(data stored in ACNUC7421 zone)

EMBL: CP000554

ID   CP000554; SV 1; circular; genomic DNA; STD; PRO; 2682675 BP.
AC   CP000554;
PR   Project:PRJNA13496;
DT   23-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
DE   Prochlorococcus marinus str. MIT 9303, complete genome.
KW   .
OS   Prochlorococcus marinus str. MIT 9303
OC   Bacteria; Cyanobacteria; Synechococcales; Prochloraceae; Prochlorococcus.
RN   [1]
RP   1-2682675
RX   DOI; 10.1371/journal.pgen.0030231.
RX   PUBMED; 18159947.
RA   Kettler G.C., Martiny A.C., Huang K., Zucker J., Coleman M.L., Rodrigue S.,
RA   Chen F., Lapidus A., Ferriera S., Johnson J., Steglich C., Church G.M.,
RA   Richardson P., Chisholm S.W.;
RT   "Patterns and implications of gene gain and loss in the evolution of
RT   Prochlorococcus";
RL   PloS Genet. 3(12):E231-E231(2007).
RN   [2]
RP   1-2682675
RA   Chisholm S., Huang K., Martiny A., Kettler G., Zucker J., Coleman M.,
RA   Keller K., Arkin A., Coe A., Rodrigue S., Church G., Ferriera S.,
RA   Johnson J., Kravitz S., Beeson K., Sutton G., Rogers Y.-H., Friedman R.,
RA   Frazier M., Venter J.C.;
RT   ;
RL   Submitted (10-JAN-2007) to the INSDC.
RL   J Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
DR   MD5; 0f92f6d73707a031903ebbf90eb49191.
DR   BioSample; SAMN02603917.
DR   EnsemblGenomes-Gn; EBG00001019308.
DR   EnsemblGenomes-Gn; EBG00001019309.
DR   EnsemblGenomes-Gn; EBG00001019310.
DR   EnsemblGenomes-Gn; EBG00001019311.
DR   EnsemblGenomes-Gn; EBG00001019312.
DR   EnsemblGenomes-Gn; EBG00001019313.
DR   EnsemblGenomes-Gn; EBG00001019314.
DR   EnsemblGenomes-Gn; EBG00001019315.
DR   EnsemblGenomes-Gn; EBG00001019316.
DR   EnsemblGenomes-Gn; EBG00001019317.
DR   EnsemblGenomes-Gn; EBG00001019318.
DR   EnsemblGenomes-Gn; EBG00001019319.
DR   EnsemblGenomes-Gn; EBG00001019320.
DR   EnsemblGenomes-Gn; EBG00001019321.
DR   EnsemblGenomes-Gn; EBG00001019322.
DR   EnsemblGenomes-Gn; EBG00001019323.
DR   EnsemblGenomes-Gn; EBG00001019324.
DR   EnsemblGenomes-Gn; EBG00001019325.
DR   EnsemblGenomes-Gn; EBG00001019326.
DR   EnsemblGenomes-Gn; EBG00001019327.
DR   EnsemblGenomes-Gn; EBG00001019328.
DR   EnsemblGenomes-Gn; EBG00001019329.
DR   EnsemblGenomes-Gn; EBG00001019330.
DR   EnsemblGenomes-Gn; EBG00001019331.
DR   EnsemblGenomes-Gn; EBG00001019332.
DR   EnsemblGenomes-Gn; EBG00001019333.
DR   EnsemblGenomes-Gn; EBG00001019334.
DR   EnsemblGenomes-Gn; EBG00001019335.
DR   EnsemblGenomes-Gn; EBG00001019336.
DR   EnsemblGenomes-Gn; EBG00001019337.
DR   EnsemblGenomes-Gn; EBG00001019338.
DR   EnsemblGenomes-Gn; EBG00001019339.
DR   EnsemblGenomes-Gn; EBG00001019340.
DR   EnsemblGenomes-Gn; EBG00001019341.
DR   EnsemblGenomes-Gn; EBG00001019342.
DR   EnsemblGenomes-Gn; EBG00001019343.
DR   EnsemblGenomes-Gn; EBG00001019344.
DR   EnsemblGenomes-Gn; EBG00001019345.
DR   EnsemblGenomes-Gn; EBG00001019346.
DR   EnsemblGenomes-Gn; EBG00001019347.
DR   EnsemblGenomes-Gn; EBG00001019348.
DR   EnsemblGenomes-Gn; EBG00001019349.
DR   EnsemblGenomes-Gn; EBG00001019350.
DR   EnsemblGenomes-Gn; EBG00001019351.
DR   EnsemblGenomes-Gn; EBG00001019352.
DR   EnsemblGenomes-Gn; EBG00001019353.
DR   EnsemblGenomes-Gn; EBG00001019354.
DR   EnsemblGenomes-Gn; EBG00001019355.
DR   EnsemblGenomes-Gn; EBG00001019356.
DR   EnsemblGenomes-Gn; EBG00001019357.
DR   EnsemblGenomes-Gn; EBG00001019358.
DR   EnsemblGenomes-Gn; EBG00001019359.
DR   EnsemblGenomes-Gn; EBG00001019360.
DR   EnsemblGenomes-Gn; EBG00001019361.
DR   EnsemblGenomes-Gn; EBG00001019362.
DR   EnsemblGenomes-Gn; EBG00001019363.
DR   EnsemblGenomes-Gn; EBG00001019364.
DR   EnsemblGenomes-Gn; EBG00001019365.
DR   EnsemblGenomes-Gn; EBG00001019366.
DR   EnsemblGenomes-Gn; EBG00001019367.
DR   EnsemblGenomes-Gn; EBG00001019368.
DR   EnsemblGenomes-Gn; EBG00001019369.
DR   EnsemblGenomes-Gn; EBG00001019370.
DR   EnsemblGenomes-Gn; EBG00001019371.
DR   EnsemblGenomes-Gn; P9303_rrfVIMSS1309421.
DR   EnsemblGenomes-Gn; P9303_rrfVIMSS1309422.
DR   EnsemblGenomes-Gn; P9303_rrlVIMSS1365778.
DR   EnsemblGenomes-Gn; P9303_rrlVIMSS1365779.
DR   EnsemblGenomes-Gn; P9303_rrsVIMSS1309419.
DR   EnsemblGenomes-Gn; P9303_rrsVIMSS1309420.
DR   EnsemblGenomes-Gn; P9303_tRNAAlaVIMSS1309258.
DR   EnsemblGenomes-Gn; P9303_tRNAAlaVIMSS1309282.
DR   EnsemblGenomes-Gn; P9303_tRNAAlaVIMSS1309286.
DR   EnsemblGenomes-Gn; P9303_tRNAAlaVIMSS1309290.
DR   EnsemblGenomes-Gn; P9303_tRNAArgVIMSS1309268.
DR   EnsemblGenomes-Gn; P9303_tRNAArgVIMSS1309273.
DR   EnsemblGenomes-Gn; P9303_tRNAArgVIMSS1309275.
DR   EnsemblGenomes-Gn; P9303_tRNAArgVIMSS1309279.
DR   EnsemblGenomes-Gn; P9303_tRNAAsnVIMSS1309287.
DR   EnsemblGenomes-Gn; P9303_tRNAAspVIMSS1309266.
DR   EnsemblGenomes-Gn; P9303_tRNACysVIMSS1309280.
DR   EnsemblGenomes-Gn; P9303_tRNAGlnVIMSS1309278.
DR   EnsemblGenomes-Gn; P9303_tRNAGluVIMSS1309264.
DR   EnsemblGenomes-Gn; P9303_tRNAGlyVIMSS1309271.
DR   EnsemblGenomes-Gn; P9303_tRNAGlyVIMSS1309288.
DR   EnsemblGenomes-Gn; P9303_tRNAGlyVIMSS1309292.
DR   EnsemblGenomes-Gn; P9303_tRNAHisVIMSS1309297.
DR   EnsemblGenomes-Gn; P9303_tRNAIleVIMSS1309281.
DR   EnsemblGenomes-Gn; P9303_tRNAIleVIMSS1309289.
DR   EnsemblGenomes-Gn; P9303_tRNALeuVIMSS1309257.
DR   EnsemblGenomes-Gn; P9303_tRNALeuVIMSS1309259.
DR   EnsemblGenomes-Gn; P9303_tRNALeuVIMSS1309276.
DR   EnsemblGenomes-Gn; P9303_tRNALeuVIMSS1309291.
DR   EnsemblGenomes-Gn; P9303_tRNALeuVIMSS1309296.
DR   EnsemblGenomes-Gn; P9303_tRNALysVIMSS1309293.
DR   EnsemblGenomes-Gn; P9303_tRNAMetVIMSS1309261.
DR   EnsemblGenomes-Gn; P9303_tRNAMetVIMSS1309263.
DR   EnsemblGenomes-Gn; P9303_tRNAPheVIMSS1309284.
DR   EnsemblGenomes-Gn; P9303_tRNAProVIMSS1309277.
DR   EnsemblGenomes-Gn; P9303_tRNAProVIMSS1309294.
DR   EnsemblGenomes-Gn; P9303_tRNAProVIMSS1309295.
DR   EnsemblGenomes-Gn; P9303_tRNASerVIMSS1309256.
DR   EnsemblGenomes-Gn; P9303_tRNASerVIMSS1309260.
DR   EnsemblGenomes-Gn; P9303_tRNASerVIMSS1309262.
DR   EnsemblGenomes-Gn; P9303_tRNASerVIMSS1309285.
DR   EnsemblGenomes-Gn; P9303_tRNAThrVIMSS1309270.
DR   EnsemblGenomes-Gn; P9303_tRNAThrVIMSS1309283.
DR   EnsemblGenomes-Gn; P9303_tRNAThrVIMSS1309299.
DR   EnsemblGenomes-Gn; P9303_tRNATrpVIMSS1309265.
DR   EnsemblGenomes-Gn; P9303_tRNATyrVIMSS1309298.
DR   EnsemblGenomes-Gn; P9303_tRNAValVIMSS1309267.
DR   EnsemblGenomes-Gn; P9303_tRNAValVIMSS1309269.
DR   EnsemblGenomes-Gn; P9303_tRNAValVIMSS1309272.
DR   EnsemblGenomes-Tr; EBT00001622208.
DR   EnsemblGenomes-Tr; EBT00001622212.
DR   EnsemblGenomes-Tr; EBT00001622214.
DR   EnsemblGenomes-Tr; EBT00001622217.
DR   EnsemblGenomes-Tr; EBT00001622219.
DR   EnsemblGenomes-Tr; EBT00001622221.
DR   EnsemblGenomes-Tr; EBT00001622223.
DR   EnsemblGenomes-Tr; EBT00001622225.
DR   EnsemblGenomes-Tr; EBT00001622227.
DR   EnsemblGenomes-Tr; EBT00001622229.
DR   EnsemblGenomes-Tr; EBT00001622231.
DR   EnsemblGenomes-Tr; EBT00001622233.
DR   EnsemblGenomes-Tr; EBT00001622235.
DR   EnsemblGenomes-Tr; EBT00001622238.
DR   EnsemblGenomes-Tr; EBT00001622240.
DR   EnsemblGenomes-Tr; EBT00001622242.
DR   EnsemblGenomes-Tr; EBT00001622244.
DR   EnsemblGenomes-Tr; EBT00001622246.
DR   EnsemblGenomes-Tr; EBT00001622248.
DR   EnsemblGenomes-Tr; EBT00001622250.
DR   EnsemblGenomes-Tr; EBT00001622252.
DR   EnsemblGenomes-Tr; EBT00001622253.
DR   EnsemblGenomes-Tr; EBT00001622254.
DR   EnsemblGenomes-Tr; EBT00001622255.
DR   EnsemblGenomes-Tr; EBT00001622256.
DR   EnsemblGenomes-Tr; EBT00001622257.
DR   EnsemblGenomes-Tr; EBT00001622258.
DR   EnsemblGenomes-Tr; EBT00001622259.
DR   EnsemblGenomes-Tr; EBT00001622260.
DR   EnsemblGenomes-Tr; EBT00001622261.
DR   EnsemblGenomes-Tr; EBT00001622262.
DR   EnsemblGenomes-Tr; EBT00001622263.
DR   EnsemblGenomes-Tr; EBT00001622264.
DR   EnsemblGenomes-Tr; EBT00001622265.
DR   EnsemblGenomes-Tr; EBT00001622266.
DR   EnsemblGenomes-Tr; EBT00001622267.
DR   EnsemblGenomes-Tr; EBT00001622268.
DR   EnsemblGenomes-Tr; EBT00001622269.
DR   EnsemblGenomes-Tr; EBT00001622270.
DR   EnsemblGenomes-Tr; EBT00001622271.
DR   EnsemblGenomes-Tr; EBT00001622272.
DR   EnsemblGenomes-Tr; EBT00001622273.
DR   EnsemblGenomes-Tr; EBT00001622274.
DR   EnsemblGenomes-Tr; EBT00001622275.
DR   EnsemblGenomes-Tr; EBT00001622276.
DR   EnsemblGenomes-Tr; EBT00001622277.
DR   EnsemblGenomes-Tr; EBT00001622278.
DR   EnsemblGenomes-Tr; EBT00001622279.
DR   EnsemblGenomes-Tr; EBT00001622280.
DR   EnsemblGenomes-Tr; EBT00001622281.
DR   EnsemblGenomes-Tr; EBT00001622282.
DR   EnsemblGenomes-Tr; EBT00001622283.
DR   EnsemblGenomes-Tr; EBT00001622284.
DR   EnsemblGenomes-Tr; EBT00001622285.
DR   EnsemblGenomes-Tr; EBT00001622286.
DR   EnsemblGenomes-Tr; EBT00001622287.
DR   EnsemblGenomes-Tr; EBT00001622288.
DR   EnsemblGenomes-Tr; EBT00001622289.
DR   EnsemblGenomes-Tr; EBT00001622290.
DR   EnsemblGenomes-Tr; EBT00001622291.
DR   EnsemblGenomes-Tr; EBT00001622292.
DR   EnsemblGenomes-Tr; EBT00001622293.
DR   EnsemblGenomes-Tr; EBT00001622294.
DR   EnsemblGenomes-Tr; EBT00001622295.
DR   EnsemblGenomes-Tr; P9303_rrfVIMSS1309421-1.
DR   EnsemblGenomes-Tr; P9303_rrfVIMSS1309422-1.
DR   EnsemblGenomes-Tr; P9303_rrlVIMSS1365778-1.
DR   EnsemblGenomes-Tr; P9303_rrlVIMSS1365779-1.
DR   EnsemblGenomes-Tr; P9303_rrsVIMSS1309419-1.
DR   EnsemblGenomes-Tr; P9303_rrsVIMSS1309420-1.
DR   EnsemblGenomes-Tr; P9303_tRNAAlaVIMSS1309258-1.
DR   EnsemblGenomes-Tr; P9303_tRNAAlaVIMSS1309282-1.
DR   EnsemblGenomes-Tr; P9303_tRNAAlaVIMSS1309286-1.
DR   EnsemblGenomes-Tr; P9303_tRNAAlaVIMSS1309290-1.
DR   EnsemblGenomes-Tr; P9303_tRNAArgVIMSS1309268-1.
DR   EnsemblGenomes-Tr; P9303_tRNAArgVIMSS1309273-1.
DR   EnsemblGenomes-Tr; P9303_tRNAArgVIMSS1309275-1.
DR   EnsemblGenomes-Tr; P9303_tRNAArgVIMSS1309279-1.
DR   EnsemblGenomes-Tr; P9303_tRNAAsnVIMSS1309287-1.
DR   EnsemblGenomes-Tr; P9303_tRNAAspVIMSS1309266-1.
DR   EnsemblGenomes-Tr; P9303_tRNACysVIMSS1309280-1.
DR   EnsemblGenomes-Tr; P9303_tRNAGlnVIMSS1309278-1.
DR   EnsemblGenomes-Tr; P9303_tRNAGluVIMSS1309264-1.
DR   EnsemblGenomes-Tr; P9303_tRNAGlyVIMSS1309271-1.
DR   EnsemblGenomes-Tr; P9303_tRNAGlyVIMSS1309288-1.
DR   EnsemblGenomes-Tr; P9303_tRNAGlyVIMSS1309292-1.
DR   EnsemblGenomes-Tr; P9303_tRNAHisVIMSS1309297-1.
DR   EnsemblGenomes-Tr; P9303_tRNAIleVIMSS1309281-1.
DR   EnsemblGenomes-Tr; P9303_tRNAIleVIMSS1309289-1.
DR   EnsemblGenomes-Tr; P9303_tRNALeuVIMSS1309257-1.
DR   EnsemblGenomes-Tr; P9303_tRNALeuVIMSS1309259-1.
DR   EnsemblGenomes-Tr; P9303_tRNALeuVIMSS1309276-1.
DR   EnsemblGenomes-Tr; P9303_tRNALeuVIMSS1309291-1.
DR   EnsemblGenomes-Tr; P9303_tRNALeuVIMSS1309296-1.
DR   EnsemblGenomes-Tr; P9303_tRNALysVIMSS1309293-1.
DR   EnsemblGenomes-Tr; P9303_tRNAMetVIMSS1309261-1.
DR   EnsemblGenomes-Tr; P9303_tRNAMetVIMSS1309263-1.
DR   EnsemblGenomes-Tr; P9303_tRNAPheVIMSS1309284-1.
DR   EnsemblGenomes-Tr; P9303_tRNAProVIMSS1309277-1.
DR   EnsemblGenomes-Tr; P9303_tRNAProVIMSS1309294-1.
DR   EnsemblGenomes-Tr; P9303_tRNAProVIMSS1309295-1.
DR   EnsemblGenomes-Tr; P9303_tRNASerVIMSS1309256-1.
DR   EnsemblGenomes-Tr; P9303_tRNASerVIMSS1309260-1.
DR   EnsemblGenomes-Tr; P9303_tRNASerVIMSS1309262-1.
DR   EnsemblGenomes-Tr; P9303_tRNASerVIMSS1309285-1.
DR   EnsemblGenomes-Tr; P9303_tRNAThrVIMSS1309270-1.
DR   EnsemblGenomes-Tr; P9303_tRNAThrVIMSS1309283-1.
DR   EnsemblGenomes-Tr; P9303_tRNAThrVIMSS1309299-1.
DR   EnsemblGenomes-Tr; P9303_tRNATrpVIMSS1309265-1.
DR   EnsemblGenomes-Tr; P9303_tRNATyrVIMSS1309298-1.
DR   EnsemblGenomes-Tr; P9303_tRNAValVIMSS1309267-1.
DR   EnsemblGenomes-Tr; P9303_tRNAValVIMSS1309269-1.
DR   EnsemblGenomes-Tr; P9303_tRNAValVIMSS1309272-1.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC3390001; 22768379.
DR   EuropePMC; PMC6102989; 29915114.
DR   EuropePMC; PMC6581173; 31028025.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01067; ATPC.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01704; Downstream-peptide.
DR   RFAM; RF01739; glnA.
DR   RFAM; RF01752; psaA.
DR   RFAM; RF01753; psbNH.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000554.
DR   SILVA-SSU; CP000554.
