPQLVKVAESAKEASISLGQSTNKQRCEALTEMAN
FT                   ALNDNADEILKANVQDLERSEKEGLNKSLLSRLQLTKTKLKGCIDGVLKVSNLADPIGK
FT                   RQLHRELDENLILERVTVPLGVLGVIFESRPDALIQIASLAVRSGNGALLKGGSEAKDT
FT                   NQSIMDSLDKGLRKSNVGSGALSLLTTRQESLGLLRLDKFVNLIIPRGSNELVQFIQEN
FT                   TRIPVLGHADGICHLYVDNSVDIDKAISIALDSKIQYPAACNAIETLLIHEDVAEMFLK
FT                   KGLPIFSSEGVTLKGDTKSQALGVKNKADESDWSKEYLDLILSIKIVRNVNEAIEHIRK
FT                   YSSRHTEAIVTEDKMVAEKFLSSVDSAGVYHNCSTRFADGFRYGFGAEVGISTQTLPPR
FT                   GPVGLEGLVTYRYYLRGDGDLVKDFASGDRSFSHIDLPL"
FT   gene            591462..591851
FT                   /gene="folB"
FT                   /locus_tag="NATL1_06471"
FT   CDS_pept        591462..591851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="NATL1_06471"
FT                   /product="Possible dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="COG1539 Dihydroneopterin aldolase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75209"
FT                   /db_xref="GOA:A2C149"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A2C149"
FT                   /protein_id="ABM75209.1"
FT                   /translation="MSQLHNLSAIHIKDINLWAHVGVLESERIHGQRFLLDLSFWLELD
FT                   ESSKLDKLDKSIDYSEAIKAVKKLSFEIKCLTIEYFSDQILNLLESLYGPVPIHILLTK
FT                   CSPPIDGFTGSVLIEKKRNFLFPIN"
FT   gene            591852..592454
FT                   /locus_tag="NATL1_06481"
FT   CDS_pept        591852..592454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06481"
FT                   /product="lipase family protein"
FT                   /EC_number="3.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75210"
FT                   /db_xref="GOA:A2C150"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2C150"
FT                   /protein_id="ABM75210.1"
FT                   /translation="MYINKRPIFLVHGLWNNPKLFEKLIKKINEDDYELYRPHLPHKYG
FT                   KTSLKRLALDLDSKIEELVGPEIEIDIVGFSMGGLISRFWLQNHDGFLRTKRFFSIGTP
FT                   HFGTYTAQMIPSFLMPGIAEMKRGSRLLSLLNNDLTSLEKVECTSFFTKWDLMSFPGWQ
FT                   AKLSIGESYHLPVLTHKELITNSSSLDILVKKIFKNS"
FT   gene            complement(592451..594562)
FT                   /gene="prlC"
FT                   /locus_tag="NATL1_06491"
FT   CDS_pept        complement(592451..594562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="NATL1_06491"
FT                   /product="Peptidase family M3"
FT                   /EC_number="3.4.24.70"
FT                   /note="COG339 Zn-dependent oligopeptidases [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75211"
FT                   /db_xref="GOA:A2C151"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A2C151"
FT                   /protein_id="ABM75211.1"
FT                   /translation="MTSIKPTALLKGEGLPDYDKITPNEITENIPKLIKELNEKLDKLE
FT                   VQLEKQLQTKSSLSWGDVMPQLYEIGEKLRWSWGVVSHLNAVCNSTKLREVHSNQQPTI
FT                   VRFSNQLAQNEVIFKALLNLKEHGNIKDETQIRILETELITMKNKGIGLEADEKTLFNS
FT                   RSERLAELSTTFSNNVLDATKNWSLLLKNKSEVEGLPERALETLALAAKEAGDKDEEGN
FT                   NPSSSIGPWRVGLDLPRYIPFQTYAKNRRIREKVYRAFVSRASDGKINNKKIIEEILEL
FT                   RNKQAKLLGYKNWCEISLATKMADNEEAVEMLLEELRLAAIPHAEKEVIHLRECAKRNG
FT                   ENEDFELSPWDISFWSEVLRKEKYDLDQEKLRPWFPLDQVLDGLFNLCKRLFEIDIEEA
FT                   INTAPLWHEDVRFFNVKNIDGQKIASFYLDPFSRPATKRGGAWMDECLCRNQKTKDDIV
FT                   LPVAYLVCNQTPPIADKPSLMSFEEVETLFHEFGHGLQHMLTTINYPQAAGINNVEWDA
FT                   VELASQFMENWCLEDQTISEIAIHWKTKEPLPESEINKLRQSRTFNSGLATLRQIHFAL
FT                   TDLKLHSQWNKDLEISPDELRREIAKNTTVMDPIPEDQFLCAFSHIFAGGYAAGYYSYK
FT                   WAEVLSSDAFAAFEEAGLANQDEVRKIGKKYRDSILSLGGSRSPNKVFKQFRGRLPSTE
FT                   ALIRHSGLN"
FT   gene            complement(594579..596153)
FT                   /locus_tag="NATL1_06501"
FT   CDS_pept        complement(594579..596153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NATL1_06501"
FT                   /product="putative NADH Dehydrogenase (complex I) subunit
FT                   (chain 4)"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1008 NADH:ubiquinone oxidoreductase subunit 4
FT                   (chain M) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75212"
FT                   /db_xref="GOA:A2C152"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A2C152"
FT                   /protein_id="ABM75212.1"
FT                   /translation="MADLPQIMDANLPMSIDSQTVFPWLSLIVLLPIVGALIMPFLPTQ