FH   Key             Location/Qualifiers
FT   source          1..2682675
FT                   /organism="Prochlorococcus marinus str. MIT 9303"
FT                   /strain="MIT 9303"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:59922"
FT   gene            205..1371
FT                   /gene="dnaN"
FT                   /locus_tag="P9303_00001"
FT   CDS_pept        205..1371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="P9303_00001"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number=""
FT                   /note="COG592 DNA polymerase sliding clamp subunit (PCNA
FT                   homolog) [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76757"
FT                   /db_xref="GOA:A2C5J7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5J7"
FT                   /protein_id="ABM76757.1"
FT   gene            1375..2151
FT                   /locus_tag="P9303_00011"
FT   CDS_pept        1375..2151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76758"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5J8"
FT                   /protein_id="ABM76758.1"
FT   gene            2209..4593
FT                   /locus_tag="P9303_00021"
FT   CDS_pept        2209..4593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00021"
FT                   /product="phosphoribosylformylglycinamidine synthetase II"
FT                   /EC_number=""
FT                   /note="COG46 Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, synthetase domain [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76759"
FT                   /db_xref="GOA:A2C5J9"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5J9"
FT                   /protein_id="ABM76759.1"
FT   gene            4653..6110
FT                   /gene="purF"
FT                   /locus_tag="P9303_00031"
FT   CDS_pept        4653..6110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="P9303_00031"
FT                   /product="Glutamine amidotransferase
FT                   class-II:Phosphoribosyl transferase"
FT                   /EC_number=""
FT                   /note="COG34 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76760"
FT                   /db_xref="GOA:A2C5K0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5K0"
FT                   /protein_id="ABM76760.1"
FT   gene            complement(6146..8635)
FT                   /locus_tag="P9303_00041"
FT   CDS_pept        complement(6146..8635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00041"
FT                   /product="DNA gyrase/topoisomerase IV, subunit A"
FT                   /EC_number=""
FT                   /note="COG188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76761"
FT                   /db_xref="GOA:A2C5K1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5K1"
FT                   /protein_id="ABM76761.1"
FT                   EEIQKLVPLITTNNIID"
FT   gene            complement(8713..9606)
FT                   /locus_tag="P9303_00051"
FT   CDS_pept        complement(8713..9606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00051"
FT                   /product="Flp pilus assembly protein TadD, contains TPR
FT                   repeats"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76762"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5K2"
FT                   /protein_id="ABM76762.1"
FT                   LRSAVERAEANADTNQ"
FT   gene            complement(9616..10590)
FT                   /locus_tag="P9303_00061"
FT   CDS_pept        complement(9616..10590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00061"
FT                   /product="Uncharacterized Fe-S protein"
FT                   /note="COG1600 Uncharacterized Fe-S protein [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76763"
FT                   /db_xref="GOA:A2C5K3"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5K3"
FT                   /protein_id="ABM76763.1"
FT   gene            10602..11291
FT                   /locus_tag="P9303_00071"
FT   CDS_pept        10602..11291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00071"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76764"
FT                   /db_xref="GOA:A2C5K4"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5K4"
FT                   /protein_id="ABM76764.1"
FT                   LALTAVL"
FT   gene            11363..12112
FT                   /locus_tag="P9303_00081"
FT   CDS_pept        11363..12112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00081"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG2928 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76765"
FT                   /db_xref="GOA:A2C5K5"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5K5"
FT                   /protein_id="ABM76765.1"
FT   gene            12142..12777
FT                   /gene="nusB"
FT                   /locus_tag="P9303_00091"
FT   CDS_pept        12142..12777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="P9303_00091"
FT                   /product="Antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76766"
FT                   /db_xref="GOA:A2C5K6"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5K6"
FT                   /protein_id="ABM76766.1"
FT   gene            12777..14231
FT                   /gene="ftsY"
FT                   /locus_tag="P9303_00101"
FT   CDS_pept        12777..14231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="P9303_00101"
FT                   /product="signal recognition particle docking protein FtsY"
FT                   /note="COG552 Signal recognition particle GTPase
FT                   [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76767"
FT                   /db_xref="GOA:A2C5K7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5K7"
FT                   /protein_id="ABM76767.1"
FT   gene            14295..15698
FT                   /gene="rsbU"
FT                   /locus_tag="P9303_00111"
FT   CDS_pept        14295..15698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /locus_tag="P9303_00111"
FT                   /product="Protein phosphatase 2C domain"
FT                   /note="COG2208 Serine phosphatase RsbU, regulator of sigma
FT                   subunit [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76768"
FT                   /db_xref="GOA:A2C5K8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5K8"
FT                   /protein_id="ABM76768.1"
FT                   VTLPSVSLA"
FT   gene            15728..17140
FT                   /gene="argH"
FT                   /locus_tag="P9303_00121"
FT   CDS_pept        15728..17140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="P9303_00121"
FT                   /product="Fumarate lyase:Delta crystallin"
FT                   /EC_number=""
FT                   /note="COG165 Argininosuccinate lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76769"
FT                   /db_xref="GOA:A2C5K9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5K9"
FT                   /protein_id="ABM76769.1"
FT                   RHWRSRLDSGVS"
FT   gene            17264..17872
FT                   /locus_tag="P9303_00131"
FT   CDS_pept        17264..17872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00131"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76770"
FT                   /db_xref="GOA:A2C5L0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5L0"
FT                   /protein_id="ABM76770.1"
FT   gene            complement(17882..18886)
FT                   /locus_tag="P9303_00141"
FT   CDS_pept        complement(17882..18886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00141"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /note="COG42 tRNA-dihydrouridine synthase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76771"
FT                   /db_xref="GOA:A2C5L1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5L1"
FT                   /protein_id="ABM76771.1"
FT   gene            18956..19462
FT                   /locus_tag="P9303_00151"
FT   CDS_pept        18956..19462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00151"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG229 Conserved domain frequently associated with
FT                   peptide methionine sulfoxide reductase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76772"
FT                   /db_xref="GOA:A2C5L2"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5L2"
FT                   /protein_id="ABM76772.1"
FT                   FRPAS"
FT   gene            19389..20711
FT                   /locus_tag="P9303_00161"
FT   CDS_pept        19389..20711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00161"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2081 Predicted flavoproteins [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76773"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5L3"
FT                   /protein_id="ABM76773.1"
FT   gene            complement(20686..21966)
FT                   /locus_tag="P9303_00171"
FT   CDS_pept        complement(20686..21966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00171"
FT                   /product="pili biogenesis protein"
FT                   /note="COG1459 Type II secretory pathway, component PulF
FT                   [Cell motility and secretion / Intracellular trafficking
FT                   and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76774"
FT                   /db_xref="GOA:A2C5L4"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5L4"
FT                   /protein_id="ABM76774.1"
FT   gene            complement(21983..23059)
FT                   /locus_tag="P9303_00181"
FT   CDS_pept        complement(21983..23059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00181"
FT                   /product="PilT1-like protein"
FT                   /note="COG2805 Tfp pilus assembly protein, pilus retraction
FT                   ATPase PilT [Cell motility and secretion / Intracellular
FT                   trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76775"
FT                   /db_xref="GOA:A2C5L5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5L5"
FT                   /protein_id="ABM76775.1"
FT                   AIAKASKPSELEQLLNDG"
FT   gene            complement(23070..24986)
FT                   /locus_tag="P9303_00191"
FT   CDS_pept        complement(23070..24986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00191"
FT                   /product="General secretion pathway protein E"
FT                   /note="COG2804 Type II secretory pathway, ATPase PulE/Tfp
FT                   pilus assembly pathway, ATPase PilB [Cell motility and
FT                   secretion / Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76776"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5L6"
FT                   /protein_id="ABM76776.1"
FT                   ARQ"
FT   gene            24985..25698
FT                   /gene="grpE"
FT                   /locus_tag="P9303_00201"
FT   CDS_pept        24985..25698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="P9303_00201"
FT                   /product="Heat shock protein GrpE"
FT                   /note="COG576 Molecular chaperone GrpE (heat shock protein)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76777"
FT                   /db_xref="GOA:A2C5L7"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5L7"
FT                   /protein_id="ABM76777.1"
FT                   TATFQGEADPAEPGV"
FT   gene            25743..26879
FT                   /gene="dnaJ"
FT                   /locus_tag="P9303_00211"
FT   CDS_pept        25743..26879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="P9303_00211"
FT                   /product="DnaJ protein"
FT                   /note="COG484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76778"
FT                   /db_xref="GOA:A2C5L8"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5L8"
FT                   /protein_id="ABM76778.1"
FT   gene            26876..27121
FT                   /locus_tag="P9303_00221"
FT   CDS_pept        26876..27121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76779"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5L9"
FT                   /protein_id="ABM76779.1"
FT   gene            27108..28073
FT                   /locus_tag="P9303_00231"
FT   CDS_pept        27108..28073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00231"
FT                   /product="Predicted GTPase"
FT                   /EC_number=""
FT                   /note="COG1162 Predicted GTPases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76780"
FT                   /db_xref="GOA:A2C5M0"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5M0"
FT                   /protein_id="ABM76780.1"
FT   gene            complement(28030..28371)
FT                   /locus_tag="P9303_00241"
FT   CDS_pept        complement(28030..28371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00241"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG718 Uncharacterized protein conserved in bacteria
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76781"
FT                   /db_xref="GOA:A2C5M1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5M1"
FT                   /protein_id="ABM76781.1"
FT                   NLNLPGMSD"
FT   gene            complement(28396..29319)
FT                   /gene="murB"
FT                   /locus_tag="P9303_00251"
FT   CDS_pept        complement(28396..29319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="P9303_00251"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number=""
FT                   /note="COG812 UDP-N-acetylmuramate dehydrogenase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76782"
FT                   /db_xref="GOA:A2C5M2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5M2"
FT                   /protein_id="ABM76782.1"
FT   gene            complement(29295..30761)
FT                   /gene="murC"
FT                   /locus_tag="P9303_00261"
FT   CDS_pept        complement(29295..30761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="P9303_00261"
FT                   /product="Probable UDP-N-acetylmuramate-alanine ligase"
FT                   /EC_number=""
FT                   /note="COG773 UDP-N-acetylmuramate-alanine ligase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76783"
FT                   /db_xref="GOA:A2C5M3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5M3"
FT                   /protein_id="ABM76783.1"
FT   gene            30825..31955
FT                   /gene="gap2"
FT                   /locus_tag="P9303_00271"
FT   CDS_pept        30825..31955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap2"
FT                   /locus_tag="P9303_00271"
FT                   /product="Glyceraldehyde 3-phosphate
FT                   dehydrogenase(NADP+)(phosphorylating)"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG57 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76784"
FT                   /db_xref="GOA:A2C5M4"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5M4"
FT                   /protein_id="ABM76784.1"
FT   gene            complement(32042..33025)
FT                   /gene="thiL"
FT                   /locus_tag="P9303_00281"
FT   CDS_pept        complement(32042..33025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="P9303_00281"
FT                   /product="putative thiamine-monophosphate kinase"
FT                   /EC_number=""
FT                   /note="COG611 Thiamine monophosphate kinase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76785"
FT                   /db_xref="GOA:A2C5M5"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5M5"
FT                   /protein_id="ABM76785.1"
FT   gene            complement(33036..34289)
FT                   /locus_tag="P9303_00291"
FT   CDS_pept        complement(33036..34289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00291"
FT                   /product="Cyclophilin-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /note="COG652 Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) - cyclophilin family [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76786"
FT                   /db_xref="GOA:A2C5M6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5M6"
FT                   /protein_id="ABM76786.1"
FT                   QILSIKVVDGADRLKPHA"
FT   gene            34184..34744
FT                   /gene="efp"
FT                   /locus_tag="P9303_00301"
FT   CDS_pept        34184..34744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="P9303_00301"
FT                   /product="Elongation factor P (EF-P)"
FT                   /note="COG231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76787"
FT                   /db_xref="GOA:A2C5M7"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5M7"
FT                   /protein_id="ABM76787.1"
FT   gene            34744..35238
FT                   /gene="accB"
FT                   /locus_tag="P9303_00311"
FT   CDS_pept        34744..35238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="P9303_00311"
FT                   /product="Biotin / Lipoyl attachment:Acetyl-CoA biotin
FT                   carboxyl carrier subunit"
FT                   /EC_number=""
FT                   /note="COG511 Biotin carboxyl carrier protein [Lipid
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76788"
FT                   /db_xref="GOA:A2C5M8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5M8"
FT                   /protein_id="ABM76788.1"
FT                   G"
FT   gene            complement(35239..36270)
FT                   /gene="pdxA"
FT                   /locus_tag="P9303_00321"
FT   CDS_pept        complement(35239..36270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="P9303_00321"
FT                   /product="putative pyridoxal phosphate biosynthetic protein
FT                   PdxA"
FT                   /EC_number=""
FT                   /note="COG1995 Pyridoxal phosphate biosynthesis protein
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76789"
FT                   /db_xref="GOA:A2C5M9"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5M9"
FT                   /protein_id="ABM76789.1"
FT                   ESR"
FT   gene            36269..36481
FT                   /locus_tag="P9303_00331"
FT   CDS_pept        36269..36481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00331"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76790"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5N0"
FT                   /protein_id="ABM76790.1"
FT   gene            complement(36453..37373)
FT                   /locus_tag="P9303_00341"
FT   CDS_pept        complement(36453..37373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00341"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76791"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5N1"
FT                   /protein_id="ABM76791.1"
FT   gene            37382..37627
FT                   /locus_tag="P9303_00351"
FT   CDS_pept        37382..37627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00351"
FT                   /product="possible Squash family serine protease inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76792"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5N2"
FT                   /protein_id="ABM76792.1"
FT   gene            complement(37635..38036)
FT                   /locus_tag="P9303_00361"
FT   CDS_pept        complement(37635..38036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00361"
FT                   /product="HNH endonuclease:HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76793"
FT                   /db_xref="GOA:A2C5N3"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5N3"
FT                   /protein_id="ABM76793.1"
FT   gene            38191..39819
FT                   /locus_tag="P9303_00371"
FT   CDS_pept        38191..39819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00371"
FT                   /product="Superfamily II DNA/RNA helicases, SNF2 family
FT                   protein"
FT                   /note="COG553 Superfamily II DNA/RNA helicases, SNF2 family
FT                   [Transcription / DNA replication, recombination, and
FT                   repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76794"
FT                   /db_xref="GOA:A2C5N4"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030101"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5N4"
FT                   /protein_id="ABM76794.1"
FT   gene            complement(40147..40593)
FT                   /locus_tag="P9303_00381"
FT   CDS_pept        complement(40147..40593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00381"
FT                   /product="possible Penicillin amidase"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76795"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5N5"
FT                   /protein_id="ABM76795.1"
FT   gene            complement(40656..41171)
FT                   /locus_tag="P9303_00391"
FT   CDS_pept        complement(40656..41171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76796"
FT                   /db_xref="GOA:A2C5N6"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5N6"
FT                   /protein_id="ABM76796.1"
FT                   APLGLIDS"
FT   gene            41281..41589
FT                   /locus_tag="P9303_00401"
FT   CDS_pept        41281..41589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00401"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76797"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5N7"
FT                   /protein_id="ABM76797.1"
FT   gene            41579..41857
FT                   /locus_tag="P9303_00411"
FT   CDS_pept        41579..41857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76798"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5N8"
FT                   /protein_id="ABM76798.1"
FT   gene            42058..42216
FT                   /locus_tag="P9303_00421"
FT   CDS_pept        42058..42216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00421"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76799"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5N9"
FT                   /protein_id="ABM76799.1"
FT                   QLIKPRS"
FT   gene            complement(42320..42391)
FT                   /locus_tag="P9303_tRNAGlyVIMSS1309271"
FT                   /note="tRNA-Gly"
FT   tRNA            complement(42320..42391)
FT                   /locus_tag="P9303_tRNAGlyVIMSS1309271"
FT                   /product="tRNA-Gly"
FT   gene            complement(42440..43588)
FT                   /gene="dhsS"
FT                   /locus_tag="P9303_00431"
FT   CDS_pept        complement(42440..43588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhsS"
FT                   /locus_tag="P9303_00431"
FT                   /product="soluble hydrogenase small subunit"
FT                   /EC_number=""
FT                   /note="COG75 Serine-pyruvate aminotransferase/archaeal
FT                   aspartate aminotransferase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76800"
FT                   /db_xref="GOA:A2C5P0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5P0"
FT                   /protein_id="ABM76800.1"
FT   gene            43673..44833
FT                   /gene="cbiD"
FT                   /locus_tag="P9303_00441"
FT   CDS_pept        43673..44833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiD"
FT                   /locus_tag="P9303_00441"
FT                   /product="CbiD protein"
FT                   /note="COG1903 Cobalamin biosynthesis protein CbiD
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76801"
FT                   /db_xref="GOA:A2C5P1"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5P1"
FT                   /protein_id="ABM76801.1"
FT   gene            44874..46460
FT                   /locus_tag="P9303_00451"
FT   CDS_pept        44874..46460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00451"
FT                   /product="Glutamine amidotransferase class-I:GMP synthase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG519 GMP synthase, PP-ATPase domain/subunit
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76802"
FT                   /db_xref="GOA:A2C5P2"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5P2"
FT                   /protein_id="ABM76802.1"
FT                   TSKPPGTIEWE"
FT   gene            46655..47458
FT                   /locus_tag="P9303_00461"
FT   CDS_pept        46655..47458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00461"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76803"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5P3"
FT                   /protein_id="ABM76803.1"
FT   gene            47796..48407
FT                   /locus_tag="P9303_00471"
FT   CDS_pept        47796..48407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76804"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5P4"
FT                   /protein_id="ABM76804.1"
FT   gene            48423..48824
FT                   /locus_tag="P9303_00481"
FT   CDS_pept        48423..48824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76805"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5P5"
FT                   /protein_id="ABM76805.1"
FT   gene            48830..50632
FT                   /locus_tag="P9303_00491"
FT   CDS_pept        48830..50632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00491"
FT                   /product="Putative penicillin-binding protein"
FT                   /note="COG768 Cell division protein FtsI/penicillin-binding
FT                   protein 2 [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76806"
FT                   /db_xref="GOA:A2C5P6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5P6"
FT                   /protein_id="ABM76806.1"
FT   gene            complement(50668..51813)
FT                   /locus_tag="P9303_00501"
FT   CDS_pept        complement(50668..51813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00501"
FT                   /product="SqdX"
FT                   /note="COG438 Glycosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76807"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5P7"
FT                   /protein_id="ABM76807.1"
FT   gene            complement(51843..53039)
FT                   /gene="sqdB"
FT                   /locus_tag="P9303_00511"
FT   CDS_pept        complement(51843..53039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sqdB"
FT                   /locus_tag="P9303_00511"
FT                   /product="sulfolipid (UDP-sulfoquinovose) biosynthesis
FT                   protein"
FT                   /EC_number=""
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76808"
FT                   /db_xref="GOA:A2C5P8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5P8"
FT                   /protein_id="ABM76808.1"
FT   gene            complement(53098..53265)
FT                   /locus_tag="P9303_00521"
FT   CDS_pept        complement(53098..53265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00521"
FT                   /product="high light inducible protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76809"
FT                   /db_xref="GOA:A2C5P9"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5P9"
FT                   /protein_id="ABM76809.1"
FT                   CLIIVRIAIS"
FT   gene            complement(53333..54253)
FT                   /gene="thiG"
FT                   /locus_tag="P9303_00531"
FT   CDS_pept        complement(53333..54253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="P9303_00531"
FT                   /product="thiamin biosynthesis protein"
FT                   /note="COG2022 Uncharacterized enzyme of thiazole
FT                   biosynthesis [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76810"
FT                   /db_xref="GOA:A2C5Q0"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Q0"
FT                   /protein_id="ABM76810.1"
FT   gene            54207..54791
FT                   /locus_tag="P9303_00541"
FT   CDS_pept        54207..54791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76811"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Q1"
FT                   /protein_id="ABM76811.1"
FT   gene            complement(54759..55322)
FT                   /locus_tag="P9303_00551"
FT   CDS_pept        complement(54759..55322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00551"
FT                   /product="putative photosystem I assembly related protein
FT                   Ycf37"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76812"
FT                   /db_xref="GOA:A2C5Q2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Q2"
FT                   /protein_id="ABM76812.1"
FT   gene            complement(55319..55486)
FT                   /locus_tag="P9303_00561"
FT   CDS_pept        complement(55319..55486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00561"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76813"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Q3"
FT                   /protein_id="ABM76813.1"
FT                   NSALRTAPKP"
FT   gene            55711..55845
FT                   /locus_tag="P9303_00571"
FT   CDS_pept        55711..55845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00571"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76814"
FT                   /db_xref="GOA:A2C5Q4"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Q4"
FT                   /protein_id="ABM76814.1"
FT   gene            55974..56105
FT                   /locus_tag="P9303_00581"
FT   CDS_pept        55974..56105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00581"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76815"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Q5"
FT                   /protein_id="ABM76815.1"
FT   gene            complement(56338..56685)
FT                   /gene="rplT"
FT                   /locus_tag="P9303_00591"
FT   CDS_pept        complement(56338..56685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="P9303_00591"
FT                   /product="50S ribosomal protein L20"
FT                   /note="COG292 Ribosomal protein L20 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76816"
FT                   /db_xref="GOA:A2C5Q6"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5Q6"
FT                   /protein_id="ABM76816.1"
FT                   SFTSVVTSAKS"
FT   gene            complement(56756..56953)
FT                   /gene="rpmI"
FT                   /locus_tag="P9303_00601"
FT   CDS_pept        complement(56756..56953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="P9303_00601"
FT                   /product="50S ribosomal protein L35"
FT                   /note="COG291 Ribosomal protein L35 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76817"
FT                   /db_xref="GOA:A2C5Q7"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5Q7"
FT                   /protein_id="ABM76817.1"
FT   gene            56886..57020
FT                   /locus_tag="P9303_00611"
FT   CDS_pept        56886..57020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00611"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76818"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Q8"
FT                   /protein_id="ABM76818.1"
FT   gene            57045..58628
FT                   /locus_tag="P9303_00621"
FT   CDS_pept        57045..58628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00621"
FT                   /product="possible amidase enhancer"
FT                   /note="COG2385 Sporulation protein and related proteins
FT                   [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76819"
FT                   /db_xref="GOA:A2C5Q9"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Q9"
FT                   /protein_id="ABM76819.1"
FT                   GPLPEMKDAP"
FT   gene            58653..59984
FT                   /locus_tag="P9303_00631"
FT   CDS_pept        58653..59984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00631"
FT                   /product="Glycosyl transferase, family 2"
FT                   /note="COG1215 Glycosyltransferases, probably involved in
FT                   cell wall biogenesis [Cell envelope biogenesis, outer
FT                   membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76820"
FT                   /db_xref="GOA:A2C5R0"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5R0"
FT                   /protein_id="ABM76820.1"
FT   gene            complement(59989..61803)
FT                   /gene="dnaX"
FT                   /locus_tag="P9303_00641"
FT   CDS_pept        complement(59989..61803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="P9303_00641"
FT                   /product="DNA polymerase, gamma and tau subunits"
FT                   /EC_number=""
FT                   /note="COG2812 DNA polymerase III, gamma/tau subunits [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76821"
FT                   /db_xref="GOA:A2C5R1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5R1"
FT                   /protein_id="ABM76821.1"
FT   gene            complement(61827..62507)
FT                   /locus_tag="P9303_00651"
FT   CDS_pept        complement(61827..62507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76822"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5R2"
FT                   /protein_id="ABM76822.1"
FT                   AKPE"
FT   gene            complement(62605..65856)
FT                   /locus_tag="P9303_00661"
FT   CDS_pept        complement(62605..65856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00661"
FT                   /product="Hypothetical protein"
FT                   /note="COG1404 Subtilisin-like serine proteases
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76823"
FT                   /db_xref="GOA:A2C5R3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5R3"
FT                   /protein_id="ABM76823.1"
FT   gene            complement(66173..66328)
FT                   /locus_tag="P9303_00671"
FT   CDS_pept        complement(66173..66328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00671"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76824"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5R4"
FT                   /protein_id="ABM76824.1"
FT                   SSVKRT"
FT   gene            complement(66333..67691)
FT                   /gene="clpX"
FT                   /locus_tag="P9303_00681"
FT   CDS_pept        complement(66333..67691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="P9303_00681"
FT                   /product="Clp protease ATP-binding subunit, ClpX"
FT                   /EC_number=""
FT                   /note="COG1219 ATP-dependent protease Clp, ATPase subunit
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76825"
FT                   /db_xref="GOA:A2C5R5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5R5"
FT                   /protein_id="ABM76825.1"
FT   gene            complement(67780..68454)
FT                   /locus_tag="P9303_00691"
FT   CDS_pept        complement(67780..68454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00691"
FT                   /product="Clp protease proteolytic subunit"
FT                   /EC_number=""
FT                   /note="COG740 Protease subunit of ATP-dependent Clp
FT                   proteases [Posttranslational modification, protein
FT                   turnover, chaperones / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76826"
FT                   /db_xref="GOA:A2C5R6"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5R6"
FT                   /protein_id="ABM76826.1"
FT                   EG"
FT   gene            complement(68501..69940)
FT                   /gene="tig"
FT                   /locus_tag="P9303_00701"
FT   CDS_pept        complement(68501..69940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="P9303_00701"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (PPIase)"
FT                   /EC_number=""
FT                   /note="COG544 FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (trigger factor) [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76827"
FT                   /db_xref="GOA:A2C5R7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5R7"
FT                   /protein_id="ABM76827.1"
FT   gene            70114..71145
FT                   /gene="asd"
FT                   /locus_tag="P9303_00711"
FT   CDS_pept        70114..71145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="P9303_00711"
FT                   /product="aspartate Semialdehyde dehydrogenase"
FT                   /EC_number=""
FT                   /note="COG136 Aspartate-semialdehyde dehydrogenase [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76828"
FT                   /db_xref="GOA:A2C5R8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5R8"
FT                   /protein_id="ABM76828.1"
FT                   SSS"
FT   gene            71142..72050
FT                   /gene="dapA"
FT                   /locus_tag="P9303_00721"
FT   CDS_pept        71142..72050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="P9303_00721"
FT                   /product="Dihydrodipicolinate synthetase"
FT                   /EC_number=""
FT                   /note="COG329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase [Amino acid transport
FT                   and metabolism / Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76829"
FT                   /db_xref="GOA:A2C5R9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5R9"
FT                   /protein_id="ABM76829.1"
FT   gene            complement(72087..72206)
FT                   /locus_tag="P9303_00731"
FT   CDS_pept        complement(72087..72206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00731"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76830"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5S0"
FT                   /protein_id="ABM76830.1"
FT   gene            72151..74154
FT                   /locus_tag="P9303_00741"
FT   CDS_pept        72151..74154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00741"
FT                   /product="Predicted hydrolase of the metallo-beta-lactamase
FT                   superfamily protein"
FT                   /note="COG595 Predicted hydrolase of the
FT                   metallo-beta-lactamase superfamily [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76831"
FT                   /db_xref="GOA:A2C5S1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5S1"
FT                   /protein_id="ABM76831.1"
FT   gene            complement(74140..75249)
FT                   /locus_tag="P9303_00751"
FT   CDS_pept        complement(74140..75249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00751"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76832"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5S2"
FT                   /protein_id="ABM76832.1"
FT   gene            complement(75210..76241)
FT                   /gene="mesJ"
FT                   /locus_tag="P9303_00761"
FT   CDS_pept        complement(75210..76241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="P9303_00761"
FT                   /product="Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /note="COG37 Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control [Cell division and
FT                   chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76833"
FT                   /db_xref="GOA:A2C5S3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5S3"
FT                   /protein_id="ABM76833.1"
FT                   HHD"
FT   gene            76325..77101
FT                   /locus_tag="P9303_00771"
FT   CDS_pept        76325..77101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00771"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76834"
FT                   /db_xref="InterPro:IPR007570"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5S4"
FT                   /protein_id="ABM76834.1"
FT   gene            77146..77565
FT                   /locus_tag="P9303_00781"
FT   CDS_pept        77146..77565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00781"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76835"
FT                   /db_xref="GOA:A2C5S5"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5S5"
FT                   /protein_id="ABM76835.1"
FT   gene            77670..79709
FT                   /gene="uvrB"
FT                   /locus_tag="P9303_00791"
FT   CDS_pept        77670..79709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="P9303_00791"
FT                   /product="Excinuclease ABC subunit B (UvrB)"
FT                   /note="COG556 Helicase subunit of the DNA excision repair
FT                   complex [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76836"
FT                   /db_xref="GOA:A2C5S6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5S6"
FT                   /protein_id="ABM76836.1"
FT   gene            79817..79990
FT                   /locus_tag="P9303_00801"
FT   CDS_pept        79817..79990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00801"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76837"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5S7"
FT                   /protein_id="ABM76837.1"
FT                   RIGVRVLSGAPD"
FT   gene            80044..80259
FT                   /locus_tag="P9303_00811"
FT   CDS_pept        80044..80259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00811"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76838"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5S8"
FT                   /protein_id="ABM76838.1"
FT   gene            complement(80328..82115)
FT                   /gene="lysC"
FT                   /locus_tag="P9303_00821"
FT   CDS_pept        complement(80328..82115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="P9303_00821"
FT                   /product="Aspartate kinase"
FT                   /EC_number=""
FT                   /note="COG527 Aspartokinases [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76839"
FT                   /db_xref="GOA:A2C5S9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5S9"
FT                   /protein_id="ABM76839.1"
FT   gene            complement(82164..83174)
FT                   /gene="holA"
FT                   /locus_tag="P9303_00831"
FT   CDS_pept        complement(82164..83174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="P9303_00831"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number=""
FT                   /note="COG1466 DNA polymerase III, delta subunit [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76840"
FT                   /db_xref="GOA:A2C5T0"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5T0"
FT                   /protein_id="ABM76840.1"
FT   gene            83240..83875
FT                   /gene="cobH"
FT                   /locus_tag="P9303_00841"
FT   CDS_pept        83240..83875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /locus_tag="P9303_00841"
FT                   /product="putative Precorrin-8X methylmutase CobH"
FT                   /EC_number=""
FT                   /note="COG2082 Precorrin isomerase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76841"
FT                   /db_xref="GOA:A2C5T1"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5T1"
FT                   /protein_id="ABM76841.1"
FT   gene            complement(83858..85033)
FT                   /locus_tag="P9303_00851"
FT   CDS_pept        complement(83858..85033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00851"
FT                   /product="possible transporter component"
FT                   /note="COG1566 Multidrug resistance efflux pump [Defense
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76842"
FT                   /db_xref="GOA:A2C5T2"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5T2"
FT                   /protein_id="ABM76842.1"
FT   gene            complement(85035..87962)
FT                   /locus_tag="P9303_00861"
FT   CDS_pept        complement(85035..87962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00861"
FT                   /product="ABC transporter, multi drug efflux family
FT                   protein"
FT                   /note="COG2274 ABC-type bacteriocin/lantibiotic exporters,
FT                   contain an N-terminal double-glycine peptidase domain
FT                   [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76843"
FT                   /db_xref="GOA:A2C5T3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR010132"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5T3"
FT                   /protein_id="ABM76843.1"
FT   gene            complement(87959..88738)
FT                   /locus_tag="P9303_00871"
FT   CDS_pept        complement(87959..88738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00871"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76844"
FT                   /db_xref="GOA:A2C5T4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5T4"
FT                   /protein_id="ABM76844.1"
FT   gene            complement(88774..91557)
FT                   /locus_tag="P9303_00881"
FT   CDS_pept        complement(88774..91557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00881"
FT                   /product="putative DNA mismatch repair protein"
FT                   /note="COG249 Mismatch repair ATPase (MutS family) [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76845"
FT                   /db_xref="GOA:A2C5T5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5T5"
FT                   /protein_id="ABM76845.1"
FT   gene            91714..91914
FT                   /locus_tag="P9303_00891"
FT   CDS_pept        91714..91914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00891"
FT                   /product="possible Photosystem II reaction center Z protein
FT                   (PsbZ)"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76846"
FT                   /db_xref="GOA:A2C5T6"
FT                   /db_xref="InterPro:IPR002644"
FT                   /db_xref="InterPro:IPR036512"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5T6"
FT                   /protein_id="ABM76846.1"
FT   gene            91967..92464
FT                   /gene="ribH"
FT                   /locus_tag="P9303_00901"
FT   CDS_pept        91967..92464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="P9303_00901"
FT                   /product="Putative 6,7-dimethyl-8-ribityllumazine synthase
FT                   or riboflavin synthase beta chain"
FT                   /EC_number=""
FT                   /note="COG54 Riboflavin synthase beta-chain [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76847"
FT                   /db_xref="GOA:A2C5T7"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5T7"
FT                   /protein_id="ABM76847.1"
FT                   AS"
FT   gene            92543..92614
FT                   /locus_tag="P9303_tRNAGlyVIMSS1309288"
FT                   /note="tRNA-Gly"
FT   tRNA            92543..92614
FT                   /locus_tag="P9303_tRNAGlyVIMSS1309288"
FT                   /product="tRNA-Gly"
FT   gene            complement(92617..93099)
FT                   /locus_tag="P9303_00911"
FT   CDS_pept        complement(92617..93099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00911"
FT                   /product="putative acetyltransferase, GNAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76848"
FT                   /db_xref="GOA:A2C5T8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5T8"
FT                   /protein_id="ABM76848.1"
FT   gene            93112..94041
FT                   /locus_tag="P9303_00921"
FT                   /note="disrupted dTDP-glucose pyrophosphorylase; rfbA;
FT                   COG1209 dTDP-glucose pyrophosphorylase [Cell envelope
FT                   biogenesis, outer membrane]"
FT   gene            94031..94636
FT                   /gene="rfbC"
FT                   /locus_tag="P9303_00941"
FT   CDS_pept        94031..94636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="P9303_00941"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number=""
FT                   /note="COG1898 dTDP-4-dehydrorhamnose 3,5-epimerase and
FT                   related enzymes [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76849"
FT                   /db_xref="GOA:A2C5T9"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5T9"
FT                   /protein_id="ABM76849.1"
FT   gene            94830..95951
FT                   /locus_tag="P9303_00951"
FT   CDS_pept        94830..95951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00951"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76850"
FT                   /db_xref="GOA:A2C5U0"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5U0"
FT                   /protein_id="ABM76850.1"
FT   gene            95972..96907
FT                   /gene="rfbD"
FT                   /locus_tag="P9303_00961"
FT   CDS_pept        95972..96907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="P9303_00961"
FT                   /product="putative dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number=""
FT                   /note="COG1091 dTDP-4-dehydrorhamnose reductase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76851"
FT                   /db_xref="GOA:A2C5U1"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5U1"
FT                   /protein_id="ABM76851.1"
FT   gene            97134..97796
FT                   /locus_tag="P9303_00971"
FT   CDS_pept        97134..97796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00971"
FT                   /product="possible phosphatase"
FT                   /note="COG241 Histidinol phosphatase and related
FT                   phosphatases [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76852"
FT                   /db_xref="GOA:A2C5U2"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5U2"
FT                   /protein_id="ABM76852.1"
FT   gene            97950..98708
FT                   /locus_tag="P9303_00981"
FT   CDS_pept        97950..98708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_00981"
FT                   /product="Putative sugar-phosphate nucleotidyl transferase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1208 Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B,
FT                   gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell
FT                   envelope biogenesis, outer membrane / Translation,
FT                   ribosomal structure an"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76853"
FT                   /db_xref="GOA:A2C5U3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5U3"
FT                   /protein_id="ABM76853.1"
FT   gene            98662..99330
FT                   /gene="gmhA"
FT                   /locus_tag="P9303_00991"
FT   CDS_pept        98662..99330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="P9303_00991"
FT                   /product="putative phosphoheptose isomerase"
FT                   /note="COG279 Phosphoheptose isomerase [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_00991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76854"
FT                   /db_xref="GOA:A2C5U4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5U4"
FT                   /protein_id="ABM76854.1"
FT                   "
FT   gene            99327..100838
FT                   /gene="rfaE"
FT                   /locus_tag="P9303_01001"
FT   CDS_pept        99327..100838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE"
FT                   /locus_tag="P9303_01001"
FT                   /product="putative ADP-heptose synthase"
FT                   /note="COG2870 ADP-heptose synthase, bifunctional sugar
FT                   kinase/adenylyltransferase [Cell envelope biogenesis, outer
FT                   membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76855"
FT                   /db_xref="GOA:A2C5U5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5U5"
FT                   /protein_id="ABM76855.1"
FT   gene            100911..101885
FT                   /locus_tag="P9303_01011"
FT   CDS_pept        100911..101885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01011"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76856"
FT                   /db_xref="GOA:A2C5U6"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5U6"
FT                   /protein_id="ABM76856.1"
FT   gene            101915..103036
FT                   /locus_tag="P9303_01021"
FT   CDS_pept        101915..103036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01021"
FT                   /product="Hypothetical protein"
FT                   /note="COG535 Predicted Fe-S oxidoreductases [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76857"
FT                   /db_xref="GOA:A2C5U7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5U7"
FT                   /protein_id="ABM76857.1"
FT   gene            103093..103935
FT                   /locus_tag="P9303_01031"
FT   CDS_pept        103093..103935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01031"
FT                   /product="Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, eukaryotic type, alpha
FT                   subunit"
FT                   /EC_number=""
FT                   /note="COG1071 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dehydrogenase (E1) component, eukaryotic type,
FT                   alpha subunit [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76858"
FT                   /db_xref="GOA:A2C5U8"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5U8"
FT                   /protein_id="ABM76858.1"
FT   gene            103928..105007
FT                   /locus_tag="P9303_01041"
FT   CDS_pept        103928..105007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01041"
FT                   /product="Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, eukaryotic type, beta
FT                   subunit"
FT                   /EC_number=""
FT                   /note="COG22 Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, eukaryotic type, beta subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76859"
FT                   /db_xref="GOA:A2C5U9"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5U9"
FT                   /protein_id="ABM76859.1"
FT   gene            105021..105275
FT                   /locus_tag="P9303_01051"
FT   CDS_pept        105021..105275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01051"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76860"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5V0"
FT                   /protein_id="ABM76860.1"
FT   gene            105272..106435
FT                   /locus_tag="P9303_01061"
FT   CDS_pept        105272..106435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01061"
FT                   /product="Hypothetical protein"
FT                   /note="COG535 Predicted Fe-S oxidoreductases [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76861"
FT                   /db_xref="GOA:A2C5V1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5V1"
FT                   /protein_id="ABM76861.1"
FT   gene            complement(106451..107953)
FT                   /locus_tag="P9303_01071"
FT   CDS_pept        complement(106451..107953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01071"
FT                   /product="Imidazoleglycerol-phosphate synthase"
FT                   /note="COG107 Imidazoleglycerol-phosphate synthase [Amino
FT                   acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76862"
FT                   /db_xref="GOA:A2C5V2"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5V2"
FT                   /protein_id="ABM76862.1"
FT   gene            complement(107923..109293)
FT                   /locus_tag="P9303_01081"
FT   CDS_pept        complement(107923..109293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01081"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76863"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5V3"
FT                   /protein_id="ABM76863.1"
FT   gene            complement(109329..110489)
FT                   /locus_tag="P9303_01091"
FT   CDS_pept        complement(109329..110489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01091"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number=""
FT                   /note="COG381 UDP-N-acetylglucosamine 2-epimerase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76864"
FT                   /db_xref="GOA:A2C5V4"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5V4"
FT                   /protein_id="ABM76864.1"
FT   gene            complement(110482..111489)
FT                   /gene="spsE"
FT                   /locus_tag="P9303_01101"
FT   CDS_pept        complement(110482..111489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spsE"
FT                   /locus_tag="P9303_01101"
FT                   /product="Sialic acid synthase"
FT                   /EC_number=""
FT                   /note="COG2089 Sialic acid synthase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76865"
FT                   /db_xref="GOA:A2C5V5"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5V5"
FT                   /protein_id="ABM76865.1"
FT   gene            complement(111474..112070)
FT                   /locus_tag="P9303_01111"
FT   CDS_pept        complement(111474..112070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01111"
FT                   /product="Hypothetical protein"
FT                   /note="COG663 Carbonic anhydrases/acetyltransferases,
FT                   isoleucine patch superfamily [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76866"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5V6"
FT                   /protein_id="ABM76866.1"
FT   gene            complement(112067..113254)
FT                   /locus_tag="P9303_01121"
FT   CDS_pept        complement(112067..113254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01121"
FT                   /product="Predicted pyridoxal phosphate-dependent enzyme"
FT                   /note="COG399 Predicted pyridoxal phosphate-dependent
FT                   enzyme apparently involved in regulation of cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76867"
FT                   /db_xref="GOA:A2C5V7"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026385"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5V7"
FT                   /protein_id="ABM76867.1"
FT   gene            complement(113251..114258)
FT                   /locus_tag="P9303_01131"
FT   CDS_pept        complement(113251..114258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01131"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76868"
FT                   /db_xref="GOA:A2C5V8"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR026390"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5V8"
FT                   /protein_id="ABM76868.1"
FT   gene            complement(114258..115040)
FT                   /locus_tag="P9303_01141"
FT   CDS_pept        complement(114258..115040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01141"
FT                   /product="Hypothetical protein"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76869"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5V9"
FT                   /protein_id="ABM76869.1"
FT   gene            complement(115033..115749)
FT                   /locus_tag="P9303_01151"
FT   CDS_pept        complement(115033..115749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01151"
FT                   /product="CMP-N-acetylneuraminic acid synthetase"
FT                   /EC_number=""
FT                   /note="COG1083 CMP-N-acetylneuraminic acid synthetase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76870"
FT                   /db_xref="GOA:A2C5W0"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5W0"
FT                   /protein_id="ABM76870.1"
FT                   FIFEEYRPSLKVREDG"
FT   gene            complement(115751..116749)
FT                   /locus_tag="P9303_01161"
FT   CDS_pept        complement(115751..116749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01161"
FT                   /product="Hypothetical protein"
FT                   /note="COG673 Predicted dehydrogenases and related proteins
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76871"
FT                   /db_xref="GOA:A2C5W1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5W1"
FT                   /protein_id="ABM76871.1"
FT   gene            complement(116758..117720)
FT                   /locus_tag="P9303_01171"
FT   CDS_pept        complement(116758..117720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01171"
FT                   /product="Nucleoside-diphosphate-sugar pyrophosphorylase"
FT                   /EC_number=""
FT                   /note="COG1208 Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B,
FT                   gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell
FT                   envelope biogenesis, outer membrane / Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76872"
FT                   /db_xref="GOA:A2C5W2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5W2"
FT                   /protein_id="ABM76872.1"
FT   gene            118285..119379
FT                   /gene="rfbB"
FT                   /locus_tag="P9303_01181"
FT   CDS_pept        118285..119379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="P9303_01181"
FT                   /product="dTDP-D-glucose 4,6-dehydratase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1088 dTDP-D-glucose 4,6-dehydratase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76873"
FT                   /db_xref="GOA:A2C5W3"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5W3"
FT                   /protein_id="ABM76873.1"
FT   gene            complement(119566..121215)
FT                   /locus_tag="P9303_01191"
FT   CDS_pept        complement(119566..121215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01191"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76874"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5W4"
FT                   /protein_id="ABM76874.1"
FT   gene            complement(121484..123079)
FT                   /locus_tag="P9303_01201"
FT   CDS_pept        complement(121484..123079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01201"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76875"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5W5"
FT                   /protein_id="ABM76875.1"
FT                   RGSLELTSRIVLNN"
FT   gene            complement(123297..125327)
FT                   /locus_tag="P9303_01211"
FT   CDS_pept        complement(123297..125327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01211"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76876"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5W6"
FT                   /protein_id="ABM76876.1"
FT   gene            complement(125559..127058)
FT                   /locus_tag="P9303_01221"
FT   CDS_pept        complement(125559..127058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01221"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76877"
FT                   /db_xref="GOA:A2C5W7"
FT                   /db_xref="InterPro:IPR030808"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5W7"
FT                   /protein_id="ABM76877.1"
FT   gene            complement(127022..129043)
FT                   /locus_tag="P9303_01231"
FT   CDS_pept        complement(127022..129043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01231"
FT                   /product="Hypothetical protein"
FT                   /note="COG2604 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76878"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5W8"
FT                   /protein_id="ABM76878.1"
FT   gene            complement(129051..131066)
FT                   /locus_tag="P9303_01241"
FT   CDS_pept        complement(129051..131066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01241"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76879"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5W9"
FT                   /protein_id="ABM76879.1"
FT   gene            complement(131124..132719)
FT                   /locus_tag="P9303_01251"
FT   CDS_pept        complement(131124..132719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01251"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76880"
FT                   /db_xref="GOA:A2C5X0"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5X0"
FT                   /protein_id="ABM76880.1"
FT                   TVGTVDGQLGITFT"
FT   gene            complement(133139..134377)
FT                   /locus_tag="P9303_01261"
FT   CDS_pept        complement(133139..134377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01261"
FT                   /product="Hypothetical protein"
FT                   /note="COG438 Glycosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76881"
FT                   /db_xref="InterPro:IPR022623"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5X1"
FT                   /protein_id="ABM76881.1"
FT                   EWSLLINEVFQDH"
FT   gene            135399..136556
FT                   /locus_tag="P9303_01271"
FT   CDS_pept        135399..136556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01271"
FT                   /product="Glycosyltransferase"
FT                   /note="COG438 Glycosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76882"
FT                   /db_xref="GOA:A2C5X2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022623"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5X2"
FT                   /protein_id="ABM76882.1"
FT   gene            136770..137813
FT                   /locus_tag="P9303_01281"
FT   CDS_pept        136770..137813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01281"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76883"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5X3"
FT                   /protein_id="ABM76883.1"
FT                   FSWREYQ"
FT   gene            complement(138714..141674)
FT                   /locus_tag="P9303_01291"
FT   CDS_pept        complement(138714..141674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01291"
FT                   /product="Hypothetical protein"
FT                   /note="COG2274 ABC-type bacteriocin/lantibiotic exporters,
FT                   contain an N-terminal double-glycine peptidase domain
FT                   [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76884"
FT                   /db_xref="GOA:A2C5X4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5X4"
FT                   /protein_id="ABM76884.1"
FT   gene            complement(141674..142444)
FT                   /locus_tag="P9303_01301"
FT   CDS_pept        complement(141674..142444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01301"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76885"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5X5"
FT                   /protein_id="ABM76885.1"
FT   gene            complement(142441..143484)
FT                   /locus_tag="P9303_01311"
FT   CDS_pept        complement(142441..143484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01311"
FT                   /product="Hypothetical protein"
FT                   /note="COG1566 Multidrug resistance efflux pump [Defense
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76886"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5X6"
FT                   /protein_id="ABM76886.1"
FT                   LKRLRQP"
FT   gene            complement(143384..143557)
FT                   /locus_tag="P9303_01321"
FT   CDS_pept        complement(143384..143557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01321"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76887"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5X7"
FT                   /protein_id="ABM76887.1"
FT                   YCPCHSVHLPIG"
FT   gene            144261..147179
FT                   /locus_tag="P9303_01331"
FT   CDS_pept        144261..147179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01331"
FT                   /product="Hypothetical protein"
FT                   /note="COG438 Glycosyltransferase [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76888"
FT                   /db_xref="GOA:A2C5X8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5X8"
FT                   /protein_id="ABM76888.1"
FT   gene            147176..147994
FT                   /locus_tag="P9303_01341"
FT   CDS_pept        147176..147994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01341"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76889"
FT                   /db_xref="GOA:A2C5X9"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5X9"
FT                   /protein_id="ABM76889.1"
FT   gene            148158..150467
FT                   /locus_tag="P9303_01351"
FT   CDS_pept        148158..150467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01351"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76890"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Y0"
FT                   /protein_id="ABM76890.1"
FT                   PEVELDLLLQWESRCR"
FT   gene            150458..151279
FT                   /locus_tag="P9303_01361"
FT   CDS_pept        150458..151279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01361"
FT                   /product="Hypothetical protein"
FT                   /note="COG1216 Predicted glycosyltransferases [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76891"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Y1"
FT                   /protein_id="ABM76891.1"
FT   gene            151389..152093
FT                   /locus_tag="P9303_01371"
FT   CDS_pept        151389..152093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01371"
FT                   /product="Hypothetical protein"
FT                   /note="COG1134 ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component [Carbohydrate transport
FT                   and metabolism / Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76892"
FT                   /db_xref="GOA:A2C5Y2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Y2"
FT                   /protein_id="ABM76892.1"
FT                   ALTHYSKGVTAS"
FT   gene            152090..152920
FT                   /gene="tagG"
FT                   /locus_tag="P9303_01381"
FT   CDS_pept        152090..152920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagG"
FT                   /locus_tag="P9303_01381"
FT                   /product="Hypothetical protein"
FT                   /note="COG1682 ABC-type polysaccharide/polyol phosphate
FT                   export systems, permease component [Carbohydrate transport
FT                   and metabolism / Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76893"
FT                   /db_xref="GOA:A2C5Y3"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Y3"
FT                   /protein_id="ABM76893.1"
FT   gene            152924..153691
FT                   /locus_tag="P9303_01391"
FT   CDS_pept        152924..153691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01391"
FT                   /product="glucose-1-phosphate cytidylyltransferase"
FT                   /EC_number=""
FT                   /note="COG1208 Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B,
FT                   gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell
FT                   envelope biogenesis, outer membrane / Translation,
FT                   ribosomal structure an"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76894"
FT                   /db_xref="GOA:A2C5Y4"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR013446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Y4"
FT                   /protein_id="ABM76894.1"
FT   gene            153676..154773
FT                   /gene="rfbG"
FT                   /locus_tag="P9303_01401"
FT   CDS_pept        153676..154773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbG"
FT                   /locus_tag="P9303_01401"
FT                   /product="CDP-glucose 4,6-dehydratase"
FT                   /EC_number=""
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76895"
FT                   /db_xref="GOA:A2C5Y5"
FT                   /db_xref="InterPro:IPR013445"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Y5"
FT                   /protein_id="ABM76895.1"
FT   gene            154830..156374
FT                   /locus_tag="P9303_01411"
FT   CDS_pept        154830..156374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01411"
FT                   /product="NDP-hexose 3,4-dehydratase"
FT                   /note="COG399 Predicted pyridoxal phosphate-dependent
FT                   enzyme apparently involved in regulation of cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76896"
FT                   /db_xref="GOA:A2C5Y6"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Y6"
FT                   /protein_id="ABM76896.1"
FT   gene            156371..157066
FT                   /locus_tag="P9303_01421"
FT   CDS_pept        156371..157066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01421"
FT                   /product="Dehydrogenases with different specificities"
FT                   /note="related to short-chain alcohol dehydrogenases;
FT                   COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76897"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Y7"
FT                   /protein_id="ABM76897.1"
FT                   AGFIGMKHS"
FT   gene            157075..158193
FT                   /locus_tag="P9303_01431"
FT   CDS_pept        157075..158193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01431"
FT                   /product="3-dehydroquinate synthetase"
FT                   /EC_number=""
FT                   /note="COG337 3-dehydroquinate synthetase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76898"
FT                   /db_xref="GOA:A2C5Y8"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Y8"
FT                   /protein_id="ABM76898.1"
FT   gene            158274..160001
FT                   /locus_tag="P9303_01441"
FT   CDS_pept        158274..160001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01441"
FT                   /product="Thiamine pyrophosphate-requiring enzyme"
FT                   /EC_number=""
FT                   /note="COG28 Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase] [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76899"
FT                   /db_xref="GOA:A2C5Y9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Y9"
FT                   /protein_id="ABM76899.1"
FT   gene            160059..160859
FT                   /locus_tag="P9303_01451"
FT   CDS_pept        160059..160859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01451"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76900"
FT                   /db_xref="GOA:A2C5Z0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Z0"
FT                   /protein_id="ABM76900.1"
FT   gene            160886..161851
FT                   /locus_tag="P9303_01461"
FT   CDS_pept        160886..161851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01461"
FT                   /product="Hypothetical protein"
FT                   /note="COG451 Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76901"
FT                   /db_xref="GOA:A2C5Z1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Z1"
FT                   /protein_id="ABM76901.1"
FT   gene            161853..165002
FT                   /locus_tag="P9303_01471"
FT   CDS_pept        161853..165002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01471"
FT                   /product="Hypothetical protein"
FT                   /note="COG1216 Predicted glycosyltransferases [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76902"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Z2"
FT                   /protein_id="ABM76902.1"
FT                   A"
FT   gene            164971..166005
FT                   /locus_tag="P9303_01481"
FT   CDS_pept        164971..166005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01481"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76903"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Z3"
FT                   /protein_id="ABM76903.1"
FT                   IERW"
FT   gene            complement(165934..166824)
FT                   /locus_tag="P9303_01491"
FT   CDS_pept        complement(165934..166824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01491"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76904"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Z4"
FT                   /protein_id="ABM76904.1"
FT                   VSEFIPERSRPPSIR"
FT   gene            166953..167126
FT                   /locus_tag="P9303_01501"
FT   CDS_pept        166953..167126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01501"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76905"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Z5"
FT                   /protein_id="ABM76905.1"
FT                   SIIVSFEDLPML"
FT   gene            167715..170570
FT                   /gene="secA"
FT                   /locus_tag="P9303_01511"
FT   CDS_pept        167715..170570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="P9303_01511"
FT                   /product="Preprotein translocase SecA subunit"
FT                   /note="COG653 Preprotein translocase subunit SecA (ATPase,
FT                   RNA helicase) [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76906"
FT                   /db_xref="GOA:A2C5Z6"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C5Z6"
FT                   /protein_id="ABM76906.1"
FT   gene            complement(170600..171343)
FT                   /gene="cysE"
FT                   /locus_tag="P9303_01521"
FT   CDS_pept        complement(170600..171343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="P9303_01521"
FT                   /product="Serine acetyltransferase"
FT                   /EC_number=""
FT                   /note="COG1045 Serine acetyltransferase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76907"
FT                   /db_xref="GOA:A2C5Z7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Z7"
FT                   /protein_id="ABM76907.1"
FT   gene            complement(171366..172355)
FT                   /locus_tag="P9303_01531"
FT   CDS_pept        complement(171366..172355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01531"
FT                   /product="possible transcriptional regulator"
FT                   /note="COG1725 Predicted transcriptional regulators
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76908"
FT                   /db_xref="GOA:A2C5Z8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Z8"
FT                   /protein_id="ABM76908.1"
FT   gene            172370..172567
FT                   /locus_tag="P9303_01541"
FT   CDS_pept        172370..172567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01541"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76909"
FT                   /db_xref="UniProtKB/TrEMBL:A2C5Z9"
FT                   /protein_id="ABM76909.1"
FT   gene            complement(172786..173445)
FT                   /gene="infC"
FT                   /locus_tag="P9303_01551"
FT   CDS_pept        complement(172786..173445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="P9303_01551"
FT                   /product="Translation Initiation factor 3"
FT                   /note="COG290 Translation initiation factor 3 (IF-3)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76910"
FT                   /db_xref="GOA:A2C600"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C600"
FT                   /protein_id="ABM76910.1"
FT   gene            complement(173508..174407)
FT                   /gene="miaA"
FT                   /locus_tag="P9303_01561"
FT   CDS_pept        complement(173508..174407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="P9303_01561"
FT                   /product="tRNA delta-2-isopentenylpyrophosphate (IPP)
FT                   transferase"
FT                   /EC_number=""
FT                   /note="COG324 tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase [Translation, ribosomal structure and
FT                   biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76911"
FT                   /db_xref="GOA:A2C601"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C601"
FT                   /protein_id="ABM76911.1"
FT                   KGEEPLSEALSLIQAGLR"
FT   gene            174585..176552
FT                   /gene="gyrB"
FT                   /locus_tag="P9303_01571"
FT   CDS_pept        174585..176552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="P9303_01571"
FT                   /product="DNA gyrase, subunit B"
FT                   /EC_number=""
FT                   /note="COG187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76912"