FT                   ESKNFNLPRNIALVILLADFLIVVLAFANLFDPNSESLQLVERLQWLPSIGLEWSLGVD
FT                   GISAPLVVLSGLITFLSAAASWKVKQKTRLYFALLLIQASAQALVFLSQDFLLFFLAWE
FT                   LELVPVYLLIAIWGGKRKLYAATKFILYTALASLLILISGLALALSGDQFTFNLSEIAA
FT                   KSFTGNFGIFCYLGFLIGFGVKLPIFPLHTWLPDAHGEANAPVSMLLAGVLLKMGGYAL
FT                   IRFNVQILPDTHLILAPALIIIGIVNIIYGALNAFAQDNVKRRIACSSVSHMGFVLVGI
FT                   GAVNALGISGAMLQMISHGLIAAAMFFVTGSFYERTNTLSIPNMGGLAKALPITFAFFL
FT                   ASSLASLALPGMSGFISEITVFLGITSQEGFTSLFRAITILLAAIGLVLTPIYLLSMCR
FT                   RVFFGPRIPALSIVKEMDARELSIGLSLLVPTLVIGFWPRIAIDLYEVSTNALAQSLIT
FT                   NNLVPIS"
FT   gene            complement(596190..597137)
FT                   /gene="thrB"
FT                   /locus_tag="NATL1_06511"
FT   CDS_pept        complement(596190..597137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="NATL1_06511"
FT                   /product="Homoserine kinase:GHMP kinases putative
FT                   ATP-binding domain"
FT                   /EC_number="2.7.1.39"
FT                   /note="COG83 Homoserine kinase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75213"
FT                   /db_xref="GOA:A2C153"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C153"
FT                   /protein_id="ABM75213.1"
FT                   /translation="MGPPKIGQTVVVEVPSTTANIGPGFDCLGAALDLSNQFTIKRIEG
FT                   NAERFELIMESTEGNHLRGGPENLFYRAAQRVWRTAGVEPVALEARVKLAVPPARGLGS
FT                   SATAIVAGLVGANALAGYPLPKEKLLELAIDIEGHPDNVVPSLIGGLCVTAKTATDRWR
FT                   VVRCDWDQSIKAVVAIPSIRLSTSEARRVMPENIPVNDAVINLGALTLLLQGLRTGNED
FT                   LIADGMHDKLHEPYRWGLIKGGLEVREAAKAAGALGCAISGAGPSILALCKATKGREVS
FT                   VAMVKAWEAAGVASRAPLMSLQLTGSECISNTFG"
FT   gene            complement(597149..598192)
FT                   /gene="glk"
FT                   /locus_tag="NATL1_06521"
FT   CDS_pept        complement(597149..598192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="NATL1_06521"
FT                   /product="Putative glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="COG837 Glucokinase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75214"
FT                   /db_xref="GOA:A2C154"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:A2C154"
FT                   /protein_id="ABM75214.1"
FT                   /translation="MNLLAGDLGGTKTILAIYSNENYPKKIFERYYISSEWKSFYSLFE
FT                   DFIKHLPDHISLPQYGSIGVAGPIQNQEVKITNLGWDIESKKLSLLSKINNIELINDFS
FT                   VLIYGIPFFNRNQYEVIQGTLNSDYKNDQKLIAIIGAGTGLGMSRGLITPKSISIFPSE
FT                   GGHREFSPRTENEWALVKWLKKKLNIQRISIERIVSGTGLGMIARWKLDDPINESHPLQ
FT                   VILKNMDSDKSDSTDLPALVWEKAKNGDKLMTEALQLWLNAYGSAAGDLALQELCSSGL
FT                   WISGGTAAKNLDGINSSNFLNAFSNKGRFQSYLKEIPLIVLKDPEATLFSSACRARLSA
FT                   ESNGRLS"
FT   gene            complement(598216..600138)
FT                   /gene="thrS"
FT                   /locus_tag="NATL1_06531"
FT   CDS_pept        complement(598216..600138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="NATL1_06531"
FT                   /product="Threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="COG441 Threonyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:NATL1_06531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM75215"
FT                   /db_xref="GOA:A2C155"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C155"
FT                   /protein_id="ABM75215.1"
FT                   /translation="MPIITLPDGSEKNYESSVTIEKIATDIGPGLAKAALAGRVNGNLL
FT                   DTCIPITNDAEIQIITSKDNEGLEIIRHSFAHLLGHAVKQLYPEAKMAIGPVIEDGFYY
FT                   DISYKDTFTPVDLEKIEKRIKELINKDYDVDVEVVSPAKATQVFSERGEVFKLDIIKNI
FT                   PKDEIIKLYKHEEYIDMCRGPHVPNTRHLRAFKLMKVSGAYWRGDSNNEMLQRIYGTAW
FT                   KNSKELKEYINRIEEAEKRDHRKLGKKLSLFHFQEEAPGMIFWHPNGWTIYRVLQDFIR
FT                   ETISKYDYQELKSPQIVCRSLWEKSGHWDKFKEDMFTTTSENKEYAIKPMNCPCHVQVF
FT                   NQGLKSYRDLPIRLSEFGSCHRNEPSGALHGLMRVRNFVQDDGHIFCTNEQIQEEVQSF
FT                   IDLVFEVYKAFGFNSILIKLSTRPEKRVGSDDVWDKSEKALSDALDSKGLDWSLLPGEG
FT                   AFYGPKIEFSLKDCLNRVWQCGTIQVDFSMPERLNSSYIDVDGKKQPPVMLHRAILGSF
FT                   ERFIGILIENYSGNLPIWLCPLQIVVMGITDRNNDACLDTKSKLIKYGFRASVDTRNEK
FT                   VGFKIREHTMQRIPFLIIIGDKEEENNEISVRTREGKDLGKMTLDKFKVIMDESISKKS
FT                   LVESK"
FT   gene            complement(600145..601158)
FT                   /gene="trpS"
FT