FT                   /db_xref="GOA:A2C602"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2C602"
FT                   /protein_id="ABM76912.1"
FT   gene            176552..176878
FT                   /locus_tag="P9303_01581"
FT   CDS_pept        176552..176878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76913"
FT                   /db_xref="UniProtKB/TrEMBL:A2C603"
FT                   /protein_id="ABM76913.1"
FT                   WLNV"
FT   gene            176859..177266
FT                   /locus_tag="P9303_01591"
FT   CDS_pept        176859..177266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01591"
FT                   /product="Integral membrane protein possibly involved in
FT                   chromosome condensation"
FT                   /note="COG239 Integral membrane protein possibly involved
FT                   in chromosome condensation [Cell division and chromosome
FT                   partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76914"
FT                   /db_xref="GOA:A2C604"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A2C604"
FT                   /protein_id="ABM76914.1"
FT   gene            177259..177612
FT                   /locus_tag="P9303_01601"
FT   CDS_pept        177259..177612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01601"
FT                   /product="Integral membrane protein possibly involved in
FT                   chromosome condensation"
FT                   /note="COG239 Integral membrane protein possibly involved
FT                   in chromosome condensation [Cell division and chromosome
FT                   partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76915"
FT                   /db_xref="GOA:A2C605"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A2C605"
FT                   /protein_id="ABM76915.1"
FT                   AALGFLIGRQISP"
FT   gene            178035..179453
FT                   /locus_tag="P9303_01611"
FT   CDS_pept        178035..179453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01611"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76916"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A2C606"
FT                   /protein_id="ABM76916.1"
FT                   LVKLGLAESHAVGG"
FT   gene            complement(179466..179945)
FT                   /gene="btuE"
FT                   /locus_tag="P9303_01621"
FT   CDS_pept        complement(179466..179945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuE"
FT                   /locus_tag="P9303_01621"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number=""
FT                   /note="COG386 Glutathione peroxidase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76917"
FT                   /db_xref="GOA:A2C607"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2C607"
FT                   /protein_id="ABM76917.1"
FT   gene            180021..181442
FT                   /gene="mgtE"
FT                   /locus_tag="P9303_01631"
FT   CDS_pept        180021..181442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="P9303_01631"
FT                   /product="MgtE family, putative magnesium transport
FT                   protein"
FT                   /note="COG2239 Mg/Co/Ni transporter MgtE (contains CBS
FT                   domain) [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76918"
FT                   /db_xref="GOA:A2C608"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A2C608"
FT                   /protein_id="ABM76918.1"
FT                   RTAAWLLEQTNGIAF"
FT   gene            181490..182542
FT                   /locus_tag="P9303_01641"
FT   CDS_pept        181490..182542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01641"
FT                   /product="Type II alternative RNA polymerase sigma factor,
FT                   sigma-70 family protein"
FT                   /note="COG568 DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32) [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76919"
FT                   /db_xref="GOA:A2C609"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A2C609"
FT                   /protein_id="ABM76919.1"
FT                   SETVEAYAAC"
FT   gene            complement(182527..183393)
FT                   /locus_tag="P9303_01651"
FT   CDS_pept        complement(182527..183393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01651"
FT                   /product="possible alpha/beta hydrolase superfamily
FT                   protein"
FT                   /note="COG596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76920"
FT                   /db_xref="GOA:A2C610"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2C610"
FT                   /protein_id="ABM76920.1"
FT                   RIIQQAA"
FT   gene            complement(183435..186695)
FT                   /locus_tag="P9303_01661"
FT   CDS_pept        complement(183435..186695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01661"
FT                   /product="putative RND family multidrug efflux transporter"
FT                   /note="COG841 Cation/multidrug efflux pump [Defense
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76921"
FT                   /db_xref="GOA:A2C611"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A2C611"
FT                   /protein_id="ABM76921.1"
FT   gene            complement(186703..187803)
FT                   /locus_tag="P9303_01671"
FT   CDS_pept        complement(186703..187803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01671"
FT                   /product="Membrane-fusion protein"
FT                   /note="COG845 Membrane-fusion protein [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76922"
FT                   /db_xref="GOA:A2C612"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A2C612"
FT                   /protein_id="ABM76922.1"
FT   gene            187989..188621
FT                   /locus_tag="P9303_01681"
FT   CDS_pept        187989..188621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01681"
FT                   /product="Succinate dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76923"
FT                   /db_xref="GOA:A2C613"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A2C613"
FT                   /protein_id="ABM76923.1"
FT   gene            188621..190537
FT                   /gene="sdhA"
FT                   /locus_tag="P9303_01691"
FT   CDS_pept        188621..190537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="P9303_01691"
FT                   /product="Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /EC_number=""
FT                   /note="COG1053 Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76924"
FT                   /db_xref="GOA:A2C614"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A2C614"
FT                   /protein_id="ABM76924.1"
FT                   SYR"
FT   gene            190534..191271
FT                   /gene="sdhB"
FT                   /locus_tag="P9303_01701"
FT   CDS_pept        190534..191271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="P9303_01701"
FT                   /product="succinate dehydrogenase/fumarate reductase,
FT                   iron-sulfur binding"
FT                   /EC_number=""
FT                   /note="COG479 Succinate dehydrogenase/fumarate reductase,
FT                   Fe-S protein subunit [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76925"
FT                   /db_xref="GOA:A2C615"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A2C615"
FT                   /protein_id="ABM76925.1"
FT   gene            complement(191302..192255)
FT                   /locus_tag="P9303_01711"
FT   CDS_pept        complement(191302..192255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01711"
FT                   /product="Iron/Ascorbate oxidoreductase"
FT                   /note="COG3491 Isopenicillin N synthase and related
FT                   dioxygenases [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76926"
FT                   /db_xref="GOA:A2C616"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:A2C616"
FT                   /protein_id="ABM76926.1"
FT   gene            192340..193542
FT                   /gene="mutY"
FT                   /locus_tag="P9303_01721"
FT   CDS_pept        192340..193542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="P9303_01721"
FT                   /product="probable adenine glycosylase"
FT                   /note="COG1194 A/G-specific DNA glycosylase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76927"
FT                   /db_xref="GOA:A2C617"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A2C617"
FT                   /protein_id="ABM76927.1"
FT                   S"
FT   gene            193567..194607
FT                   /locus_tag="P9303_01731"
FT   CDS_pept        193567..194607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01731"
FT                   /product="Putative carbohydrate kinase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG524 Sugar kinases, ribokinase family
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76928"
FT                   /db_xref="GOA:A2C618"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A2C618"
FT                   /protein_id="ABM76928.1"
FT                   VAGDVN"
FT   gene            complement(194556..195074)
FT                   /locus_tag="P9303_01741"
FT   CDS_pept        complement(194556..195074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01741"
FT                   /product="Predicted ATPase or kinase"
FT                   /note="COG802 Predicted ATPase or kinase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76929"
FT                   /db_xref="GOA:A2C619"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C619"
FT                   /protein_id="ABM76929.1"
FT                   DPKNSSTCI"
FT   gene            195100..196530
FT                   /gene="sam1"
FT                   /locus_tag="P9303_01751"
FT   CDS_pept        195100..196530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sam1"
FT                   /locus_tag="P9303_01751"
FT                   /product="putative adenosylhomocysteinase"
FT                   /EC_number=""
FT                   /note="COG499 S-adenosylhomocysteine hydrolase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76930"
FT                   /db_xref="GOA:A2C620"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C620"
FT                   /protein_id="ABM76930.1"
FT                   DYISVPIEGPYKPDHYRY"
FT   gene            complement(196706..196996)
FT                   /locus_tag="P9303_01761"
FT   CDS_pept        complement(196706..196996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01761"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76931"
FT                   /db_xref="UniProtKB/TrEMBL:A2C621"
FT                   /protein_id="ABM76931.1"
FT   gene            197027..197698
FT                   /gene="dedA"
FT                   /locus_tag="P9303_01771"
FT   CDS_pept        197027..197698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="P9303_01771"
FT                   /product="DedA family; putative alkaline phosphatase-like
FT                   protein"
FT                   /EC_number=""
FT                   /note="COG586 Uncharacterized membrane-associated protein
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76932"
FT                   /db_xref="GOA:A2C622"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A2C622"
FT                   /protein_id="ABM76932.1"
FT                   H"
FT   gene            complement(197709..198095)
FT                   /locus_tag="P9303_01781"
FT   CDS_pept        complement(197709..198095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01781"
FT                   /product="single-stranded DNA-binding protein"
FT                   /note="COG629 Single-stranded DNA-binding protein [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76933"
FT                   /db_xref="GOA:A2C623"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A2C623"
FT                   /protein_id="ABM76933.1"
FT   gene            198239..199291
FT                   /gene="mreB"
FT                   /locus_tag="P9303_01791"
FT   CDS_pept        198239..199291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="P9303_01791"
FT                   /product="Rod shape determining protein"
FT                   /note="COG1077 Actin-like ATPase involved in cell
FT                   morphogenesis [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76934"
FT                   /db_xref="GOA:A2C624"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A2C624"
FT                   /protein_id="ABM76934.1"
FT                   PEFTRSSMTA"
FT   gene            199296..200039
FT                   /gene="mreC"
FT                   /locus_tag="P9303_01801"
FT   CDS_pept        199296..200039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="P9303_01801"
FT                   /product="putative rod shape-determining protein"
FT                   /note="COG1792 Cell shape-determining protein [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76935"
FT                   /db_xref="GOA:A2C625"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A2C625"
FT                   /protein_id="ABM76935.1"
FT   gene            200039..200548
FT                   /locus_tag="P9303_01811"
FT   CDS_pept        200039..200548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01811"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76936"
FT                   /db_xref="GOA:A2C626"
FT                   /db_xref="UniProtKB/TrEMBL:A2C626"
FT                   /protein_id="ABM76936.1"
FT                   RRLARA"
FT   gene            200562..201866
FT                   /locus_tag="P9303_01821"
FT   CDS_pept        200562..201866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01821"
FT                   /product="Bacterial extracellular solute-binding protein,
FT                   family 1"
FT                   /note="COG1653 ABC-type sugar transport system, periplasmic
FT                   component [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76937"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A2C627"
FT                   /protein_id="ABM76937.1"
FT   gene            202013..202885
FT                   /locus_tag="P9303_01831"
FT   CDS_pept        202013..202885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01831"
FT                   /product="two-component response regulator"
FT                   /EC_number=""
FT                   /note="COG745 Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76938"
FT                   /db_xref="GOA:A2C628"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2C628"
FT                   /protein_id="ABM76938.1"
FT                   ASASVAVAS"
FT   gene            202932..204458
FT                   /gene="lysS"
FT                   /locus_tag="P9303_01841"
FT   CDS_pept        202932..204458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="P9303_01841"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG1190 Lysyl-tRNA synthetase (class II)
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76939"
FT                   /db_xref="GOA:A2C629"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C629"
FT                   /protein_id="ABM76939.1"
FT   gene            204518..204781
FT                   /locus_tag="P9303_01851"
FT   CDS_pept        204518..204781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01851"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76940"
FT                   /db_xref="UniProtKB/TrEMBL:A2C630"
FT                   /protein_id="ABM76940.1"
FT   gene            complement(204783..205265)
FT                   /locus_tag="P9303_01861"
FT   CDS_pept        complement(204783..205265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01861"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76941"
FT                   /db_xref="InterPro:IPR030812"
FT                   /db_xref="UniProtKB/TrEMBL:A2C631"
FT                   /protein_id="ABM76941.1"
FT   gene            complement(205262..205492)
FT                   /locus_tag="P9303_01871"
FT   CDS_pept        complement(205262..205492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01871"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76942"
FT                   /db_xref="InterPro:IPR030810"
FT                   /db_xref="UniProtKB/TrEMBL:A2C632"
FT                   /protein_id="ABM76942.1"
FT   gene            complement(205518..206471)
FT                   /locus_tag="P9303_01881"
FT   CDS_pept        complement(205518..206471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01881"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG4301 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76943"
FT                   /db_xref="GOA:A2C633"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:A2C633"
FT                   /protein_id="ABM76943.1"
FT   gene            complement(206468..207649)
FT                   /locus_tag="P9303_01891"
FT   CDS_pept        complement(206468..207649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01891"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG1262 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76944"
FT                   /db_xref="GOA:A2C634"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A2C634"
FT                   /protein_id="ABM76944.1"
FT   gene            208728..209078
FT                   /locus_tag="P9303_01901"
FT   CDS_pept        208728..209078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01901"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76945"
FT                   /db_xref="GOA:A2C635"
FT                   /db_xref="UniProtKB/TrEMBL:A2C635"
FT                   /protein_id="ABM76945.1"
FT                   YVDLILSDKDYF"
FT   gene            209171..211093
FT                   /locus_tag="P9303_01911"
FT   CDS_pept        209171..211093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01911"
FT                   /product="Eukaryotic protein kinase:Serine/Threonine
FT                   protein kinase"
FT                   /note="COG515 Serine/threonine protein kinase [General
FT                   function prediction only / Signal transduction mechanisms /
FT                   Transcription / DNA replication, recombination, and
FT                   repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76946"
FT                   /db_xref="GOA:A2C636"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A2C636"
FT                   /protein_id="ABM76946.1"
FT                   NPLAD"
FT   gene            complement(211205..211702)
FT                   /gene="smpB"
FT                   /locus_tag="P9303_01921"
FT   CDS_pept        complement(211205..211702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="P9303_01921"
FT                   /product="tmRNA binding protein SmpB"
FT                   /note="COG691 tmRNA-binding protein [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76947"
FT                   /db_xref="GOA:A2C637"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C637"
FT                   /protein_id="ABM76947.1"
FT                   RY"
FT   gene            211616..212812
FT                   /gene="ruvB"
FT                   /locus_tag="P9303_01931"
FT   CDS_pept        211616..212812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="P9303_01931"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="COG2255 Holliday junction resolvasome, helicase
FT                   subunit [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76948"
FT                   /db_xref="GOA:A2C638"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C638"
FT                   /protein_id="ABM76948.1"
FT   gene            212809..213621
FT                   /locus_tag="P9303_01941"
FT   CDS_pept        212809..213621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01941"
FT                   /product="Tfp pilus assembly protein PilF"
FT                   /note="COG3063 Tfp pilus assembly protein PilF [Cell
FT                   motility and secretion / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76949"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2C639"
FT                   /protein_id="ABM76949.1"
FT   gene            213618..214814
FT                   /locus_tag="P9303_01951"
FT   CDS_pept        213618..214814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01951"
FT                   /product="Zinc metallopeptidase M20/M25/M40 family protein"
FT                   /note="COG1473 Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76950"
FT                   /db_xref="GOA:A2C640"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A2C640"
FT                   /protein_id="ABM76950.1"
FT   gene            214811..215035
FT                   /locus_tag="P9303_01961"
FT   CDS_pept        214811..215035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01961"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76951"
FT                   /db_xref="GOA:A2C641"
FT                   /db_xref="InterPro:IPR021524"
FT                   /db_xref="UniProtKB/TrEMBL:A2C641"
FT                   /protein_id="ABM76951.1"
FT   gene            215312..216691
FT                   /gene="thiC"
FT                   /locus_tag="P9303_01971"
FT   CDS_pept        215312..216691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="P9303_01971"
FT                   /product="ThiC family protein"
FT                   /note="COG422 Thiamine biosynthesis protein ThiC [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76952"
FT                   /db_xref="GOA:A2C642"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C642"
FT                   /protein_id="ABM76952.1"
FT                   A"
FT   gene            218909..219091
FT                   /locus_tag="P9303_01981"
FT   CDS_pept        218909..219091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01981"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76953"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="InterPro:IPR022516"
FT                   /db_xref="UniProtKB/TrEMBL:A2C643"
FT                   /protein_id="ABM76953.1"
FT                   LRIAYTEWVRDSLAK"
FT   gene            219488..219700
FT                   /locus_tag="P9303_01991"
FT   CDS_pept        219488..219700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_01991"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_01991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76954"
FT                   /db_xref="UniProtKB/TrEMBL:A2C644"
FT                   /protein_id="ABM76954.1"
FT   gene            complement(219965..220291)
FT                   /locus_tag="P9303_02001"
FT   CDS_pept        complement(219965..220291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02001"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4446 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76955"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:A2C645"
FT                   /protein_id="ABM76955.1"
FT                   YSQL"
FT   gene            complement(221719..221928)
FT                   /locus_tag="P9303_02011"
FT   CDS_pept        complement(221719..221928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02011"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76956"
FT                   /db_xref="UniProtKB/TrEMBL:A2C646"
FT                   /protein_id="ABM76956.1"
FT   gene            complement(221936..222553)
FT                   /locus_tag="P9303_02021"
FT   CDS_pept        complement(221936..222553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02021"
FT                   /product="possible Bacterial regulatory proteins, crp
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76957"
FT                   /db_xref="UniProtKB/TrEMBL:A2C647"
FT                   /protein_id="ABM76957.1"
FT   gene            223054..223236
FT                   /locus_tag="P9303_02031"
FT   CDS_pept        223054..223236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02031"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76958"
FT                   /db_xref="GOA:A2C648"
FT                   /db_xref="UniProtKB/TrEMBL:A2C648"
FT                   /protein_id="ABM76958.1"
FT                   SRYLYSQACLVGGRL"
FT   gene            complement(223190..223372)
FT                   /locus_tag="P9303_02041"
FT   CDS_pept        complement(223190..223372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02041"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76959"
FT                   /db_xref="UniProtKB/TrEMBL:A2C649"
FT                   /protein_id="ABM76959.1"
FT                   PTADLQQGKPVSINT"
FT   gene            complement(224035..224613)
FT                   /gene="aroK"
FT                   /locus_tag="P9303_02051"
FT   CDS_pept        complement(224035..224613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="P9303_02051"
FT                   /product="Shikimate kinase"
FT                   /EC_number=""
FT                   /note="COG703 Shikimate kinase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76960"
FT                   /db_xref="GOA:A2C650"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C650"
FT                   /protein_id="ABM76960.1"
FT   gene            224666..225586
FT                   /locus_tag="P9303_02061"
FT   CDS_pept        224666..225586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02061"
FT                   /product="6-pyruvoyl tetrahydropterin synthase"
FT                   /EC_number=""
FT                   /note="COG720 6-pyruvoyl-tetrahydropterin synthase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76961"
FT                   /db_xref="GOA:A2C651"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A2C651"
FT                   /protein_id="ABM76961.1"
FT   gene            225595..226311
FT                   /locus_tag="P9303_02071"
FT   CDS_pept        225595..226311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02071"
FT                   /product="RibD/ribG C-terminal domain"
FT                   /EC_number=""
FT                   /note="COG1985 Pyrimidine reductase, riboflavin
FT                   biosynthesis [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76962"
FT                   /db_xref="GOA:A2C652"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A2C652"
FT                   /protein_id="ABM76962.1"
FT                   RYERKRVEGSRADRLI"
FT   gene            226371..226679
FT                   /locus_tag="P9303_02081"
FT   CDS_pept        226371..226679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02081"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76963"
FT                   /db_xref="GOA:A2C653"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A2C653"
FT                   /protein_id="ABM76963.1"
FT   gene            226782..227012
FT                   /locus_tag="P9303_02091"
FT   CDS_pept        226782..227012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02091"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76964"
FT                   /db_xref="GOA:A2C654"
FT                   /db_xref="UniProtKB/TrEMBL:A2C654"
FT                   /protein_id="ABM76964.1"
FT   gene            227187..228323
FT                   /locus_tag="P9303_02101"
FT   CDS_pept        227187..228323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02101"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3146 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76965"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2C655"
FT                   /protein_id="ABM76965.1"
FT   gene            228438..228782
FT                   /locus_tag="P9303_02111"
FT   CDS_pept        228438..228782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02111"
FT                   /product="possible Penicillin amidase"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76966"
FT                   /db_xref="UniProtKB/TrEMBL:A2C656"
FT                   /protein_id="ABM76966.1"
FT                   PQCKFGLPSL"
FT   gene            229155..229526
FT                   /locus_tag="P9303_02121"
FT   CDS_pept        229155..229526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76967"
FT                   /db_xref="InterPro:IPR017260"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:A2C657"
FT                   /protein_id="ABM76967.1"
FT   gene            complement(229542..231116)
FT                   /locus_tag="P9303_02131"
FT   CDS_pept        complement(229542..231116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02131"
FT                   /product="Fe-S oxidoreductase"
FT                   /note="COG1032 Fe-S oxidoreductase [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76968"
FT                   /db_xref="GOA:A2C658"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR025274"
FT                   /db_xref="InterPro:IPR034530"
FT                   /db_xref="UniProtKB/TrEMBL:A2C658"
FT                   /protein_id="ABM76968.1"
FT                   KKTLQPV"
FT   gene            231259..231360
FT                   /locus_tag="P9303_02141"
FT   CDS_pept        231259..231360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02141"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76969"
FT                   /db_xref="GOA:A2C659"
FT                   /db_xref="UniProtKB/TrEMBL:A2C659"
FT                   /protein_id="ABM76969.1"
FT   gene            complement(231347..232582)
FT                   /locus_tag="P9303_02151"
FT   CDS_pept        complement(231347..232582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02151"
FT                   /product="multidrug efflux MFS family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76970"
FT                   /db_xref="GOA:A2C660"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2C660"
FT                   /protein_id="ABM76970.1"
FT                   KGRTVLEEVRSA"
FT   gene            complement(232579..233997)
FT                   /locus_tag="P9303_02161"
FT   CDS_pept        complement(232579..233997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02161"
FT                   /product="possible Fe-S oxidoreductase"
FT                   /note="COG621 2-methylthioadenine synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76971"
FT                   /db_xref="GOA:A2C661"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C661"
FT                   /protein_id="ABM76971.1"
FT                   VDTNAMAVTAQTSQ"
FT   gene            234106..235047
FT                   /locus_tag="P9303_02171"
FT   CDS_pept        234106..235047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02171"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4243 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76972"
FT                   /db_xref="GOA:A2C662"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:A2C662"
FT                   /protein_id="ABM76972.1"
FT   gene            complement(235057..236727)
FT                   /gene="nadB"
FT                   /locus_tag="P9303_02181"
FT   CDS_pept        complement(235057..236727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="P9303_02181"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number=""
FT                   /note="COG29 Aspartate oxidase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76973"
FT                   /db_xref="GOA:A2C663"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A2C663"
FT                   /protein_id="ABM76973.1"
FT   gene            complement(236799..237161)
FT                   /gene="psbU"
FT                   /locus_tag="P9303_02191"
FT   CDS_pept        complement(236799..237161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbU"
FT                   /locus_tag="P9303_02191"
FT                   /product="putative Photosystem II PsbU protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76974"
FT                   /db_xref="GOA:A2C664"
FT                   /db_xref="InterPro:IPR010527"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C664"
FT                   /protein_id="ABM76974.1"
FT                   IAVNEGFDRINDGQYR"
FT   gene            complement(237273..238064)
FT                   /locus_tag="P9303_02201"
FT   CDS_pept        complement(237273..238064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76975"
FT                   /db_xref="GOA:A2C665"
FT                   /db_xref="InterPro:IPR021468"
FT                   /db_xref="UniProtKB/TrEMBL:A2C665"
FT                   /protein_id="ABM76975.1"
FT   gene            238161..239042
FT                   /gene="bacA"
FT                   /locus_tag="P9303_02211"
FT   CDS_pept        238161..239042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="P9303_02211"
FT                   /product="Bacitracin resistance protein BacA"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1968 Uncharacterized bacitracin resistance
FT                   protein [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76976"
FT                   /db_xref="GOA:A2C666"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C666"
FT                   /protein_id="ABM76976.1"
FT                   LVLAWWLSDTSN"
FT   gene            239064..240461
FT                   /locus_tag="P9303_02221"
FT   CDS_pept        239064..240461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02221"
FT                   /product="possible Fe-S oxidoreductase"
FT                   /note="COG1625 Fe-S oxidoreductase, related to NifB/MoaA
FT                   family [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76977"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR017673"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A2C667"
FT                   /protein_id="ABM76977.1"
FT                   GDGQEIH"
FT   gene            240486..242219
FT                   /locus_tag="P9303_02231"
FT   CDS_pept        240486..242219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02231"
FT                   /product="possible RND family outer membrane efflux
FT                   protein"
FT                   /note="COG1538 Outer membrane protein [Cell envelope
FT                   biogenesis, outer membrane / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76978"
FT                   /db_xref="GOA:A2C668"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A2C668"
FT                   /protein_id="ABM76978.1"
FT                   E"
FT   gene            242219..243031
FT                   /locus_tag="P9303_02241"
FT   CDS_pept        242219..243031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02241"
FT                   /product="inositol monophosphate family protein"
FT                   /note="COG483 Archaeal fructose-1,6-bisphosphatase and
FT                   related enzymes of inositol monophosphatase family
FT                   [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76979"
FT                   /db_xref="GOA:A2C669"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:A2C669"
FT                   /protein_id="ABM76979.1"
FT   gene            243004..243135
FT                   /locus_tag="P9303_02251"
FT   CDS_pept        243004..243135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02251"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76980"
FT                   /db_xref="UniProtKB/TrEMBL:A2C670"
FT                   /protein_id="ABM76980.1"
FT   gene            complement(243308..243433)
FT                   /locus_tag="P9303_02261"
FT   CDS_pept        complement(243308..243433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02261"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76981"
FT                   /db_xref="UniProtKB/TrEMBL:A2C671"
FT                   /protein_id="ABM76981.1"
FT   gene            243682..245082
FT                   /locus_tag="P9303_rrsVIMSS1309419"
FT   rRNA            243682..245082
FT                   /locus_tag="P9303_rrsVIMSS1309419"
FT                   /product="16S ribosomal RNA"
FT   gene            245324..245397
FT                   /locus_tag="P9303_tRNAIleVIMSS1309289"
FT                   /note="tRNA-Ile"
FT   tRNA            245324..245397
FT                   /locus_tag="P9303_tRNAIleVIMSS1309289"
FT                   /product="tRNA-Ile"
FT   gene            245407..245479
FT                   /locus_tag="P9303_tRNAAlaVIMSS1309290"
FT                   /note="tRNA-Ala"
FT   tRNA            245407..245479
FT                   /locus_tag="P9303_tRNAAlaVIMSS1309290"
FT                   /product="tRNA-Ala"
FT   gene            complement(245531..245734)
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362595"
FT                   /note="Pseudogene derived from P9313_20831"
FT   gene            complement(245742..245855)
FT                   /locus_tag="P9303_02271"
FT   CDS_pept        complement(245742..245855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02271"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76982"
FT                   /db_xref="UniProtKB/TrEMBL:A2C672"
FT                   /protein_id="ABM76982.1"
FT   gene            245970..248842
FT                   /locus_tag="P9303_rrlVIMSS1365778"
FT   rRNA            245970..248842
FT                   /locus_tag="P9303_rrlVIMSS1365778"
FT                   /product="23S ribosomal RNA"
FT   gene            248952..249067
FT                   /gene="rrf"
FT                   /locus_tag="P9303_rrfVIMSS1309421"
FT   rRNA            248952..249067
FT                   /gene="rrf"
FT                   /locus_tag="P9303_rrfVIMSS1309421"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(249013..249162)
FT                   /locus_tag="P9303_02281"
FT   CDS_pept        complement(249013..249162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02281"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76983"
FT                   /db_xref="UniProtKB/TrEMBL:A2C673"
FT                   /protein_id="ABM76983.1"
FT                   YRRR"
FT   gene            249247..250191
FT                   /gene="rbn"
FT                   /locus_tag="P9303_02291"
FT   CDS_pept        249247..250191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="P9303_02291"
FT                   /product="serum resistance locus BrkB-like protein"
FT                   /note="COG1295 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76984"
FT                   /db_xref="GOA:A2C674"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A2C674"
FT                   /protein_id="ABM76984.1"
FT   gene            250231..250488
FT                   /locus_tag="P9303_02301"
FT   CDS_pept        250231..250488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02301"
FT                   /product="possible Glypican"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76985"
FT                   /db_xref="GOA:A2C675"
FT                   /db_xref="UniProtKB/TrEMBL:A2C675"
FT                   /protein_id="ABM76985.1"
FT   gene            250490..250846
FT                   /locus_tag="P9303_02311"
FT   CDS_pept        250490..250846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02311"
FT                   /product="possible Zinc finger, C3HC4 type (RING finger)"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76986"
FT                   /db_xref="GOA:A2C676"
FT                   /db_xref="UniProtKB/TrEMBL:A2C676"
FT                   /protein_id="ABM76986.1"
FT                   ATIDITAEDAGSEG"
FT   gene            complement(250952..251275)
FT                   /locus_tag="P9303_02321"
FT   CDS_pept        complement(250952..251275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76987"
FT                   /db_xref="GOA:A2C677"
FT                   /db_xref="InterPro:IPR021362"
FT                   /db_xref="UniProtKB/TrEMBL:A2C677"
FT                   /protein_id="ABM76987.1"
FT                   AEN"
FT   gene            complement(251339..251494)
FT                   /locus_tag="P9303_02331"
FT   CDS_pept        complement(251339..251494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02331"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76988"
FT                   /db_xref="UniProtKB/TrEMBL:A2C678"
FT                   /protein_id="ABM76988.1"
FT                   FTWLLH"
FT   gene            251741..251881
FT                   /locus_tag="P9303_02341"
FT   CDS_pept        251741..251881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02341"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76989"
FT                   /db_xref="UniProtKB/TrEMBL:A2C679"
FT                   /protein_id="ABM76989.1"
FT                   L"
FT   gene            complement(251878..252114)
FT                   /locus_tag="P9303_02351"
FT   CDS_pept        complement(251878..252114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02351"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76990"
FT                   /db_xref="GOA:A2C680"
FT                   /db_xref="UniProtKB/TrEMBL:A2C680"
FT                   /protein_id="ABM76990.1"
FT   gene            252825..252992
FT                   /locus_tag="P9303_02361"
FT   CDS_pept        252825..252992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02361"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76991"
FT                   /db_xref="UniProtKB/TrEMBL:A2C681"
FT                   /protein_id="ABM76991.1"
FT                   RWHTIRLLDE"
FT   gene            complement(253163..253495)
FT                   /locus_tag="P9303_02371"
FT   CDS_pept        complement(253163..253495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02371"
FT                   /product="possible exodeoxyribonuclease small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76992"
FT                   /db_xref="GOA:A2C682"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:A2C682"
FT                   /protein_id="ABM76992.1"
FT                   KPNSDT"
FT   gene            complement(253492..254649)
FT                   /gene="xseA"
FT                   /locus_tag="P9303_02381"
FT   CDS_pept        complement(253492..254649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="P9303_02381"
FT                   /product="Exonuclease VII, large subunit"
FT                   /EC_number=""
FT                   /note="COG1570 Exonuclease VII, large subunit [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76993"
FT                   /db_xref="GOA:A2C683"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:A2C683"
FT                   /protein_id="ABM76993.1"
FT   gene            complement(254639..254815)
FT                   /locus_tag="P9303_02391"
FT   CDS_pept        complement(254639..254815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02391"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76994"
FT                   /db_xref="GOA:A2C684"
FT                   /db_xref="UniProtKB/TrEMBL:A2C684"
FT                   /protein_id="ABM76994.1"
FT                   CLYWGMAYRRLDR"
FT   gene            complement(254941..255087)
FT                   /locus_tag="P9303_02401"
FT   CDS_pept        complement(254941..255087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02401"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76995"
FT                   /db_xref="UniProtKB/TrEMBL:A2C685"
FT                   /protein_id="ABM76995.1"
FT                   GLG"
FT   gene            complement(255193..257754)
FT                   /gene="hrpB"
FT                   /locus_tag="P9303_02411"
FT   CDS_pept        complement(255193..257754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="P9303_02411"
FT                   /product="DEAD/DEAH box helicase:Helicase C-terminal
FT                   domain"
FT                   /note="COG1643 HrpA-like helicases [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76996"
FT                   /db_xref="GOA:A2C686"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C686"
FT                   /protein_id="ABM76996.1"
FT   gene            complement(257770..257874)
FT                   /locus_tag="P9303_02421"
FT   CDS_pept        complement(257770..257874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02421"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76997"
FT                   /db_xref="GOA:A2C687"
FT                   /db_xref="UniProtKB/TrEMBL:A2C687"
FT                   /protein_id="ABM76997.1"
FT   gene            complement(257967..258350)
FT                   /locus_tag="P9303_02431"
FT   CDS_pept        complement(257967..258350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76998"
FT                   /db_xref="UniProtKB/TrEMBL:A2C688"
FT                   /protein_id="ABM76998.1"
FT   gene            complement(258408..258671)
FT                   /locus_tag="P9303_02441"
FT   CDS_pept        complement(258408..258671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM76999"
FT                   /db_xref="InterPro:IPR021355"
FT                   /db_xref="UniProtKB/TrEMBL:A2C689"
FT                   /protein_id="ABM76999.1"
FT   gene            258682..258999
FT                   /locus_tag="P9303_02451"
FT   CDS_pept        258682..258999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02451"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77000"
FT                   /db_xref="UniProtKB/TrEMBL:A2C690"
FT                   /protein_id="ABM77000.1"
FT                   N"
FT   gene            259014..260201
FT                   /locus_tag="P9303_02461"
FT   CDS_pept        259014..260201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02461"
FT                   /product="possible serine protease"
FT                   /note="COG265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77001"
FT                   /db_xref="GOA:A2C691"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A2C691"
FT                   /protein_id="ABM77001.1"
FT   gene            complement(260325..260513)
FT                   /locus_tag="P9303_02471"
FT   CDS_pept        complement(260325..260513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02471"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77002"
FT                   /db_xref="UniProtKB/TrEMBL:A2C692"
FT                   /protein_id="ABM77002.1"
FT                   DGECITRCVEQLRDTDD"
FT   gene            complement(260630..262354)
FT                   /locus_tag="P9303_02481"
FT   CDS_pept        complement(260630..262354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02481"
FT                   /product="ABC transporter, ATP binding component"
FT                   /note="COG488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77003"
FT                   /db_xref="GOA:A2C693"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A2C693"
FT                   /protein_id="ABM77003.1"
FT   gene            262329..262628
FT                   /locus_tag="P9303_02491"
FT   CDS_pept        262329..262628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02491"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77004"
FT                   /db_xref="GOA:A2C694"
FT                   /db_xref="UniProtKB/TrEMBL:A2C694"
FT                   /protein_id="ABM77004.1"
FT   gene            complement(262606..262836)
FT                   /locus_tag="P9303_02501"
FT   CDS_pept        complement(262606..262836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77005"
FT                   /db_xref="UniProtKB/TrEMBL:A2C695"
FT                   /protein_id="ABM77005.1"
FT   gene            complement(262898..263275)
FT                   /locus_tag="P9303_02511"
FT   CDS_pept        complement(262898..263275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77006"
FT                   /db_xref="UniProtKB/TrEMBL:A2C696"
FT                   /protein_id="ABM77006.1"
FT   gene            263421..263783
FT                   /locus_tag="P9303_02521"
FT   CDS_pept        263421..263783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02521"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77007"
FT                   /db_xref="InterPro:IPR012869"
FT                   /db_xref="UniProtKB/TrEMBL:A2C697"
FT                   /protein_id="ABM77007.1"
FT                   RRLRGAPRRLRLYRPS"
FT   gene            complement(263826..264965)
FT                   /locus_tag="P9303_02531"
FT   CDS_pept        complement(263826..264965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02531"
FT                   /product="Predicted molecular chaperone"
FT                   /note="distantly related to HSP70-fold metalloproteases;
FT                   COG2377 Predicted molecular chaperone distantly related to
FT                   HSP70-fold metalloproteases [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77008"
FT                   /db_xref="GOA:A2C698"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C698"
FT                   /protein_id="ABM77008.1"
FT   gene            complement(264971..265675)
FT                   /locus_tag="P9303_02541"
FT   CDS_pept        complement(264971..265675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02541"
FT                   /product="putative potassium channel, VIC family protein"
FT                   /note="COG569 K+ transport systems, NAD-binding component
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77009"
FT                   /db_xref="GOA:A2C699"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A2C699"
FT                   /protein_id="ABM77009.1"
FT                   GLVDDLKKLPKT"
FT   gene            complement(265700..267103)
FT                   /gene="trkG"
FT                   /locus_tag="P9303_02551"
FT   CDS_pept        complement(265700..267103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkG"
FT                   /locus_tag="P9303_02551"
FT                   /product="possible sodium transporter, Trk family protein"
FT                   /note="COG168 Trk-type K+ transport systems, membrane
FT                   components [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77010"
FT                   /db_xref="GOA:A2C6A0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6A0"
FT                   /protein_id="ABM77010.1"
FT                   GYPREDLYV"
FT   gene            complement(267209..269029)
FT                   /gene="citT"
FT                   /locus_tag="P9303_02561"
FT   CDS_pept        complement(267209..269029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="P9303_02561"
FT                   /product="putative sodium/sulfate transporter, DASS family
FT                   protein"
FT                   /note="COG471 Di- and tricarboxylate transporters
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77011"
FT                   /db_xref="GOA:A2C6A1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6A1"
FT                   /protein_id="ABM77011.1"
FT   gene            complement(269032..270708)
FT                   /locus_tag="P9303_02571"
FT   CDS_pept        complement(269032..270708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02571"
FT                   /product="putative GTP-binding protein, transport
FT                   associated"
FT                   /note="COG2262 GTPases [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77012"
FT                   /db_xref="GOA:A2C6A2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6A2"
FT                   /protein_id="ABM77012.1"
FT   gene            complement(270705..271874)
FT                   /locus_tag="P9303_02581"
FT   CDS_pept        complement(270705..271874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02581"
FT                   /product="putative NADH dehydrogenase, transport
FT                   associated"
FT                   /EC_number=""
FT                   /note="COG1252 NADH dehydrogenase, FAD-containing subunit
FT                   [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77013"
FT                   /db_xref="GOA:A2C6A3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6A3"
FT                   /protein_id="ABM77013.1"
FT   gene            271947..272747
FT                   /gene="cysH"
FT                   /locus_tag="P9303_02591"
FT   CDS_pept        271947..272747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="P9303_02591"
FT                   /product="Phosphoadenosine phosphosulfate reductase"
FT                   /EC_number=""
FT                   /note="COG175 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase and
FT                   related enzymes [Amino acid transport and metabolism /
FT                   Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77014"
FT                   /db_xref="GOA:A2C6A4"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6A4"
FT                   /protein_id="ABM77014.1"
FT   gene            272705..273460
FT                   /locus_tag="P9303_02601"
FT   CDS_pept        272705..273460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02601"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="COG1521 Putative transcriptional regulator, homolog
FT                   of Bvg accessory factor [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77015"
FT                   /db_xref="GOA:A2C6A5"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6A5"
FT                   /protein_id="ABM77015.1"
FT   gene            complement(273438..273905)
FT                   /locus_tag="P9303_02611"
FT   CDS_pept        complement(273438..273905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02611"
FT                   /product="putative bacterioferritin comigratory (BCP)
FT                   protein"
FT                   /note="COG1225 Peroxiredoxin [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77016"
FT                   /db_xref="GOA:A2C6A6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6A6"
FT                   /protein_id="ABM77016.1"
FT   gene            273908..274561
FT                   /locus_tag="P9303_02621"
FT   CDS_pept        273908..274561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02621"
FT                   /product="possible 4'-phosphopantetheinyl transferase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77017"
FT                   /db_xref="GOA:A2C6A7"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6A7"
FT                   /protein_id="ABM77017.1"
FT   gene            274660..275085
FT                   /locus_tag="P9303_02631"
FT   CDS_pept        274660..275085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02631"
FT                   /product="possible Thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77018"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6A8"
FT                   /protein_id="ABM77018.1"
FT   gene            275262..275969
FT                   /locus_tag="P9303_02641"
FT   CDS_pept        275262..275969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02641"
FT                   /product="possible Protein phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77019"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6A9"
FT                   /protein_id="ABM77019.1"
FT                   LSSYSSSPIRGLW"
FT   gene            complement(276053..278260)
FT                   /locus_tag="P9303_02651"
FT   CDS_pept        complement(276053..278260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02651"
FT                   /product="putative ATPase, AAA family protein"
FT                   /note="COG2256 ATPase related to the helicase subunit of
FT                   the Holliday junction resolvase [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77020"
FT                   /db_xref="GOA:A2C6B0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6B0"
FT                   /protein_id="ABM77020.1"
FT   gene            278312..279439
FT                   /locus_tag="P9303_02661"
FT   CDS_pept        278312..279439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02661"
FT                   /product="Membrane-fusion protein"
FT                   /note="COG845 Membrane-fusion protein [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77021"
FT                   /db_xref="GOA:A2C6B1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6B1"
FT                   /protein_id="ABM77021.1"
FT   gene            279449..282886
FT                   /locus_tag="P9303_02671"
FT   CDS_pept        279449..282886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02671"
FT                   /product="putative RND family multidrug efflux transporter"
FT                   /note="COG3696 Putative silver efflux pump [Inorganic ion
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77022"
FT                   /db_xref="GOA:A2C6B2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6B2"
FT                   /protein_id="ABM77022.1"
FT   gene            282891..283175
FT                   /locus_tag="P9303_02681"
FT   CDS_pept        282891..283175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02681"
FT                   /product="possible Domain of unknown function DUF33"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77023"
FT                   /db_xref="GOA:A2C6B3"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6B3"
FT                   /protein_id="ABM77023.1"
FT   gene            complement(283178..284836)
FT                   /gene="pgm"
FT                   /locus_tag="P9303_02691"
FT   CDS_pept        complement(283178..284836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="P9303_02691"
FT                   /product="Phosphoglucomutase"
FT                   /EC_number=""
FT                   /note="COG33 Phosphoglucomutase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77024"
FT                   /db_xref="GOA:A2C6B4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6B4"
FT                   /protein_id="ABM77024.1"
FT   gene            284950..285324
FT                   /locus_tag="P9303_02701"
FT   CDS_pept        284950..285324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77025"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6B5"
FT                   /protein_id="ABM77025.1"
FT   gene            complement(285497..285904)
FT                   /locus_tag="P9303_02711"
FT   CDS_pept        complement(285497..285904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02711"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77026"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6B6"
FT                   /protein_id="ABM77026.1"
FT   gene            complement(286001..286357)
FT                   /locus_tag="P9303_02721"
FT   CDS_pept        complement(286001..286357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02721"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77027"
FT                   /db_xref="GOA:A2C6B7"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6B7"
FT                   /protein_id="ABM77027.1"
FT                   LGAIEWAEDLGAKD"
FT   gene            complement(286889..287380)
FT                   /locus_tag="P9303_02731"
FT   CDS_pept        complement(286889..287380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02731"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77028"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6B8"
FT                   /protein_id="ABM77028.1"
FT                   "
FT   gene            complement(287508..288446)
FT                   /locus_tag="P9303_02741"
FT   CDS_pept        complement(287508..288446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02741"
FT                   /product="Hypothetical protein"
FT                   /note="COG330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77029"
FT                   /db_xref="GOA:A2C6B9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6B9"
FT                   /protein_id="ABM77029.1"
FT   gene            288511..288984
FT                   /locus_tag="P9303_02751"
FT   CDS_pept        288511..288984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02751"
FT                   /product="Hypothetical protein"
FT                   /note="COG1585 Membrane protein implicated in regulation of
FT                   membrane protease activity [Posttranslational modification,
FT                   protein turnover, chaperones / Intracellular trafficking
FT                   and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77030"
FT                   /db_xref="GOA:A2C6C0"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6C0"
FT                   /protein_id="ABM77030.1"
FT   gene            complement(289155..289334)
FT                   /locus_tag="P9303_02761"
FT   CDS_pept        complement(289155..289334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02761"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77031"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6C1"
FT                   /protein_id="ABM77031.1"
FT                   HTDQRGLNVSGIGL"
FT   gene            complement(289539..291653)
FT                   /locus_tag="P9303_02771"
FT   CDS_pept        complement(289539..291653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02771"
FT                   /product="Hypothetical protein"
FT                   /note="COG3063 Tfp pilus assembly protein PilF [Cell
FT                   motility and secretion / Intracellular trafficking and
FT                   secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77032"
FT                   /db_xref="GOA:A2C6C2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6C2"
FT                   /protein_id="ABM77032.1"
FT                   MYQFWAYKHS"
FT   gene            complement(291915..292085)
FT                   /locus_tag="P9303_02781"
FT   CDS_pept        complement(291915..292085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02781"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77033"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6C3"
FT                   /protein_id="ABM77033.1"
FT                   KHFTRETDRLW"
FT   gene            complement(292394..292633)
FT                   /locus_tag="P9303_02791"
FT   CDS_pept        complement(292394..292633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02791"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77034"
FT                   /db_xref="GOA:A2C6C4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6C4"
FT                   /protein_id="ABM77034.1"
FT   gene            complement(292866..294101)
FT                   /locus_tag="P9303_02801"
FT   CDS_pept        complement(292866..294101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02801"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77035"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6C5"
FT                   /protein_id="ABM77035.1"
FT                   EHPYAKDELQQE"
FT   gene            complement(294098..296611)
FT                   /locus_tag="P9303_02811"
FT   CDS_pept        complement(294098..296611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02811"
FT                   /product="Hypothetical protein"
FT                   /note="COG3914 Predicted O-linked N-acetylglucosamine
FT                   transferase, SPINDLY family [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77036"
FT                   /db_xref="GOA:A2C6C6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6C6"
FT                   /protein_id="ABM77036.1"
FT   gene            complement(296779..296913)
FT                   /locus_tag="P9303_02821"
FT   CDS_pept        complement(296779..296913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02821"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77037"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6C7"
FT                   /protein_id="ABM77037.1"
FT   gene            complement(296900..297187)
FT                   /locus_tag="P9303_02831"
FT   CDS_pept        complement(296900..297187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02831"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77038"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6C8"
FT                   /protein_id="ABM77038.1"
FT   gene            complement(297332..297604)
FT                   /locus_tag="P9303_02841"
FT   CDS_pept        complement(297332..297604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02841"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77039"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6C9"
FT                   /protein_id="ABM77039.1"
FT   gene            298352..298483
FT                   /locus_tag="P9303_02851"
FT   CDS_pept        298352..298483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02851"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77040"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6D0"
FT                   /protein_id="ABM77040.1"
FT   gene            complement(298506..300161)
FT                   /locus_tag="P9303_02861"
FT                   /note="disrupted protein; COG3063 Tfp pilus assembly
FT                   protein PilF [Cell motility and secretion / Intracellular
FT                   trafficking and secretion]"
FT   gene            complement(300329..300463)
FT                   /locus_tag="P9303_02881"
FT   CDS_pept        complement(300329..300463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02881"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77041"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6C7"
FT                   /protein_id="ABM77041.1"
FT   gene            complement(300534..300761)
FT                   /locus_tag="P9303_02891"
FT   CDS_pept        complement(300534..300761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02891"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77042"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6D2"
FT                   /protein_id="ABM77042.1"
FT   gene            301016..302080
FT                   /locus_tag="P9303_02901"
FT   CDS_pept        301016..302080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02901"
FT                   /product="Hypothetical protein"
FT                   /note="COG4974 Site-specific recombinase XerD [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77043"
FT                   /db_xref="GOA:A2C6D3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6D3"
FT                   /protein_id="ABM77043.1"
FT                   TYAKPTGRVKVPTW"
FT   gene            302074..302244
FT                   /locus_tag="P9303_02911"
FT   CDS_pept        302074..302244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02911"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77044"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6D4"
FT                   /protein_id="ABM77044.1"
FT                   QQACEREKMSR"
FT   gene            302570..302773
FT                   /locus_tag="P9303_02921"
FT   CDS_pept        302570..302773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02921"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77045"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6D5"
FT                   /protein_id="ABM77045.1"
FT   gene            303020..303469
FT                   /locus_tag="P9303_02931"
FT   CDS_pept        303020..303469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02931"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77046"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6D6"
FT                   /protein_id="ABM77046.1"
FT   gene            complement(304258..309288)
FT                   /locus_tag="P9303_02941"
FT   CDS_pept        complement(304258..309288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02941"
FT                   /product="Hypothetical protein"
FT                   /note="COG5010 Flp pilus assembly protein TadD, contains
FT                   TPR repeats [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77047"
FT                   /db_xref="GOA:A2C6D7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6D7"
FT                   /protein_id="ABM77047.1"
FT   gene            complement(309383..310165)
FT                   /locus_tag="P9303_02951"
FT   CDS_pept        complement(309383..310165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02951"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77048"
FT                   /db_xref="GOA:A2C6D8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6D8"
FT                   /protein_id="ABM77048.1"
FT   gene            complement(310392..312176)
FT                   /locus_tag="P9303_02961"
FT   CDS_pept        complement(310392..312176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02961"
FT                   /product="Hypothetical protein"
FT                   /note="COG5010 Flp pilus assembly protein TadD, contains
FT                   TPR repeats [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77049"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012668"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6D9"
FT                   /protein_id="ABM77049.1"
FT                   ICIAFDLQKNEKLWVDSN"
FT   gene            complement(312204..313607)
FT                   /locus_tag="P9303_02971"
FT   CDS_pept        complement(312204..313607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02971"
FT                   /product="Hypothetical protein"
FT                   /note="COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthases and related enzymes [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77050"
FT                   /db_xref="GOA:A2C6E0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6E0"
FT                   /protein_id="ABM77050.1"
FT                   KCGSGVGKT"
FT   gene            complement(313663..313839)
FT                   /locus_tag="P9303_02981"
FT   CDS_pept        complement(313663..313839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02981"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77051"
FT                   /db_xref="GOA:A2C6E1"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6E1"
FT                   /protein_id="ABM77051.1"
FT                   WFVAMLRTAEMPH"
FT   gene            complement(313856..314953)
FT                   /locus_tag="P9303_02991"
FT   CDS_pept        complement(313856..314953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_02991"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG3330 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_02991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77052"
FT                   /db_xref="GOA:A2C6E2"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6E2"
FT                   /protein_id="ABM77052.1"
FT   gene            complement(315226..315419)
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362596"
FT                   /note="frameshift; Pseudogene derived from P9313_20331"
FT   gene            complement(315463..316110)
FT                   /locus_tag="P9303_03001"
FT   CDS_pept        complement(315463..316110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03001"
FT                   /product="Bacterial regulatory proteins, AsnC family
FT                   protein"
FT                   /note="COG2345 Predicted transcriptional regulator
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77053"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014075"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6E3"
FT                   /protein_id="ABM77053.1"
FT   gene            316239..316442
FT                   /locus_tag="P9303_03011"
FT   CDS_pept        316239..316442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03011"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77054"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6E4"
FT                   /protein_id="ABM77054.1"
FT   gene            316485..317927
FT                   /locus_tag="P9303_03021"
FT   CDS_pept        316485..317927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03021"
FT                   /product="ABC transporter, membrane component"
FT                   /note="COG719 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77055"
FT                   /db_xref="GOA:A2C6E5"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6E5"
FT                   /protein_id="ABM77055.1"
FT   gene            317977..318765
FT                   /gene="sufC"
FT                   /locus_tag="P9303_03031"
FT   CDS_pept        317977..318765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="P9303_03031"
FT                   /product="ABC transporter, ATP binding component"
FT                   /note="COG396 ABC-type transport system involved in Fe-S
FT                   cluster assembly, ATPase component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77056"
FT                   /db_xref="GOA:A2C6E6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6E6"
FT                   /protein_id="ABM77056.1"
FT   gene            318765..320015
FT                   /locus_tag="P9303_03041"
FT   CDS_pept        318765..320015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03041"
FT                   /product="ABC transporter, membrane component"
FT                   /note="COG719 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77057"
FT                   /db_xref="GOA:A2C6E7"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6E7"
FT                   /protein_id="ABM77057.1"
FT                   PSTAQAWRPLTRLLDGV"
FT   gene            320023..321327
FT                   /locus_tag="P9303_03051"
FT   CDS_pept        320023..321327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03051"
FT                   /product="putative cysteine desulfurase or selenocysteine
FT                   lyase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG520 Selenocysteine lyase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77058"
FT                   /db_xref="GOA:A2C6E8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6E8"
FT                   /protein_id="ABM77058.1"
FT   gene            complement(321324..323282)
FT                   /gene="dap2"
FT                   /locus_tag="P9303_03061"
FT   CDS_pept        complement(321324..323282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dap2"
FT                   /locus_tag="P9303_03061"
FT                   /product="Esterase/lipase/thioesterase family active site"
FT                   /note="COG1506 Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77059"
FT                   /db_xref="GOA:A2C6E9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6E9"
FT                   /protein_id="ABM77059.1"
FT                   IKVLEATEQFFRRHLKL"
FT   gene            complement(323177..323329)
FT                   /locus_tag="P9303_03071"
FT   CDS_pept        complement(323177..323329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03071"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77060"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6F0"
FT                   /protein_id="ABM77060.1"
FT                   SKNRA"
FT   gene            323306..323428
FT                   /locus_tag="P9303_03081"
FT   CDS_pept        323306..323428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03081"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77061"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6F1"
FT                   /protein_id="ABM77061.1"
FT   gene            323349..323954
FT                   /gene="def"
FT                   /locus_tag="P9303_03091"
FT   CDS_pept        323349..323954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="P9303_03091"
FT                   /product="putative formylmethionine deformylase"
FT                   /EC_number=""
FT                   /note="COG242 N-formylmethionyl-tRNA deformylase
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77062"
FT                   /db_xref="GOA:A2C6F2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6F2"
FT                   /protein_id="ABM77062.1"
FT   gene            complement(323923..324150)
FT                   /locus_tag="P9303_03101"
FT   CDS_pept        complement(323923..324150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03101"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77063"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6F3"
FT                   /protein_id="ABM77063.1"
FT   gene            324222..324965
FT                   /locus_tag="P9303_03111"
FT   CDS_pept        324222..324965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77064"
FT                   /db_xref="InterPro:IPR022222"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6F4"
FT                   /protein_id="ABM77064.1"
FT   gene            325145..325405
FT                   /locus_tag="P9303_03121"
FT   CDS_pept        325145..325405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03121"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77065"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6F5"
FT                   /protein_id="ABM77065.1"
FT   gene            complement(325482..327068)
FT                   /locus_tag="P9303_03131"
FT   CDS_pept        complement(325482..327068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03131"
FT                   /product="Hypothetical protein"
FT                   /note="COG606 Predicted ATPase with chaperone activity
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77066"
FT                   /db_xref="GOA:A2C6F6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6F6"
FT                   /protein_id="ABM77066.1"
FT                   DFAIIAKQLAS"
FT   gene            327031..327471
FT                   /gene="hit"
FT                   /locus_tag="P9303_03141"
FT   CDS_pept        327031..327471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hit"
FT                   /locus_tag="P9303_03141"
FT                   /product="HIT (Histidine triad) family protein"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG537 Diadenosine tetraphosphate (Ap4A) hydrolase
FT                   and other HIT family hydrolases [Nucleotide transport and
FT                   metabolism / Carbohydrate transport and metabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77067"
FT                   /db_xref="GOA:A2C6F7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6F7"
FT                   /protein_id="ABM77067.1"
FT   gene            327497..329500
FT                   /locus_tag="P9303_03151"
FT   CDS_pept        327497..329500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03151"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /note="COG4178 ABC-type uncharacterized transport system,
FT                   permease and ATPase components [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77068"
FT                   /db_xref="GOA:A2C6F8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6F8"
FT                   /protein_id="ABM77068.1"
FT   gene            329443..329784
FT                   /locus_tag="P9303_03161"
FT   CDS_pept        329443..329784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03161"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77069"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6F9"
FT                   /protein_id="ABM77069.1"
FT                   FLHWAGLLS"
FT   gene            complement(329802..330308)
FT                   /locus_tag="P9303_03171"
FT   CDS_pept        complement(329802..330308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77070"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6G0"
FT                   /protein_id="ABM77070.1"
FT                   IRLPS"
FT   gene            complement(330305..330706)
FT                   /locus_tag="P9303_03181"
FT   CDS_pept        complement(330305..330706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77071"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6G1"
FT                   /protein_id="ABM77071.1"
FT   gene            complement(330850..331830)
FT                   /locus_tag="P9303_03191"
FT   CDS_pept        complement(330850..331830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77072"
FT                   /db_xref="GOA:A2C6G2"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6G2"
FT                   /protein_id="ABM77072.1"
FT   gene            complement(331935..332054)
FT                   /locus_tag="P9303_03201"
FT   CDS_pept        complement(331935..332054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03201"
FT                   /product="photosystem II PsbX protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77073"
FT                   /db_xref="GOA:A2C6G3"
FT                   /db_xref="InterPro:IPR009518"
FT                   /db_xref="InterPro:IPR023431"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6G3"
FT                   /protein_id="ABM77073.1"
FT   gene            332104..332463
FT                   /locus_tag="P9303_03211"
FT   CDS_pept        332104..332463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03211"
FT                   /product="YGGT family, conserved hypothetical integral
FT                   membrane protein"
FT                   /note="COG762 Predicted integral membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77074"
FT                   /db_xref="GOA:A2C6G4"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6G4"
FT                   /protein_id="ABM77074.1"
FT                   QGLLSQMLLKSQAIA"
FT   gene            complement(332492..333838)
FT                   /gene="accC"
FT                   /locus_tag="P9303_03221"
FT   CDS_pept        complement(332492..333838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="P9303_03221"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG4770 Acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77075"
FT                   /db_xref="GOA:A2C6G5"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6G5"
FT                   /protein_id="ABM77075.1"
FT   gene            333962..334043
FT                   /locus_tag="P9303_tRNALeuVIMSS1309291"
FT                   /note="tRNA-Leu"
FT   tRNA            333962..334043
FT                   /locus_tag="P9303_tRNALeuVIMSS1309291"
FT                   /product="tRNA-Leu"
FT   gene            334005..335360
FT                   /locus_tag="P9303_03231"
FT   CDS_pept        334005..335360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03231"
FT                   /product="cyanobacteria-specific lipid A disaccharide
FT                   synthetase-like protein"
FT                   /note="COG763 Lipid A disaccharide synthetase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77076"
FT                   /db_xref="GOA:A2C6G6"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6G6"
FT                   /protein_id="ABM77076.1"
FT   gene            335409..335843
FT                   /locus_tag="P9303_03241"
FT   CDS_pept        335409..335843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03241"
FT                   /product="putative methionine sulfoxide reductase family
FT                   protein"
FT                   /EC_number=""
FT                   /note="COG229 Conserved domain frequently associated with
FT                   peptide methionine sulfoxide reductase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77077"
FT                   /db_xref="GOA:A2C6G7"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6G7"
FT                   /protein_id="ABM77077.1"
FT   gene            complement(335857..336966)
FT                   /locus_tag="P9303_03251"
FT   CDS_pept        complement(335857..336966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03251"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG1873 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77078"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6G8"
FT                   /protein_id="ABM77078.1"
FT   gene            complement(337028..340582)
FT                   /locus_tag="P9303_03271"
FT   CDS_pept        complement(337028..340582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03271"
FT                   /product="Hypothetical protein"
FT                   /note="COG497 ATPase involved in DNA repair [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77079"
FT                   /db_xref="GOA:A2C6G9"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6G9"
FT                   /protein_id="ABM77079.1"
FT                   VTQARGAHTQVVGLPNAA"
FT   gene            complement(340688..341044)
FT                   /locus_tag="P9303_03281"
FT   CDS_pept        complement(340688..341044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77080"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6H0"
FT                   /protein_id="ABM77080.1"
FT                   HRLCRIRSKPGANP"
FT   gene            341435..341650
FT                   /locus_tag="P9303_03291"
FT   CDS_pept        341435..341650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77081"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="InterPro:IPR022516"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6H1"
FT                   /protein_id="ABM77081.1"
FT   gene            complement(341727..341918)
FT                   /locus_tag="P9303_03301"
FT   CDS_pept        complement(341727..341918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03301"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77082"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6H2"
FT                   /protein_id="ABM77082.1"
FT                   QENVKIPTKHINFSALVE"
FT   gene            complement(342155..342334)
FT                   /locus_tag="P9303_03311"
FT   CDS_pept        complement(342155..342334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03311"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77083"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6H3"
FT                   /protein_id="ABM77083.1"
FT                   SSPTSNELSEGIAS"
FT   gene            complement(342397..342522)
FT                   /locus_tag="P9303_03321"
FT   CDS_pept        complement(342397..342522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03321"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77084"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6H4"
FT                   /protein_id="ABM77084.1"
FT   gene            342526..342672
FT                   /locus_tag="P9303_03331"
FT   CDS_pept        342526..342672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03331"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77085"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6H5"
FT                   /protein_id="ABM77085.1"
FT                   AQV"
FT   gene            342701..343165
FT                   /locus_tag="P9303_03341"
FT   CDS_pept        342701..343165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77086"
FT                   /db_xref="GOA:A2C6H6"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6H6"
FT                   /protein_id="ABM77086.1"
FT   gene            343165..343551
FT                   /locus_tag="P9303_03351"
FT   CDS_pept        343165..343551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77087"
FT                   /db_xref="GOA:A2C6H7"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6H7"
FT                   /protein_id="ABM77087.1"
FT   gene            complement(344136..345260)
FT                   /locus_tag="P9303_03361"
FT   CDS_pept        complement(344136..345260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03361"
FT                   /product="Putative RNA methylase family UPF0020"
FT                   /note="COG116 Predicted N6-adenine-specific DNA methylase
FT                   [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77088"
FT                   /db_xref="GOA:A2C6H8"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6H8"
FT                   /protein_id="ABM77088.1"
FT   gene            345411..345640
FT                   /gene="ssrA"
FT                   /locus_tag="P9303_ssrAVIMSS1309423"
FT   misc_RNA        345411..345640
FT                   /gene="ssrA"
FT                   /locus_tag="P9303_ssrAVIMSS1309423"
FT                   /product="ssrA tmRNA (transfer messenger RNA, or 10Sa RNA)"
FT   gene            complement(345860..346097)
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362597"
FT                   /note="frameshift; Pseudogene derived from S9605_21251"
FT   gene            346099..346383
FT                   /locus_tag="P9303_03371"
FT   CDS_pept        346099..346383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03371"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77089"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6H9"
FT                   /protein_id="ABM77089.1"
FT   gene            346458..347057
FT                   /locus_tag="P9303_03381"
FT   CDS_pept        346458..347057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03381"
FT                   /product="Hypothetical protein"
FT                   /note="COG1943 Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77090"
FT                   /db_xref="GOA:A2C6I0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6I0"
FT                   /protein_id="ABM77090.1"
FT   gene            347065..347514
FT                   /locus_tag="P9303_03391"
FT   CDS_pept        347065..347514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03391"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77091"
FT                   /db_xref="GOA:A2C6I1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6I1"
FT                   /protein_id="ABM77091.1"
FT   gene            347511..349448
FT                   /locus_tag="P9303_03401"
FT   CDS_pept        347511..349448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03401"
FT                   /product="Hypothetical protein"
FT                   /note="COG4252 Predicted transmembrane sensor domain
FT                   [Signal transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77092"
FT                   /db_xref="GOA:A2C6I2"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6I2"
FT                   /protein_id="ABM77092.1"
FT                   ARSADQELPG"
FT   gene            complement(349384..350118)
FT                   /locus_tag="P9303_03411"
FT   CDS_pept        complement(349384..350118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03411"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77093"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6I3"
FT                   /protein_id="ABM77093.1"
FT   gene            350160..351416
FT                   /locus_tag="P9303_03421"
FT   CDS_pept        350160..351416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03421"
FT                   /product="Hypothetical protein"
FT                   /note="COG4995 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77094"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6I4"
FT                   /protein_id="ABM77094.1"
FT   gene            351620..351865
FT                   /locus_tag="P9303_03431"
FT   CDS_pept        351620..351865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03431"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77095"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6I5"
FT                   /protein_id="ABM77095.1"
FT   gene            complement(351837..352298)
FT                   /locus_tag="P9303_03441"
FT   CDS_pept        complement(351837..352298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03441"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77096"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6I6"
FT                   /protein_id="ABM77096.1"
FT   gene            complement(352322..352477)
FT                   /locus_tag="P9303_03451"
FT   CDS_pept        complement(352322..352477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03451"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77097"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6I7"
FT                   /protein_id="ABM77097.1"
FT                   TKILHQ"
FT   gene            353038..353895
FT                   /locus_tag="P9303_03461"
FT   CDS_pept        353038..353895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03461"
FT                   /product="Acid phosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77098"
FT                   /db_xref="GOA:A2C6I8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001011"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6I8"
FT                   /protein_id="ABM77098.1"
FT                   DTMR"
FT   gene            354184..355248
FT                   /locus_tag="P9303_03471"
FT   CDS_pept        354184..355248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03471"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77099"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6I9"
FT                   /protein_id="ABM77099.1"
FT                   GWNATLRIYSPQSA"
FT   gene            355868..356017
FT                   /locus_tag="P9303_03481"
FT   CDS_pept        355868..356017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03481"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77100"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6J0"
FT                   /protein_id="ABM77100.1"
FT                   IPQC"
FT   gene            356578..356712
FT                   /locus_tag="P9303_03491"
FT   CDS_pept        356578..356712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03491"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77101"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6J1"
FT                   /protein_id="ABM77101.1"
FT   gene            357371..357547
FT                   /locus_tag="P9303_03501"
FT   CDS_pept        357371..357547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03501"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77102"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6J2"
FT                   /protein_id="ABM77102.1"
FT                   LTVAIAFNVLGKW"
FT   gene            357658..357936
FT                   /locus_tag="P9303_03511"
FT   CDS_pept        357658..357936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03511"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77103"
FT                   /db_xref="InterPro:IPR022516"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6J3"
FT                   /protein_id="ABM77103.1"
FT   gene            358012..358434
FT                   /locus_tag="P9303_03521"
FT   CDS_pept        358012..358434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03521"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77104"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6J4"
FT                   /protein_id="ABM77104.1"
FT   gene            complement(358795..359115)
FT                   /locus_tag="P9303_03531"
FT   CDS_pept        complement(358795..359115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03531"
FT                   /product="Hypothetical protein"
FT                   /note="COG3152 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77105"
FT                   /db_xref="GOA:A2C6J5"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6J5"
FT                   /protein_id="ABM77105.1"
FT                   SQ"
FT   gene            358984..359226
FT                   /locus_tag="P9303_03541"
FT   CDS_pept        358984..359226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03541"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77106"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6J6"
FT                   /protein_id="ABM77106.1"
FT   gene            complement(359503..359679)
FT                   /locus_tag="P9303_03551"
FT   CDS_pept        complement(359503..359679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03551"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77107"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6J7"
FT                   /protein_id="ABM77107.1"
FT                   AGLNLFLKKILSV"
FT   gene            complement(360385..361683)
FT                   /gene="cypX"
FT                   /locus_tag="P9303_03561"
FT   CDS_pept        complement(360385..361683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cypX"
FT                   /locus_tag="P9303_03561"
FT                   /product="Cytochrome P450 enzyme"
FT                   /note="COG2124 Cytochrome P450 [Secondary metabolites
FT                   biosynthesis, transport, and catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77108"
FT                   /db_xref="GOA:A2C6J8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6J8"
FT                   /protein_id="ABM77108.1"
FT   gene            complement(361958..362194)
FT                   /locus_tag="P9303_03571"
FT   CDS_pept        complement(361958..362194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03571"
FT                   /product="possible phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77109"
FT                   /db_xref="GOA:Q0GPL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GPL6"
FT                   /protein_id="ABM77109.1"
FT   gene            362498..362825
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362598"
FT                   /note="frameshift; Pseudogene derived from P9313_19721"
FT   gene            complement(362827..362985)
FT                   /locus_tag="P9303_03581"
FT   CDS_pept        complement(362827..362985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03581"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77110"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6K0"
FT                   /protein_id="ABM77110.1"
FT                   LIVIGRH"
FT   gene            363328..363834
FT                   /locus_tag="P9303_03591"
FT   CDS_pept        363328..363834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03591"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77111"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6K1"
FT                   /protein_id="ABM77111.1"
FT                   HKSST"
FT   gene            complement(364292..364765)
FT                   /locus_tag="P9303_03601"
FT   CDS_pept        complement(364292..364765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03601"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG3542 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77112"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6K2"
FT                   /protein_id="ABM77112.1"
FT   gene            365385..365582
FT                   /locus_tag="P9303_03611"
FT   CDS_pept        365385..365582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03611"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77113"
FT                   /db_xref="GOA:A2C6K3"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6K3"
FT                   /protein_id="ABM77113.1"
FT   gene            365844..366017
FT                   /locus_tag="P9303_03621"
FT   CDS_pept        365844..366017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03621"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77114"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6K4"
FT                   /protein_id="ABM77114.1"
FT                   QPFKDKPKKGVL"
FT   gene            366249..366716
FT                   /locus_tag="P9303_03631"
FT   CDS_pept        366249..366716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03631"
FT                   /product="Hypothetical protein"
FT                   /note="COG1525 Micrococcal nuclease (thermonuclease)
FT                   homologs [DNA replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77115"
FT                   /db_xref="GOA:A2C6K5"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6K5"
FT                   /protein_id="ABM77115.1"
FT   gene            complement(366938..367093)
FT                   /locus_tag="P9303_03641"
FT   CDS_pept        complement(366938..367093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03641"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77116"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6K6"
FT                   /protein_id="ABM77116.1"
FT                   SLKCFL"
FT   gene            complement(368247..368420)
FT                   /locus_tag="P9303_03651"
FT   CDS_pept        complement(368247..368420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03651"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77117"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6K7"
FT                   /protein_id="ABM77117.1"
FT                   SKQKADLMQQPY"
FT   gene            369018..369324
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362599"
FT                   /note="frameshift; Pseudogene derived from P9313_19671"
FT   gene            369569..369667
FT                   /locus_tag="P9303_03661"
FT   CDS_pept        369569..369667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03661"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77118"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6K8"
FT                   /protein_id="ABM77118.1"
FT                   /translation="MGVLSASISLHCPFLGEWITPGQNSALKGYGM"
FT   gene            complement(369754..370023)
FT                   /locus_tag="P9303_03671"
FT   CDS_pept        complement(369754..370023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03671"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77119"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6K9"
FT                   /protein_id="ABM77119.1"
FT   gene            370945..371115
FT                   /locus_tag="P9303_03681"
FT   CDS_pept        370945..371115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03681"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77120"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6L0"
FT                   /protein_id="ABM77120.1"
FT                   FAKTKHLDKCI"
FT   gene            371169..371339
FT                   /locus_tag="P9303_03691"
FT   CDS_pept        371169..371339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03691"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77121"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6L1"
FT                   /protein_id="ABM77121.1"
FT                   WTSGLVIGGEG"
FT   gene            371387..371671
FT                   /locus_tag="P9303_03701"
FT   CDS_pept        371387..371671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03701"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77122"
FT                   /db_xref="GOA:A2C6L2"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6L2"
FT                   /protein_id="ABM77122.1"
FT   gene            complement(372786..372958)
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362600"
FT                   /note="frameshift; Pseudogene derived from P9313_19631"
FT   gene            372965..373186
FT                   /locus_tag="P9303_03711"
FT   CDS_pept        372965..373186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03711"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77123"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6L3"
FT                   /protein_id="ABM77123.1"
FT   gene            complement(374041..374685)
FT                   /locus_tag="P9303_03721"
FT   CDS_pept        complement(374041..374685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03721"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77124"
FT                   /db_xref="GOA:A2C6L4"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6L4"
FT                   /protein_id="ABM77124.1"
FT   gene            complement(374694..374864)
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362601"
FT                   /note="Pseudogene derived from P9313_19621"
FT   gene            375245..378061
FT                   /locus_tag="P9303_03731"
FT   CDS_pept        375245..378061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03731"
FT                   /product="Hypothetical protein"
FT                   /note="COG1233 Phytoene dehydrogenase and related proteins
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77125"
FT                   /db_xref="GOA:A2C6L5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6L5"
FT                   /protein_id="ABM77125.1"
FT                   HALMKNQS"
FT   gene            378196..378372
FT                   /locus_tag="P9303_03741"
FT   CDS_pept        378196..378372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03741"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77126"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6L6"
FT                   /protein_id="ABM77126.1"
FT                   EAEHHRSFLIPNG"
FT   gene            378837..379016
FT                   /locus_tag="P9303_03751"
FT   CDS_pept        378837..379016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03751"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77127"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6L7"
FT                   /protein_id="ABM77127.1"
FT                   LPKRLIFSCGLVLQ"
FT   gene            379039..379374
FT                   /locus_tag="P9303_03761"
FT   CDS_pept        379039..379374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03761"
FT                   /product="possible Transthyretin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77128"
FT                   /db_xref="GOA:A2C6L8"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6L8"
FT                   /protein_id="ABM77128.1"
FT                   ARLTPAH"
FT   gene            379599..380390
FT                   /gene="icc"
FT                   /locus_tag="P9303_03771"
FT   CDS_pept        379599..380390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icc"
FT                   /locus_tag="P9303_03771"
FT                   /product="Serine/threonine specific protein phosphatase"
FT                   /note="COG1409 Predicted phosphohydrolases [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77129"
FT                   /db_xref="GOA:A2C6L9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6L9"
FT                   /protein_id="ABM77129.1"
FT   gene            complement(381156..382490)
FT                   /locus_tag="P9303_03781"
FT   CDS_pept        complement(381156..382490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03781"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77130"
FT                   /db_xref="GOA:A2C6M0"
FT                   /db_xref="InterPro:IPR003386"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6M0"
FT                   /protein_id="ABM77130.1"
FT   gene            complement(382882..383490)
FT                   /locus_tag="P9303_03791"
FT   CDS_pept        complement(382882..383490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03791"
FT                   /product="Pentapeptide repeats"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77131"
FT                   /db_xref="GOA:A2C6M1"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6M1"
FT                   /protein_id="ABM77131.1"
FT   gene            complement(384158..385543)
FT                   /locus_tag="P9303_03801"
FT   CDS_pept        complement(384158..385543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03801"
FT                   /product="possible sodium:solute symporter, ESS family
FT                   protein"
FT                   /note="COG786 Na+/glutamate symporter [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77132"
FT                   /db_xref="GOA:A2C6M2"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6M2"
FT                   /protein_id="ABM77132.1"
FT                   EAA"
FT   gene            385514..385696
FT                   /locus_tag="P9303_03811"
FT   CDS_pept        385514..385696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03811"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77133"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6M3"
FT                   /protein_id="ABM77133.1"
FT                   MQRLLLSALLDGLHG"
FT   gene            complement(385717..386055)
FT                   /locus_tag="P9303_03821"
FT   CDS_pept        complement(385717..386055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03821"
FT                   /product="possible Helix-turn-helix protein, copG family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77134"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6M4"
FT                   /protein_id="ABM77134.1"
FT                   QKRHNTQA"
FT   gene            386153..386272
FT                   /locus_tag="P9303_03831"
FT   CDS_pept        386153..386272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03831"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77135"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6M5"
FT                   /protein_id="ABM77135.1"
FT   gene            386345..387298
FT                   /locus_tag="P9303_03841"
FT   CDS_pept        386345..387298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03841"
FT                   /product="Putative thioredoxin reductase"
FT                   /EC_number=""
FT                   /note="COG492 Thioredoxin reductase [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77136"
FT                   /db_xref="GOA:A2C6M6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6M6"
FT                   /protein_id="ABM77136.1"
FT   gene            complement(387531..388163)
FT                   /gene="thy1"
FT                   /locus_tag="P9303_03851"
FT   CDS_pept        complement(387531..388163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thy1"
FT                   /locus_tag="P9303_03851"
FT                   /product="alternative thymidylate synthase"
FT                   /EC_number=""
FT                   /note="COG1351 Predicted alternative thymidylate synthase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77137"
FT                   /db_xref="GOA:A2C6M7"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6M7"
FT                   /protein_id="ABM77137.1"
FT   gene            complement(388853..389344)
FT                   /locus_tag="P9303_03861"
FT   CDS_pept        complement(388853..389344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03861"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77138"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6M8"
FT                   /protein_id="ABM77138.1"
FT                   "
FT   gene            389437..390396
FT                   /locus_tag="P9303_03871"
FT   CDS_pept        389437..390396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03871"
FT                   /product="DnaJ3 protein"
FT                   /note="COG484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77139"
FT                   /db_xref="GOA:A2C6M9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6M9"
FT                   /protein_id="ABM77139.1"
FT   gene            390435..391436
FT                   /gene="hemB"
FT                   /locus_tag="P9303_03881"
FT   CDS_pept        390435..391436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="P9303_03881"
FT                   /product="Delta-aminolevulinic acid dehydratase"
FT                   /EC_number=""
FT                   /note="COG113 Delta-aminolevulinic acid dehydratase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77140"
FT                   /db_xref="GOA:A2C6N0"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6N0"
FT                   /protein_id="ABM77140.1"
FT   gene            391408..393894
FT                   /locus_tag="P9303_03891"
FT   CDS_pept        391408..393894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03891"
FT                   /product="putative DNA mismatch repair protein MutS family
FT                   protein"
FT                   /EC_number=""
FT                   /note="COG1193 Mismatch repair ATPase (MutS family) [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77141"
FT                   /db_xref="GOA:A2C6N1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6N1"
FT                   /protein_id="ABM77141.1"
FT                   ADQSDGGAGCSVIWLH"
FT   gene            complement(393891..395138)
FT                   /gene="malK"
FT                   /locus_tag="P9303_03901"
FT   CDS_pept        complement(393891..395138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malK"
FT                   /locus_tag="P9303_03901"
FT                   /product="possible ABC transporter, ATP binding component"
FT                   /EC_number=""
FT                   /note="COG3839 ABC-type sugar transport systems, ATPase
FT                   components [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77142"
FT                   /db_xref="GOA:A2C6N2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6N2"
FT                   /protein_id="ABM77142.1"
FT                   TEQDPNDRKLHLPILG"
FT   gene            complement(395413..395590)
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362602"
FT                   /note="frameshift; Pseudogene derived from P9313_26591"
FT   gene            complement(395774..396037)
FT                   /locus_tag="P9303_03911"
FT   CDS_pept        complement(395774..396037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03911"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77143"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="InterPro:IPR022516"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6N3"
FT                   /protein_id="ABM77143.1"
FT   gene            complement(396211..396480)
FT                   /locus_tag="P9303_03921"
FT   CDS_pept        complement(396211..396480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03921"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77144"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="InterPro:IPR022516"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6N4"
FT                   /protein_id="ABM77144.1"
FT   gene            complement(396532..396840)
FT                   /locus_tag="P9303_03931"
FT   CDS_pept        complement(396532..396840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03931"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77145"
FT                   /db_xref="InterPro:IPR022516"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6N5"
FT                   /protein_id="ABM77145.1"
FT   gene            397937..398926
FT                   /gene="obg"
FT                   /locus_tag="P9303_03941"
FT   CDS_pept        397937..398926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obg"
FT                   /locus_tag="P9303_03941"
FT                   /product="GTP1/OBG family protein"
FT                   /note="COG536 Predicted GTPase [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77146"
FT                   /db_xref="GOA:A2C6N6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6N6"
FT                   /protein_id="ABM77146.1"
FT   gene            399013..399195
FT                   /locus_tag="P9303_03951"
FT   CDS_pept        399013..399195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03951"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77147"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6N7"
FT                   /protein_id="ABM77147.1"
FT                   VCSLTGSPSDFNEDV"
FT   gene            complement(399296..399514)
FT                   /locus_tag="P9303_03961"
FT   CDS_pept        complement(399296..399514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03961"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77148"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6N8"
FT                   /protein_id="ABM77148.1"
FT   gene            complement(399548..399826)
FT                   /locus_tag="P9303_03971"
FT   CDS_pept        complement(399548..399826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03971"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77149"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6N9"
FT                   /protein_id="ABM77149.1"
FT   gene            399757..400071
FT                   /locus_tag="P9303_03981"
FT   CDS_pept        399757..400071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03981"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77150"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6P0"
FT                   /protein_id="ABM77150.1"
FT                   "
FT   gene            complement(400178..402136)
FT                   /locus_tag="P9303_03991"
FT   CDS_pept        complement(400178..402136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_03991"
FT                   /product="ABC transporter, ATP binding domain"
FT                   /note="COG488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_03991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77151"
FT                   /db_xref="GOA:A2C6P1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6P1"
FT                   /protein_id="ABM77151.1"
FT                   TLHKAEERWLELSELAI"
FT   gene            complement(402133..402807)
FT                   /locus_tag="P9303_04001"
FT   CDS_pept        complement(402133..402807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04001"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="COG5413 Uncharacterized integral membrane protein
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77152"
FT                   /db_xref="GOA:A2C6P2"
FT                   /db_xref="InterPro:IPR019275"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6P2"
FT                   /protein_id="ABM77152.1"
FT                   AL"
FT   gene            complement(402804..403796)
FT                   /gene="ecm4"
FT                   /locus_tag="P9303_04011"
FT   CDS_pept        complement(402804..403796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecm4"
FT                   /locus_tag="P9303_04011"
FT                   /product="Glutathione S-transferase C terminus protein"
FT                   /note="COG435 Predicted glutathione S-transferase
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77153"
FT                   /db_xref="GOA:A2C6P3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6P3"
FT                   /protein_id="ABM77153.1"
FT   gene            403795..404766
FT                   /gene="aspA"
FT                   /locus_tag="P9303_04021"
FT   CDS_pept        403795..404766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="P9303_04021"
FT                   /product="putative aspartoacylase"
FT                   /EC_number=""
FT                   /note="COG2988 Succinylglutamate desuccinylase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77154"
FT                   /db_xref="GOA:A2C6P4"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016708"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6P4"
FT                   /protein_id="ABM77154.1"
FT   gene            complement(404763..405137)
FT                   /locus_tag="P9303_04031"
FT   CDS_pept        complement(404763..405137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77155"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6P5"
FT                   /protein_id="ABM77155.1"
FT   gene            405109..405228
FT                   /locus_tag="P9303_04041"
FT   CDS_pept        405109..405228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04041"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77156"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6P6"
FT                   /protein_id="ABM77156.1"
FT   gene            complement(405210..405596)
FT                   /locus_tag="P9303_04051"
FT   CDS_pept        complement(405210..405596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77157"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6P7"
FT                   /protein_id="ABM77157.1"
FT   gene            complement(405678..406019)
FT                   /locus_tag="P9303_04061"
FT   CDS_pept        complement(405678..406019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77158"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6P8"
FT                   /protein_id="ABM77158.1"
FT                   STRIQWACG"
FT   gene            406047..406229
FT                   /locus_tag="P9303_04071"
FT   CDS_pept        406047..406229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04071"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77159"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6P9"
FT                   /protein_id="ABM77159.1"
FT                   GLEPRAAAGIHGQKT"
FT   gene            406139..406348
FT                   /locus_tag="P9303_04081"
FT   CDS_pept        406139..406348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04081"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77160"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Q0"
FT                   /protein_id="ABM77160.1"
FT   gene            406385..407461
FT                   /gene="psbA"
FT                   /locus_tag="P9303_04091"
FT   CDS_pept        406385..407461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbA"
FT                   /locus_tag="P9303_04091"
FT                   /product="Photosystem II PsbA protein (D1)"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77161"
FT                   /db_xref="GOA:A2C6Q1"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6Q1"
FT                   /protein_id="ABM77161.1"
FT                   DLAAAESTPVALIAPAIG"
FT   gene            complement(407639..408826)
FT                   /locus_tag="P9303_04101"
FT   CDS_pept        complement(407639..408826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04101"
FT                   /product="Predicted membrane protein"
FT                   /note="COG1808 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77162"
FT                   /db_xref="GOA:A2C6Q2"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Q2"
FT                   /protein_id="ABM77162.1"
FT   gene            409503..409676
FT                   /locus_tag="P9303_04111"
FT   CDS_pept        409503..409676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04111"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77163"
FT                   /db_xref="GOA:A2C6Q3"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Q3"
FT                   /protein_id="ABM77163.1"
FT                   RQDHVSKVLLDS"
FT   gene            complement(410294..410368)
FT                   /locus_tag="P9303_tRNAThrVIMSS1309270"
FT                   /note="tRNA-Thr"
FT   tRNA            complement(410294..410368)
FT                   /locus_tag="P9303_tRNAThrVIMSS1309270"
FT                   /product="tRNA-Thr"
FT   gene            complement(410477..411262)
FT                   /locus_tag="P9303_04121"
FT   CDS_pept        complement(410477..411262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77164"
FT                   /db_xref="GOA:A2C6Q4"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Q4"
FT                   /protein_id="ABM77164.1"
FT   gene            complement(411288..414662)
FT                   /gene="infB"
FT                   /locus_tag="P9303_04131"
FT   CDS_pept        complement(411288..414662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="P9303_04131"
FT                   /product="Translation initiation factor IF-2"
FT                   /note="COG532 Translation initiation factor 2 (IF-2;
FT                   GTPase) [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77165"
FT                   /db_xref="GOA:A2C6Q5"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6Q5"
FT                   /protein_id="ABM77165.1"
FT                   IIEAHKLVTKRRTLSSS"
FT   gene            complement(414726..415004)
FT                   /locus_tag="P9303_04141"
FT   CDS_pept        complement(414726..415004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04141"
FT                   /product="Predicted nucleic-acid-binding protein implicated
FT                   in transcription termination"
FT                   /note="COG2740 Predicted nucleic-acid-binding protein
FT                   implicated in transcription termination [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77166"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Q6"
FT                   /protein_id="ABM77166.1"
FT   gene            complement(415001..416455)
FT                   /gene="nusA"
FT                   /locus_tag="P9303_04151"
FT   CDS_pept        complement(415001..416455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="P9303_04151"
FT                   /product="N utilization substance protein A"
FT                   /note="COG195 Transcription elongation factor
FT                   [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77167"
FT                   /db_xref="GOA:A2C6Q7"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Q7"
FT                   /protein_id="ABM77167.1"
FT   gene            complement(416509..416973)
FT                   /locus_tag="P9303_04161"
FT   CDS_pept        complement(416509..416973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04161"
FT                   /product="DUF150"
FT                   /note="COG779 Uncharacterized protein conserved in bacteria
FT                   [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77168"
FT                   /db_xref="GOA:A2C6Q8"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6Q8"
FT                   /protein_id="ABM77168.1"
FT   gene            417232..418344
FT                   /locus_tag="P9303_04171"
FT   CDS_pept        417232..418344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04171"
FT                   /product="small mechanosensitive ion channel, MscS family
FT                   protein"
FT                   /note="COG668 Small-conductance mechanosensitive channel
FT                   [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77169"
FT                   /db_xref="GOA:A2C6Q9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Q9"
FT                   /protein_id="ABM77169.1"
FT   gene            complement(418387..418860)
FT                   /locus_tag="P9303_04181"
FT   CDS_pept        complement(418387..418860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77170"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6R0"
FT                   /protein_id="ABM77170.1"
FT   gene            complement(419305..420852)
FT                   /locus_tag="P9303_04191"
FT   CDS_pept        complement(419305..420852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04191"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG5361 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77171"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6R1"
FT                   /protein_id="ABM77171.1"
FT   gene            complement(420891..422414)
FT                   /locus_tag="P9303_04201"
FT   CDS_pept        complement(420891..422414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04201"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG5361 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77172"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6R2"
FT                   /protein_id="ABM77172.1"
FT   gene            422296..422463
FT                   /locus_tag="P9303_04211"
FT   CDS_pept        422296..422463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04211"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77173"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6R3"
FT                   /protein_id="ABM77173.1"
FT                   TVETLRLQIA"
FT   gene            complement(422593..423768)
FT                   /gene="aslB"
FT                   /locus_tag="P9303_04221"
FT   CDS_pept        complement(422593..423768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aslB"
FT                   /locus_tag="P9303_04221"
FT                   /product="putative arylsulfatase regulatory protein"
FT                   /note="COG641 Arylsulfatase regulator (Fe-S oxidoreductase)
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77174"
FT                   /db_xref="GOA:A2C6R4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026357"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6R4"
FT                   /protein_id="ABM77174.1"
FT   gene            complement(423788..424159)
FT                   /locus_tag="P9303_04231"
FT   CDS_pept        complement(423788..424159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04231"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77175"
FT                   /db_xref="InterPro:IPR026356"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6R5"
FT                   /protein_id="ABM77175.1"
FT   gene            complement(424282..424647)
FT                   /locus_tag="P9303_04241"
FT   CDS_pept        complement(424282..424647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77176"
FT                   /db_xref="InterPro:IPR026356"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6R6"
FT                   /protein_id="ABM77176.1"
FT                   GGGWMNGGYGGRGFANW"
FT   gene            complement(424699..425556)
FT                   /locus_tag="P9303_04251"
FT   CDS_pept        complement(424699..425556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04251"
FT                   /product="possible ABC transporter, solute binding protein"
FT                   /note="COG834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain [Amino
FT                   acid transport and metabolism / Signal transduction
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77177"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR026358"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6R7"
FT                   /protein_id="ABM77177.1"
FT                   LSLR"
FT   gene            complement(425759..426622)
FT                   /locus_tag="P9303_04261"
FT   CDS_pept        complement(425759..426622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04261"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG1262 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77178"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6R8"
FT                   /protein_id="ABM77178.1"
FT                   CAKGGP"
FT   gene            complement(426729..429089)
FT                   /locus_tag="P9303_04271"
FT   CDS_pept        complement(426729..429089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04271"
FT                   /product="Sulfatase"
FT                   /EC_number=""
FT                   /note="COG3119 Arylsulfatase A and related enzymes
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77179"
FT                   /db_xref="GOA:A2C6R9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6R9"
FT                   /protein_id="ABM77179.1"
FT   gene            429556..430557
FT                   /locus_tag="P9303_04281"
FT   CDS_pept        429556..430557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04281"
FT                   /product="possible Neuromedin U"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77180"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6S0"
FT                   /protein_id="ABM77180.1"
FT   gene            430597..431589
FT                   /locus_tag="P9303_04291"
FT   CDS_pept        430597..431589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77181"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6S1"
FT                   /protein_id="ABM77181.1"
FT   gene            431813..432001
FT                   /locus_tag="P9303_04301"
FT   CDS_pept        431813..432001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04301"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77182"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6S2"
FT                   /protein_id="ABM77182.1"
FT                   ALNCWSLPADHFLLEPV"
FT   gene            432194..433282
FT                   /locus_tag="P9303_04311"
FT   CDS_pept        432194..433282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04311"
FT                   /product="Trypsin-like serine protease"
FT                   /note="COG265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77183"
FT                   /db_xref="GOA:A2C6S3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6S3"
FT                   /protein_id="ABM77183.1"
FT   gene            433325..434041
FT                   /gene="rpiA"
FT                   /locus_tag="P9303_04321"
FT   CDS_pept        433325..434041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="P9303_04321"
FT                   /product="Ribose 5-phosphate isomerase"
FT                   /EC_number=""
FT                   /note="COG120 Ribose 5-phosphate isomerase [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77184"
FT                   /db_xref="GOA:A2C6S4"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6S4"
FT                   /protein_id="ABM77184.1"
FT                   QISDGVAGVRRLQRRE"
FT   gene            complement(434047..435375)
FT                   /gene="hisD"
FT                   /locus_tag="P9303_04331"
FT   CDS_pept        complement(434047..435375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="P9303_04331"
FT                   /product="Histidinol dehydrogenase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG141 Histidinol dehydrogenase [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77185"
FT                   /db_xref="GOA:A2C6S5"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6S5"
FT                   /protein_id="ABM77185.1"
FT   gene            435506..435808
FT                   /gene="rpsT"
FT                   /locus_tag="P9303_04341"
FT   CDS_pept        435506..435808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="P9303_04341"
FT                   /product="30s Ribosomal protein S20"
FT                   /note="COG268 Ribosomal protein S20 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77186"
FT                   /db_xref="GOA:A2C6S6"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6S6"
FT                   /protein_id="ABM77186.1"
FT   gene            435856..436689
FT                   /gene="tatD"
FT                   /locus_tag="P9303_04351"
FT   CDS_pept        435856..436689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="P9303_04351"
FT                   /product="possible deoxyribonuclease, TatD family protein"
FT                   /note="COG84 Mg-dependent DNase [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77187"
FT                   /db_xref="GOA:A2C6S7"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033665"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6S7"
FT                   /protein_id="ABM77187.1"
FT   gene            436973..440266
FT                   /gene="rpoB"
FT                   /locus_tag="P9303_04361"
FT   CDS_pept        436973..440266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="P9303_04361"
FT                   /product="RNA polymerase beta subunit"
FT                   /EC_number=""
FT                   /note="COG85 DNA-directed RNA polymerase, beta subunit/140
FT                   kD subunit [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77188"
FT                   /db_xref="GOA:A2C6S8"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6S8"
FT                   /protein_id="ABM77188.1"
FT   gene            440316..442220
FT                   /gene="rpoC1"
FT                   /locus_tag="P9303_04371"
FT   CDS_pept        440316..442220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC1"
FT                   /locus_tag="P9303_04371"
FT                   /product="RNA polymerase gamma subunit"
FT                   /EC_number=""
FT                   /note="COG86 DNA-directed RNA polymerase, beta' subunit/160
FT                   kD subunit [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77189"
FT                   /db_xref="GOA:A2C6S9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR012755"
FT                   /db_xref="InterPro:IPR034678"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6S9"
FT                   /protein_id="ABM77189.1"
FT   gene            complement(442222..442440)
FT                   /locus_tag="P9303_04381"
FT   CDS_pept        complement(442222..442440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04381"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77190"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6T0"
FT                   /protein_id="ABM77190.1"
FT   gene            442268..446392
FT                   /gene="rpoC2"
FT                   /locus_tag="P9303_04391"
FT   CDS_pept        442268..446392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC2"
FT                   /locus_tag="P9303_04391"
FT                   /product="RNA polymerase beta prime subunit"
FT                   /EC_number=""
FT                   /note="COG86 DNA-directed RNA polymerase, beta' subunit/160
FT                   kD subunit [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77191"
FT                   /db_xref="GOA:A2C6T1"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012756"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6T1"
FT                   /protein_id="ABM77191.1"
FT   gene            446452..446604
FT                   /gene="hli3"
FT                   /locus_tag="P9303_04401"
FT   CDS_pept        446452..446604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hli3"
FT                   /locus_tag="P9303_04401"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77192"
FT                   /db_xref="GOA:A2C6T2"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6T2"
FT                   /protein_id="ABM77192.1"
FT                   GLLIW"
FT   gene            446601..447671
FT                   /locus_tag="P9303_04411"
FT   CDS_pept        446601..447671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04411"
FT                   /product="Predicted Fe-S-cluster redox enzyme"
FT                   /note="COG820 Predicted Fe-S-cluster redox enzyme [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77193"
FT                   /db_xref="GOA:A2C6T3"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6T3"
FT                   /protein_id="ABM77193.1"
FT                   QNAACGQLRRQHAAIG"
FT   gene            447714..449483
FT                   /gene="putP"
FT                   /locus_tag="P9303_04421"
FT   CDS_pept        447714..449483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putP"
FT                   /locus_tag="P9303_04421"
FT                   /product="Sodium:solute symporter family, possible glucose
FT                   transporter"
FT                   /note="COG591 Na+/proline symporter [Amino acid transport
FT                   and metabolism / General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77194"
FT                   /db_xref="GOA:A2C6T4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6T4"
FT                   /protein_id="ABM77194.1"
FT                   LTRGWLRSRMGVA"
FT   gene            449535..449660
FT                   /locus_tag="P9303_04431"
FT   CDS_pept        449535..449660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04431"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77195"
FT                   /db_xref="GOA:A2C6T5"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6T5"
FT                   /protein_id="ABM77195.1"
FT   gene            449695..450486
FT                   /locus_tag="P9303_04441"
FT   CDS_pept        449695..450486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04441"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1413 FOG: HEAT repeat [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77196"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6T6"
FT                   /protein_id="ABM77196.1"
FT   gene            450578..450790
FT                   /locus_tag="P9303_04451"
FT   CDS_pept        450578..450790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77197"
FT                   /db_xref="InterPro:IPR021375"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6T7"
FT                   /protein_id="ABM77197.1"
FT   gene            450790..451182
FT                   /locus_tag="P9303_04461"
FT   CDS_pept        450790..451182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77198"
FT                   /db_xref="InterPro:IPR009666"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6T8"
FT                   /protein_id="ABM77198.1"
FT   gene            complement(451148..451345)
FT                   /locus_tag="P9303_04471"
FT   CDS_pept        complement(451148..451345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04471"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77199"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6T9"
FT                   /protein_id="ABM77199.1"
FT   gene            451199..451579
FT                   /gene="fer"
FT                   /locus_tag="P9303_04481"
FT   CDS_pept        451199..451579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fer"
FT                   /locus_tag="P9303_04481"
FT                   /product="3Fe-4S ferredoxin"
FT                   /note="COG1141 Ferredoxin [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77200"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6U0"
FT                   /protein_id="ABM77200.1"
FT   gene            451586..452806
FT                   /locus_tag="P9303_04491"
FT   CDS_pept        451586..452806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04491"
FT                   /product="Aldo/keto reductase family protein"
FT                   /note="COG1453 Predicted oxidoreductases of the aldo/keto
FT                   reductase family [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77201"
FT                   /db_xref="GOA:A2C6U1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6U1"
FT                   /protein_id="ABM77201.1"
FT                   QQRLTSV"
FT   gene            complement(452803..453546)
FT                   /gene="gidB"
FT                   /locus_tag="P9303_04501"
FT   CDS_pept        complement(452803..453546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="P9303_04501"
FT                   /product="putative glucose inhibited division protein B"
FT                   /EC_number=""
FT                   /note="COG357 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in bacterial cell division [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77202"
FT                   /db_xref="GOA:A2C6U2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6U2"
FT                   /protein_id="ABM77202.1"
FT   gene            453545..454177
FT                   /locus_tag="P9303_04511"
FT   CDS_pept        453545..454177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04511"
FT                   /product="DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77203"
FT                   /db_xref="GOA:A2C6U3"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6U3"
FT                   /protein_id="ABM77203.1"
FT   gene            454128..454385
FT                   /locus_tag="P9303_04521"
FT   CDS_pept        454128..454385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77204"
FT                   /db_xref="InterPro:IPR021489"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6U4"
FT                   /protein_id="ABM77204.1"
FT   gene            complement(454420..455748)
FT                   /gene="bioA"
FT                   /locus_tag="P9303_04531"
FT   CDS_pept        complement(454420..455748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="P9303_04531"
FT                   /product="putative diaminopelargonic acid synthase"
FT                   /EC_number=""
FT                   /note="COG161 Adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77205"
FT                   /db_xref="GOA:A2C6U5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6U5"
FT                   /protein_id="ABM77205.1"
FT   gene            complement(455911..456810)
FT                   /locus_tag="P9303_04541"
FT   CDS_pept        complement(455911..456810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04541"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77206"
FT                   /db_xref="GOA:A2C6U6"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6U6"
FT                   /protein_id="ABM77206.1"
FT                   SSGLNASQINDITTGIFS"
FT   gene            complement(457189..457344)
FT                   /locus_tag="P9303_04551"
FT   CDS_pept        complement(457189..457344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04551"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77207"
FT                   /db_xref="GOA:A2C6U7"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6U7"
FT                   /protein_id="ABM77207.1"
FT                   QSEVCR"
FT   gene            complement(457341..458039)
FT                   /gene="bioD"
FT                   /locus_tag="P9303_04561"
FT   CDS_pept        complement(457341..458039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="P9303_04561"
FT                   /product="putative Dethiobiotin synthase"
FT                   /EC_number=""
FT                   /note="COG132 Dethiobiotin synthetase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77208"
FT                   /db_xref="GOA:A2C6U8"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6U8"
FT                   /protein_id="ABM77208.1"
FT                   RLLKSWSQVQ"
FT   gene            complement(458006..458761)
FT                   /locus_tag="P9303_04571"
FT   CDS_pept        complement(458006..458761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04571"
FT                   /product="Methylase"
FT                   /note="involved in ubiquinone/menaquinone biosynthesis;
FT                   COG2226 Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77209"
FT                   /db_xref="GOA:A2C6U9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6U9"
FT                   /protein_id="ABM77209.1"
FT   gene            complement(458758..459456)
FT                   /locus_tag="P9303_04581"
FT   CDS_pept        complement(458758..459456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77210"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6V0"
FT                   /protein_id="ABM77210.1"
FT                   RVHKWLESAP"
FT   gene            complement(459471..460613)
FT                   /gene="bioF"
FT                   /locus_tag="P9303_04591"
FT   CDS_pept        complement(459471..460613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="P9303_04591"
FT                   /product="putative 8-amino-7-oxononanoate synthase"
FT                   /EC_number=""
FT                   /note="COG156 7-keto-8-aminopelargonate synthetase and
FT                   related enzymes [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77211"
FT                   /db_xref="GOA:A2C6V1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6V1"
FT                   /protein_id="ABM77211.1"
FT   gene            460745..463519
FT                   /locus_tag="P9303_04601"
FT   CDS_pept        460745..463519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04601"
FT                   /product="putative DNA helicase"
FT                   /note="COG4581 Superfamily II RNA helicase [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77212"
FT                   /db_xref="GOA:A2C6V2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6V2"
FT                   /protein_id="ABM77212.1"
FT   gene            complement(463539..464894)
FT                   /locus_tag="P9303_04611"
FT   CDS_pept        complement(463539..464894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04611"
FT                   /product="possible multidrug efflux transporter, MFS family
FT                   protein"
FT                   /note="COG2271 Sugar phosphate permease [Carbohydrate
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77213"
FT                   /db_xref="GOA:A2C6V3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6V3"
FT                   /protein_id="ABM77213.1"
FT   gene            complement(464902..466299)
FT                   /gene="fumC"
FT                   /locus_tag="P9303_04621"
FT   CDS_pept        complement(464902..466299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="P9303_04621"
FT                   /product="Fumarate lyase"
FT                   /EC_number=""
FT                   /note="COG114 Fumarase [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77214"
FT                   /db_xref="GOA:A2C6V4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6V4"
FT                   /protein_id="ABM77214.1"
FT                   LMTSARL"
FT   gene            complement(466458..467753)
FT                   /gene="purB"
FT                   /locus_tag="P9303_04631"
FT   CDS_pept        complement(466458..467753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="P9303_04631"
FT                   /product="Fumarate lyase:Adenylosuccinate lyase"
FT                   /EC_number=""
FT                   /note="COG15 Adenylosuccinate lyase [Nucleotide transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77215"
FT                   /db_xref="GOA:A2C6V5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6V5"
FT                   /protein_id="ABM77215.1"
FT   gene            467691..467807
FT                   /locus_tag="P9303_04641"
FT   CDS_pept        467691..467807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04641"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77216"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6V6"
FT                   /protein_id="ABM77216.1"
FT   gene            complement(467799..468170)
FT                   /locus_tag="P9303_04651"
FT   CDS_pept        complement(467799..468170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77217"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6V7"
FT                   /protein_id="ABM77217.1"
FT   gene            468162..468965
FT                   /locus_tag="P9303_04661"
FT   CDS_pept        468162..468965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04661"
FT                   /product="FtsJ cell division protein:S4 domain:Hemolysin A"
FT                   /note="COG1189 Predicted rRNA methylase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77218"
FT                   /db_xref="GOA:A2C6V8"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6V8"
FT                   /protein_id="ABM77218.1"
FT   gene            complement(468962..469300)
FT                   /gene="glnB"
FT                   /locus_tag="P9303_04671"
FT   CDS_pept        complement(468962..469300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="P9303_04671"
FT                   /product="Nitrogen regulatory protein P-II"
FT                   /note="COG347 Nitrogen regulatory protein PII [Amino acid
FT                   transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77219"
FT                   /db_xref="GOA:A2C6V9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6V9"
FT                   /protein_id="ABM77219.1"
FT                   GDRDSKAL"
FT   gene            complement(469341..469736)
FT                   /locus_tag="P9303_04681"
FT   CDS_pept        complement(469341..469736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04681"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77220"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6W0"
FT                   /protein_id="ABM77220.1"
FT   gene            469925..470062
FT                   /locus_tag="P9303_04691"
FT   CDS_pept        469925..470062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04691"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77221"
FT                   /db_xref="GOA:A2C6W1"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6W1"
FT                   /protein_id="ABM77221.1"
FT                   "
FT   gene            470192..470599
FT                   /locus_tag="P9303_04701"
FT   CDS_pept        470192..470599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04701"
FT                   /product="GTP cyclohydrolase I-like protein"
FT                   /note="COG780 Enzyme related to GTP cyclohydrolase I
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77222"
FT                   /db_xref="GOA:A2C6W2"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6W2"
FT                   /protein_id="ABM77222.1"
FT   gene            complement(470601..471899)
FT                   /gene="resB"
FT                   /locus_tag="P9303_04711"
FT   CDS_pept        complement(470601..471899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="resB"
FT                   /locus_tag="P9303_04711"
FT                   /product="putative c-type cytochrome biogenesis protein
FT                   Ccs1"
FT                   /note="COG1333 ResB protein required for cytochrome c
FT                   biosynthesis [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77223"
FT                   /db_xref="GOA:A2C6W3"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="InterPro:IPR023494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6W3"
FT                   /protein_id="ABM77223.1"
FT   gene            complement(471904..472572)
FT                   /gene="ccdA"
FT                   /locus_tag="P9303_04721"
FT   CDS_pept        complement(471904..472572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="P9303_04721"
FT                   /product="putative c-type cytochrome biogenesis protein
FT                   CcdA"
FT                   /note="COG785 Cytochrome c biogenesis protein
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77224"
FT                   /db_xref="GOA:A2C6W4"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6W4"
FT                   /protein_id="ABM77224.1"
FT                   "
FT   gene            complement(472660..473907)
FT                   /locus_tag="P9303_04731"
FT   CDS_pept        complement(472660..473907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04731"
FT                   /product="Cell division protein FtsW"
FT                   /note="COG772 Bacterial cell division membrane protein
FT                   [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77225"
FT                   /db_xref="GOA:A2C6W5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6W5"
FT                   /protein_id="ABM77225.1"
FT                   GLLGGRSPRQRRQSIG"
FT   gene            complement(474056..474229)
FT                   /locus_tag="P9303_04741"
FT   CDS_pept        complement(474056..474229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04741"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77226"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6W6"
FT                   /protein_id="ABM77226.1"
FT                   STKSNFFLEKRL"
FT   gene            474193..475416
FT                   /locus_tag="P9303_04751"
FT   CDS_pept        474193..475416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04751"
FT                   /product="possible methyltransferase"
FT                   /note="COG2230 Cyclopropane fatty acid synthase and related
FT                   methyltransferases [Cell envelope biogenesis, outer
FT                   membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77227"
FT                   /db_xref="GOA:A2C6W7"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6W7"
FT                   /protein_id="ABM77227.1"
FT                   SPGNVPST"
FT   gene            475311..475931
FT                   /locus_tag="P9303_04761"
FT   CDS_pept        475311..475931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04761"
FT                   /product="possible H+-transporting ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77228"
FT                   /db_xref="GOA:A2C6W8"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6W8"
FT                   /protein_id="ABM77228.1"
FT   gene            475921..476019
FT                   /locus_tag="P9303_04771"
FT   CDS_pept        475921..476019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04771"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77229"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6W9"
FT                   /protein_id="ABM77229.1"
FT                   /translation="MSHELEPNLDQLNCRFAGFSSNRRFLDTEFPA"
FT   gene            476019..476744
FT                   /gene="atpB"
FT                   /locus_tag="P9303_04781"
FT   CDS_pept        476019..476744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="P9303_04781"
FT                   /product="ATP synthase A subunit"
FT                   /EC_number=""
FT                   /note="COG356 F0F1-type ATP synthase, subunit a [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77230"
FT                   /db_xref="GOA:A2C6X0"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6X0"
FT                   /protein_id="ABM77230.1"
FT   gene            476792..477160
FT                   /locus_tag="P9303_04791"
FT   CDS_pept        476792..477160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04791"
FT                   /product="F0F1-type ATP synthase, subunit
FT                   c/Archaeal/vacuolar-type H+-ATPase, subunit K"
FT                   /EC_number=""
FT                   /note="COG636 F0F1-type ATP synthase, subunit
FT                   c/Archaeal/vacuolar-type H+-ATPase, subunit K [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77231"
FT                   /db_xref="GOA:A2C6X1"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6X1"
FT                   /protein_id="ABM77231.1"
FT                   IYGLVVALVLLFANPFAG"
FT   gene            477305..477760
FT                   /locus_tag="P9303_04801"
FT   CDS_pept        477305..477760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04801"
FT                   /product="ATP synthase B/B' CF(0)"
FT                   /EC_number=""
FT                   /note="COG711 F0F1-type ATP synthase, subunit b [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77232"
FT                   /db_xref="GOA:A2C6X2"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="InterPro:IPR034679"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6X2"
FT                   /protein_id="ABM77232.1"
FT   gene            477757..478275
FT                   /locus_tag="P9303_04811"
FT   CDS_pept        477757..478275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04811"
FT                   /product="ATP synthase B/B' CF(0)"
FT                   /EC_number=""
FT                   /note="COG711 F0F1-type ATP synthase, subunit b [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77233"
FT                   /db_xref="GOA:A2C6X3"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6X3"
FT                   /protein_id="ABM77233.1"
FT                   QSIKNLGEA"
FT   gene            478275..478823
FT                   /gene="atpH"
FT                   /locus_tag="P9303_04821"
FT   CDS_pept        478275..478823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="P9303_04821"
FT                   /product="ATP synthase, delta (OSCP) subunit"
FT                   /EC_number=""
FT                   /note="COG712 F0F1-type ATP synthase, delta subunit
FT                   (mitochondrial oligomycin sensitivity protein) [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77234"
FT                   /db_xref="GOA:A2C6X4"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6X4"
FT                   /protein_id="ABM77234.1"
FT   gene            478875..480392
FT                   /gene="atpA"
FT                   /locus_tag="P9303_04831"
FT   CDS_pept        478875..480392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="P9303_04831"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number=""
FT                   /note="COG56 F0F1-type ATP synthase, alpha subunit [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77235"
FT                   /db_xref="GOA:A2C6X5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6X5"
FT                   /protein_id="ABM77235.1"
FT   gene            480423..481373
FT                   /locus_tag="P9303_04841"
FT   CDS_pept        480423..481373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04841"
FT                   /product="ATP synthase gamma subunit"
FT                   /EC_number=""
FT                   /note="COG224 F0F1-type ATP synthase, gamma subunit [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77236"
FT                   /db_xref="GOA:A2C6X6"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6X6"
FT                   /protein_id="ABM77236.1"
FT   gene            complement(481393..481623)
FT                   /locus_tag="P9303_04851"
FT   CDS_pept        complement(481393..481623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04851"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77237"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6X7"
FT                   /protein_id="ABM77237.1"
FT   gene            481712..481891
FT                   /locus_tag="P9303_04861"
FT   CDS_pept        481712..481891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04861"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77238"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6X8"
FT                   /protein_id="ABM77238.1"
FT                   RKLKIEAVVVSSDT"
FT   gene            481904..483031
FT                   /locus_tag="P9303_04871"
FT   CDS_pept        481904..483031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04871"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77239"
FT                   /db_xref="InterPro:IPR021763"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6X9"
FT                   /protein_id="ABM77239.1"
FT   gene            complement(483092..484231)
FT                   /gene="ald"
FT                   /locus_tag="P9303_04881"
FT   CDS_pept        complement(483092..484231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="P9303_04881"
FT                   /product="Alanine dehydrogenase"
FT                   /EC_number=""
FT                   /note="COG686 Alanine dehydrogenase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77240"
FT                   /db_xref="GOA:A2C6Y0"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Y0"
FT                   /protein_id="ABM77240.1"
FT   gene            complement(484294..485988)
FT                   /gene="nadE"
FT                   /locus_tag="P9303_04891"
FT   CDS_pept        complement(484294..485988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="P9303_04891"
FT                   /product="Carbon-nitrogen hydrolase:NAD+ synthase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG171 NAD synthase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77241"
FT                   /db_xref="GOA:A2C6Y1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Y1"
FT                   /protein_id="ABM77241.1"
FT   gene            complement(485988..486572)
FT                   /gene="nadD"
FT                   /locus_tag="P9303_04901"
FT   CDS_pept        complement(485988..486572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="P9303_04901"
FT                   /product="Putative nicotinate-nucleotide
FT                   adenylyltransferase"
FT                   /EC_number=""
FT                   /note="COG1057 Nicotinic acid mononucleotide
FT                   adenylyltransferase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77242"
FT                   /db_xref="GOA:A2C6Y2"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Y2"
FT                   /protein_id="ABM77242.1"
FT   gene            486429..486587
FT                   /locus_tag="P9303_04911"
FT   CDS_pept        486429..486587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04911"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77243"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Y3"
FT                   /protein_id="ABM77243.1"
FT                   LAHGSRV"
FT   gene            complement(486569..487894)
FT                   /locus_tag="P9303_04921"
FT   CDS_pept        complement(486569..487894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04921"
FT                   /product="GTPase SAR1"
FT                   /note="COG1100 GTPase SAR1 and related small G proteins
FT                   [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77244"
FT                   /db_xref="GOA:A2C6Y4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Y4"
FT                   /protein_id="ABM77244.1"
FT   gene            complement(487894..488889)
FT                   /locus_tag="P9303_04931"
FT   CDS_pept        complement(487894..488889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04931"
FT                   /product="Domain of unknown function DUF21"
FT                   /note="COG1253 Hemolysins and related proteins containing
FT                   CBS domains [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77245"
FT                   /db_xref="GOA:A2C6Y5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Y5"
FT                   /protein_id="ABM77245.1"
FT   gene            complement(488886..489194)
FT                   /locus_tag="P9303_04941"
FT   CDS_pept        complement(488886..489194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77246"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Y6"
FT                   /protein_id="ABM77246.1"
FT   gene            489138..490415
FT                   /gene="pepP"
FT                   /locus_tag="P9303_04951"
FT   CDS_pept        489138..490415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="P9303_04951"
FT                   /product="putative aminopeptidase P"
FT                   /EC_number=""
FT                   /note="COG6 Xaa-Pro aminopeptidase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77247"
FT                   /db_xref="GOA:A2C6Y7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Y7"
FT                   /protein_id="ABM77247.1"
FT   gene            490480..490746
FT                   /locus_tag="P9303_04961"
FT   CDS_pept        490480..490746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04961"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77248"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="InterPro:IPR022516"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Y8"
FT                   /protein_id="ABM77248.1"
FT   gene            complement(490932..491675)
FT                   /locus_tag="P9303_04971"
FT   CDS_pept        complement(490932..491675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04971"
FT                   /product="putative imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number=""
FT                   /note="COG546 Predicted phosphatases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77249"
FT                   /db_xref="GOA:A2C6Y9"
FT                   /db_xref="InterPro:IPR006438"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Y9"
FT                   /protein_id="ABM77249.1"
FT   gene            491619..491747
FT                   /locus_tag="P9303_04981"
FT   CDS_pept        491619..491747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04981"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77250"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Z0"
FT                   /protein_id="ABM77250.1"
FT   gene            491885..492334
FT                   /locus_tag="P9303_04991"
FT   CDS_pept        491885..492334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_04991"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_04991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77251"
FT                   /db_xref="GOA:A2C6Z1"
FT                   /db_xref="InterPro:IPR006924"
FT                   /db_xref="InterPro:IPR038447"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Z1"
FT                   /protein_id="ABM77251.1"
FT   gene            complement(492438..493109)
FT                   /gene="mipB"
FT                   /locus_tag="P9303_05001"
FT   CDS_pept        complement(492438..493109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mipB"
FT                   /locus_tag="P9303_05001"
FT                   /product="Putative fructose-6-phosphate aldolase (FSA)"
FT                   /note="COG176 Transaldolase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77252"
FT                   /db_xref="GOA:A2C6Z2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Z2"
FT                   /protein_id="ABM77252.1"
FT                   A"
FT   gene            complement(493143..493544)
FT                   /gene="atpC"
FT                   /locus_tag="P9303_05011"
FT   CDS_pept        complement(493143..493544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="P9303_05011"
FT                   /product="ATP synthase, Epsilon subunit"
FT                   /EC_number=""
FT                   /note="COG355 F0F1-type ATP synthase, epsilon subunit
FT                   (mitochondrial delta subunit) [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77253"
FT                   /db_xref="GOA:A2C6Z3"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6Z3"
FT                   /protein_id="ABM77253.1"
FT   gene            complement(493629..495227)
FT                   /gene="atpD"
FT                   /locus_tag="P9303_05021"
FT   CDS_pept        complement(493629..495227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="P9303_05021"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number=""
FT                   /note="COG55 F0F1-type ATP synthase, beta subunit [Energy
FT                   production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77254"
FT                   /db_xref="GOA:A2C6Z4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6Z4"
FT                   /protein_id="ABM77254.1"
FT                   EVKAKAEKIASEAKG"
FT   gene            495134..495634
FT                   /locus_tag="P9303_05031"
FT   CDS_pept        495134..495634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05031"
FT                   /product="Hypothetical protein"
FT                   /note="COG234 Co-chaperonin GroES (HSP10)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77255"
FT                   /db_xref="GOA:A2C6Z5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Z5"
FT                   /protein_id="ABM77255.1"
FT                   VVN"
FT   gene            495716..497350
FT                   /gene="groEL"
FT                   /locus_tag="P9303_05041"
FT   CDS_pept        495716..497350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="P9303_05041"
FT                   /product="GroEL protein (Chaperonin cpn60)"
FT                   /EC_number=""
FT                   /note="COG459 Chaperonin GroEL (HSP60 family)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77256"
FT                   /db_xref="GOA:A2C6Z6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C6Z6"
FT                   /protein_id="ABM77256.1"
FT   gene            complement(497567..498067)
FT                   /locus_tag="P9303_05051"
FT   CDS_pept        complement(497567..498067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77257"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Z7"
FT                   /protein_id="ABM77257.1"
FT                   AMS"
FT   gene            complement(498184..498474)
FT                   /locus_tag="P9303_05061"
FT   CDS_pept        complement(498184..498474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05061"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77258"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Z8"
FT                   /protein_id="ABM77258.1"
FT   gene            complement(499213..499443)
FT                   /gene="secG"
FT                   /locus_tag="P9303_05071"
FT   CDS_pept        complement(499213..499443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="P9303_05071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77259"
FT                   /db_xref="GOA:A2C6Z9"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A2C6Z9"
FT                   /protein_id="ABM77259.1"
FT   gene            complement(499501..501123)
FT                   /gene="gpmI"
FT                   /locus_tag="P9303_05081"
FT   CDS_pept        complement(499501..501123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="P9303_05081"
FT                   /product="Phosphoglycerate mutase, co-factor-independent
FT                   (iPGM)"
FT                   /EC_number="5.4.2.-"
FT                   /note="COG696 Phosphoglyceromutase [Carbohydrate transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77260"
FT                   /db_xref="GOA:A2C700"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C700"
FT                   /protein_id="ABM77260.1"
FT   gene            501287..501838
FT                   /gene="pyrR"
FT                   /locus_tag="P9303_05091"
FT   CDS_pept        501287..501838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrR"
FT                   /locus_tag="P9303_05091"
FT                   /product="Phosphoribosyl transferase"
FT                   /EC_number=""
FT                   /note="COG2065 Pyrimidine operon attenuation protein/uracil
FT                   phosphoribosyltransferase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77261"
FT                   /db_xref="GOA:A2C701"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A2C701"
FT                   /protein_id="ABM77261.1"
FT   gene            complement(501969..503594)
FT                   /locus_tag="P9303_05101"
FT   CDS_pept        complement(501969..503594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05101"
FT                   /product="putative DnaK-type molecular chaperone (HSP70
FT                   family)"
FT                   /note="COG443 Molecular chaperone [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77262"
FT                   /db_xref="GOA:A2C702"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:A2C702"
FT                   /protein_id="ABM77262.1"
FT   gene            503629..503919
FT                   /locus_tag="P9303_05111"
FT   CDS_pept        503629..503919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05111"
FT                   /product="possible Ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77263"
FT                   /db_xref="GOA:A2C703"
FT                   /db_xref="UniProtKB/TrEMBL:A2C703"
FT                   /protein_id="ABM77263.1"
FT   gene            503983..504195
FT                   /gene="rpoZ"
FT                   /locus_tag="P9303_05121"
FT   CDS_pept        503983..504195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="P9303_05121"
FT                   /product="putative DNA-directed RNA polymerase (omega
FT                   chain)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77264"
FT                   /db_xref="GOA:A2C704"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:A2C704"
FT                   /protein_id="ABM77264.1"
FT   gene            complement(504050..504574)
FT                   /locus_tag="P9303_05131"
FT   CDS_pept        complement(504050..504574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05131"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77265"
FT                   /db_xref="UniProtKB/TrEMBL:A2C705"
FT                   /protein_id="ABM77265.1"
FT                   GAASPETQLEP"
FT   gene            504197..504577
FT                   /locus_tag="P9303_05141"
FT   CDS_pept        504197..504577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77266"
FT                   /db_xref="GOA:A2C706"
FT                   /db_xref="InterPro:IPR009044"
FT                   /db_xref="InterPro:IPR014947"
FT                   /db_xref="UniProtKB/TrEMBL:A2C706"
FT                   /protein_id="ABM77266.1"
FT   gene            complement(504704..504884)
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362603"
FT                   /note="frameshift; Pseudogene derived from P9313_18171"
FT   gene            504891..505208
FT                   /locus_tag="P9303_05151"
FT   CDS_pept        504891..505208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77267"
FT                   /db_xref="InterPro:IPR021231"
FT                   /db_xref="UniProtKB/TrEMBL:A2C707"
FT                   /protein_id="ABM77267.1"
FT                   F"
FT   gene            complement(505361..505837)
FT                   /locus_tag="P9303_05161"
FT   CDS_pept        complement(505361..505837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05161"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="COG2947 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77268"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A2C708"
FT                   /protein_id="ABM77268.1"
FT   gene            505990..506631
FT                   /locus_tag="P9303_05171"
FT   CDS_pept        505990..506631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05171"
FT                   /product="possible Mannitol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77269"
FT                   /db_xref="GOA:A2C709"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:A2C709"
FT                   /protein_id="ABM77269.1"
FT   gene            506696..507619
FT                   /locus_tag="P9303_05181"
FT   CDS_pept        506696..507619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05181"
FT                   /product="AEC transporter family, substrate unknown"
FT                   /note="COG679 Predicted permeases [General function
FT                   prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77270"
FT                   /db_xref="GOA:A2C710"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A2C710"
FT                   /protein_id="ABM77270.1"
FT   gene            507750..508022
FT                   /locus_tag="P9303_05191"
FT   CDS_pept        507750..508022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77271"
FT                   /db_xref="InterPro:IPR025149"
FT                   /db_xref="UniProtKB/TrEMBL:A2C711"
FT                   /protein_id="ABM77271.1"
FT   gene            508204..508725
FT                   /locus_tag="P9303_05201"
FT   CDS_pept        508204..508725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77272"
FT                   /db_xref="UniProtKB/TrEMBL:A2C712"
FT                   /protein_id="ABM77272.1"
FT                   GGGLALWLKG"
FT   gene            complement(508880..510262)
FT                   /gene="murD"
FT                   /locus_tag="P9303_05211"
FT   CDS_pept        complement(508880..510262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="P9303_05211"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number=""
FT                   /note="COG771 UDP-N-acetylmuramoylalanine-D-glutamate
FT                   ligase [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77273"
FT                   /db_xref="GOA:A2C713"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A2C713"
FT                   /protein_id="ABM77273.1"
FT                   TA"
FT   gene            complement(510290..510361)
FT                   /locus_tag="P9303_tRNAValVIMSS1309269"
FT                   /note="tRNA-Val"
FT   tRNA            complement(510290..510361)
FT                   /locus_tag="P9303_tRNAValVIMSS1309269"
FT                   /product="tRNA-Val"
FT   gene            complement(510440..511327)
FT                   /locus_tag="P9303_05221"
FT   CDS_pept        complement(510440..511327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05221"
FT                   /product="Uncharacterized conserved protein, contains
FT                   S4-like domain"
FT                   /note="COG2302 Uncharacterized conserved protein, contains
FT                   S4-like domain [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77274"
FT                   /db_xref="GOA:A2C714"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR017506"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A2C714"
FT                   /protein_id="ABM77274.1"
FT                   MTKRQRWRVEMLRH"
FT   gene            complement(511228..511794)
FT                   /locus_tag="P9303_05231"
FT   CDS_pept        complement(511228..511794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77275"
FT                   /db_xref="GOA:A2C715"
FT                   /db_xref="UniProtKB/TrEMBL:A2C715"
FT                   /protein_id="ABM77275.1"
FT   gene            511898..513484
FT                   /gene="serA"
FT                   /locus_tag="P9303_05241"
FT   CDS_pept        511898..513484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="P9303_05241"
FT                   /product="putative D-3-phosphoglycerate dehydrogenase
FT                   (PGDH)"
FT                   /EC_number=""
FT                   /note="COG111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77276"
FT                   /db_xref="GOA:A2C716"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C716"
FT                   /protein_id="ABM77276.1"
FT                   NGIKEAHPVTL"
FT   gene            513499..514404
FT                   /gene="prmA"
FT                   /locus_tag="P9303_05251"
FT   CDS_pept        513499..514404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="P9303_05251"
FT                   /product="putative methyltransferase for Ribosomal protein
FT                   L11"
FT                   /note="COG2264 Ribosomal protein L11 methylase
FT                   [Translation, ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77277"
FT                   /db_xref="GOA:A2C717"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C717"
FT                   /protein_id="ABM77277.1"
FT   gene            514569..514868
FT                   /locus_tag="P9303_05261"
FT   CDS_pept        514569..514868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05261"
FT                   /product="ferredoxin"
FT                   /note="COG633 Ferredoxin [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77278"
FT                   /db_xref="GOA:A2C718"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR010241"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A2C718"
FT                   /protein_id="ABM77278.1"
FT   gene            514946..515401
FT                   /locus_tag="P9303_05271"
FT   CDS_pept        514946..515401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05271"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77279"
FT                   /db_xref="UniProtKB/TrEMBL:A2C719"
FT                   /protein_id="ABM77279.1"
FT   gene            515417..515620
FT                   /locus_tag="P9303_05281"
FT   CDS_pept        515417..515620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05281"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77280"
FT                   /db_xref="UniProtKB/TrEMBL:A2C720"
FT                   /protein_id="ABM77280.1"
FT   gene            515796..515957
FT                   /locus_tag="P9303_05291"
FT   CDS_pept        515796..515957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05291"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77281"
FT                   /db_xref="UniProtKB/TrEMBL:A2C721"
FT                   /protein_id="ABM77281.1"
FT                   LRHALPCD"
FT   gene            516087..516275
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362604"
FT                   /note="Pseudogene derived from P9313_18021"
FT   gene            complement(516287..516484)
FT                   /locus_tag="P9303_05301"
FT   CDS_pept        complement(516287..516484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05301"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77282"
FT                   /db_xref="UniProtKB/TrEMBL:A2C722"
FT                   /protein_id="ABM77282.1"
FT   gene            complement(516648..517160)
FT                   /gene="psbV"
FT                   /locus_tag="P9303_05311"
FT   CDS_pept        complement(516648..517160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbV"
FT                   /locus_tag="P9303_05311"
FT                   /product="Cytochrome c-550"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77283"
FT                   /db_xref="GOA:A2C723"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR016003"
FT                   /db_xref="InterPro:IPR017851"
FT                   /db_xref="InterPro:IPR029490"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C723"
FT                   /protein_id="ABM77283.1"
FT                   GGGKIYF"
FT   gene            517066..517179
FT                   /locus_tag="P9303_05321"
FT   CDS_pept        517066..517179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05321"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77284"
FT                   /db_xref="UniProtKB/TrEMBL:A2C724"
FT                   /protein_id="ABM77284.1"
FT   gene            complement(517230..518186)
FT                   /gene="elaC"
FT                   /locus_tag="P9303_05331"
FT   CDS_pept        complement(517230..518186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="elaC"
FT                   /locus_tag="P9303_05331"
FT                   /product="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily III"
FT                   /EC_number=""
FT                   /note="COG1234 Metal-dependent hydrolases of the
FT                   beta-lactamase superfamily III [General function prediction
FT                   only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77285"
FT                   /db_xref="GOA:A2C725"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C725"
FT                   /protein_id="ABM77285.1"
FT   gene            518209..518346
FT                   /locus_tag="P9303_05341"
FT   CDS_pept        518209..518346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05341"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77286"
FT                   /db_xref="UniProtKB/TrEMBL:A2C726"
FT                   /protein_id="ABM77286.1"
FT                   "
FT   gene            518310..519728
FT                   /locus_tag="P9303_05351"
FT   CDS_pept        518310..519728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05351"
FT                   /product="possible sporulation protein SpoIID"
FT                   /note="COG2385 Sporulation protein and related proteins
FT                   [Cell division and chromosome partitioning]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77287"
FT                   /db_xref="GOA:A2C727"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:A2C727"
FT                   /protein_id="ABM77287.1"
FT                   RSRQPGGVERMGGA"
FT   gene            519729..520553
FT                   /locus_tag="P9303_05361"
FT   CDS_pept        519729..520553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05361"
FT                   /product="6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase"
FT                   /EC_number=""
FT                   /note="COG363
FT                   6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77288"
FT                   /db_xref="GOA:A2C728"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A2C728"
FT                   /protein_id="ABM77288.1"
FT   gene            520888..520974
FT                   /locus_tag="P9303_05371"
FT   CDS_pept        520888..520974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05371"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77289"
FT                   /db_xref="UniProtKB/TrEMBL:A2C729"
FT                   /protein_id="ABM77289.1"
FT                   /translation="MYGRGGLEFWDANRGTDWRASGGVTFQF"
FT   gene            complement(521119..521865)
FT                   /locus_tag="P9303_05381"
FT   CDS_pept        complement(521119..521865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05381"
FT                   /product="Uncharacterized conserved protein"
FT                   /EC_number=""
FT                   /note="COG217 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77290"
FT                   /db_xref="GOA:A2C730"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C730"
FT                   /protein_id="ABM77290.1"
FT   gene            complement(521937..522908)
FT                   /gene="truB"
FT                   /locus_tag="P9303_05391"
FT   CDS_pept        complement(521937..522908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="P9303_05391"
FT                   /product="Putative tRNA pseudouridine 55 synthase"
FT                   /EC_number=""
FT                   /note="COG130 Pseudouridine synthase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77291"
FT                   /db_xref="GOA:A2C731"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:A2C731"
FT                   /protein_id="ABM77291.1"
FT   gene            complement(522978..523244)
FT                   /gene="rpmA"
FT                   /locus_tag="P9303_05401"
FT   CDS_pept        complement(522978..523244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="P9303_05401"
FT                   /product="50S ribosomal protein L27"
FT                   /note="COG211 Ribosomal protein L27 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77292"
FT                   /db_xref="GOA:A2C732"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C732"
FT                   /protein_id="ABM77292.1"
FT   gene            complement(523287..523688)
FT                   /gene="rplU"
FT                   /locus_tag="P9303_05411"
FT   CDS_pept        complement(523287..523688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="P9303_05411"
FT                   /product="50S ribosomal protein L21"
FT                   /note="COG261 Ribosomal protein L21 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77293"
FT                   /db_xref="GOA:A2C733"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C733"
FT                   /protein_id="ABM77293.1"
FT   gene            complement(524011..524208)
FT                   /locus_tag="P9303_05421"
FT   CDS_pept        complement(524011..524208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05421"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77294"
FT                   /db_xref="UniProtKB/TrEMBL:A2C734"
FT                   /protein_id="ABM77294.1"
FT   gene            524358..524717
FT                   /gene="kaiB"
FT                   /locus_tag="P9303_05431"
FT   CDS_pept        524358..524717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiB"
FT                   /locus_tag="P9303_05431"
FT                   /product="possible circadian oscillation regulator KaiB"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77295"
FT                   /db_xref="GOA:A2C735"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR013474"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039022"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C735"
FT                   /protein_id="ABM77295.1"
FT                   ELDTLADDDIASPDS"
FT   gene            524817..526283
FT                   /gene="kaiC"
FT                   /locus_tag="P9303_05441"
FT   CDS_pept        524817..526283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiC"
FT                   /locus_tag="P9303_05441"
FT                   /product="possible circadian clock protein KaiC"
FT                   /note="COG467 RecA-superfamily ATPases implicated in signal
FT                   transduction [Signal transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77296"
FT                   /db_xref="GOA:A2C736"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR013503"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:A2C736"
FT                   /protein_id="ABM77296.1"
FT   gene            complement(526341..528398)
FT                   /gene="nblS"
FT                   /locus_tag="P9303_05451"
FT   CDS_pept        complement(526341..528398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nblS"
FT                   /locus_tag="P9303_05451"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="COG5002 Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77297"
FT                   /db_xref="GOA:A2C737"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A2C737"
FT                   /protein_id="ABM77297.1"
FT   gene            complement(528423..529739)
FT                   /gene="purD"
FT                   /locus_tag="P9303_05461"
FT   CDS_pept        complement(528423..529739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="P9303_05461"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /EC_number=""
FT                   /note="COG151 Phosphoribosylamine-glycine ligase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77298"
FT                   /db_xref="GOA:A2C738"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A2C738"
FT                   /protein_id="ABM77298.1"
FT   gene            529840..530838
FT                   /locus_tag="P9303_05471"
FT   CDS_pept        529840..530838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77299"
FT                   /db_xref="UniProtKB/TrEMBL:A2C739"
FT                   /protein_id="ABM77299.1"
FT   gene            530835..531563
FT                   /gene="purC"
FT                   /locus_tag="P9303_05481"
FT   CDS_pept        530835..531563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="P9303_05481"
FT                   /product="SAICAR synthetase"
FT                   /EC_number=""
FT                   /note="COG152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77300"
FT                   /db_xref="GOA:A2C740"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C740"
FT                   /protein_id="ABM77300.1"
FT   gene            531633..533921
FT                   /locus_tag="P9303_05491"
FT   CDS_pept        531633..533921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05491"
FT                   /product="outer envelope membrane protein"
FT                   /note="chloroplast outer envelope membrane protein-like
FT                   protein; COG4775 Outer membrane protein/protective antigen
FT                   OMA87 [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77301"
FT                   /db_xref="GOA:A2C741"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A2C741"
FT                   /protein_id="ABM77301.1"
FT                   FNLGVGWKF"
FT   gene            533921..534778
FT                   /gene="lpxC"
FT                   /locus_tag="P9303_05501"
FT   CDS_pept        533921..534778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="P9303_05501"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /note="COG774 UDP-3-O-acyl-N-acetylglucosamine deacetylase
FT                   [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77302"
FT                   /db_xref="GOA:A2C742"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A2C742"
FT                   /protein_id="ABM77302.1"
FT                   VTVS"
FT   gene            534823..535230
FT                   /gene="fabZ"
FT                   /locus_tag="P9303_05511"
FT   CDS_pept        534823..535230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="P9303_05511"
FT                   /product="Putative (3R)-hydroxymyristoyl-[acyl carrier
FT                   protein] dehydratase"
FT                   /EC_number=""
FT                   /note="COG764 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratases [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77303"
FT                   /db_xref="GOA:A2C743"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A2C743"
FT                   /protein_id="ABM77303.1"
FT   gene            535236..536087
FT                   /gene="lpxA"
FT                   /locus_tag="P9303_05521"
FT   CDS_pept        535236..536087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="P9303_05521"
FT                   /product="UDP-N-acetylglucosamine acyltransferase"
FT                   /EC_number=""
FT                   /note="COG1043 Acyl-[acyl carrier protein]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77304"
FT                   /db_xref="GOA:A2C744"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="UniProtKB/TrEMBL:A2C744"
FT                   /protein_id="ABM77304.1"
FT                   SR"
FT   gene            536087..537265
FT                   /gene="lpxB"
FT                   /locus_tag="P9303_05531"
FT   CDS_pept        536087..537265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="P9303_05531"
FT                   /product="Lipid-A-disaccharide synthetase"
FT                   /EC_number=""
FT                   /note="COG763 Lipid A disaccharide synthetase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77305"
FT                   /db_xref="GOA:A2C745"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C745"
FT                   /protein_id="ABM77305.1"
FT   gene            537262..537933
FT                   /locus_tag="P9303_05541"
FT   CDS_pept        537262..537933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05541"
FT                   /product="Peptide methionine sulfoxide reductase"
FT                   /EC_number=""
FT                   /note="COG225 Peptide methionine sulfoxide reductase
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77306"
FT                   /db_xref="GOA:A2C746"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A2C746"
FT                   /protein_id="ABM77306.1"
FT                   K"
FT   gene            538046..538258
FT                   /locus_tag="P9303_05551"
FT   CDS_pept        538046..538258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05551"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77307"
FT                   /db_xref="UniProtKB/TrEMBL:A2C747"
FT                   /protein_id="ABM77307.1"
FT   gene            538292..538513
FT                   /locus_tag="P9303_05561"
FT   CDS_pept        538292..538513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05561"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77308"
FT                   /db_xref="UniProtKB/TrEMBL:A2C748"
FT                   /protein_id="ABM77308.1"
FT   gene            complement(538563..540083)
FT                   /gene="pepB"
FT                   /locus_tag="P9303_05571"
FT   CDS_pept        complement(538563..540083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepB"
FT                   /locus_tag="P9303_05571"
FT                   /product="Cytosol aminopeptidase"
FT                   /EC_number=""
FT                   /note="COG260 Leucyl aminopeptidase [Amino acid transport
FT                   and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77309"
FT                   /db_xref="GOA:A2C749"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:A2C749"
FT                   /protein_id="ABM77309.1"
FT   gene            complement(540074..540670)
FT                   /locus_tag="P9303_05581"
FT   CDS_pept        complement(540074..540670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77310"
FT                   /db_xref="UniProtKB/TrEMBL:A2C750"
FT                   /protein_id="ABM77310.1"
FT   gene            complement(540790..541515)
FT                   /locus_tag="P9303_05591"
FT   CDS_pept        complement(540790..541515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05591"
FT                   /product="possible DNA-binding response regulator"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain [Signal
FT                   transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77311"
FT                   /db_xref="GOA:A2C751"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A2C751"
FT                   /protein_id="ABM77311.1"
FT   gene            541632..541958
FT                   /locus_tag="P9303_05601"
FT   CDS_pept        541632..541958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77312"
FT                   /db_xref="InterPro:IPR014954"
FT                   /db_xref="UniProtKB/TrEMBL:A2C752"
FT                   /protein_id="ABM77312.1"
FT                   QDSR"
FT   gene            542039..543265
FT                   /gene="tyrS"
FT                   /locus_tag="P9303_05611"
FT   CDS_pept        542039..543265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="P9303_05611"
FT                   /product="Tyrosyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG162 Tyrosyl-tRNA synthetase [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77313"
FT                   /db_xref="GOA:A2C753"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A2C753"
FT                   /protein_id="ABM77313.1"
FT                   KKTFRRLTR"
FT   gene            543286..544026
FT                   /gene="pyrF"
FT                   /locus_tag="P9303_05621"
FT   CDS_pept        543286..544026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="P9303_05621"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number=""
FT                   /note="COG284 Orotidine-5'-phosphate decarboxylase
FT                   [Nucleotide transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77314"
FT                   /db_xref="GOA:A2C754"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:A2C754"
FT                   /protein_id="ABM77314.1"
FT   gene            complement(544014..544631)
FT                   /locus_tag="P9303_05631"
FT   CDS_pept        complement(544014..544631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05631"
FT                   /product="Predicted membrane protein"
FT                   /note="COG344 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77315"
FT                   /db_xref="GOA:A2C755"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:A2C755"
FT                   /protein_id="ABM77315.1"
FT   gene            complement(544631..545677)
FT                   /locus_tag="P9303_05641"
FT   CDS_pept        complement(544631..545677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77316"
FT                   /db_xref="InterPro:IPR021437"
FT                   /db_xref="UniProtKB/TrEMBL:A2C756"
FT                   /protein_id="ABM77316.1"
FT                   RFEDEELL"
FT   gene            complement(545670..545807)
FT                   /locus_tag="P9303_05651"
FT   CDS_pept        complement(545670..545807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05651"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77317"
FT                   /db_xref="UniProtKB/TrEMBL:A2C757"
FT                   /protein_id="ABM77317.1"
FT                   "
FT   gene            545692..545835
FT                   /locus_tag="P9303_05661"
FT   CDS_pept        545692..545835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05661"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77318"
FT                   /db_xref="UniProtKB/TrEMBL:A2C758"
FT                   /protein_id="ABM77318.1"
FT                   GP"
FT   gene            complement(545841..546587)
FT                   /locus_tag="P9303_05671"
FT   CDS_pept        complement(545841..546587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05671"
FT                   /product="possible transporter, membrane component"
FT                   /note="COG767 ABC-type transport system involved in
FT                   resistance to organic solvents, permease component
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77319"
FT                   /db_xref="GOA:A2C759"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A2C759"
FT                   /protein_id="ABM77319.1"
FT   gene            complement(546584..548026)
FT                   /gene="melB"
FT                   /locus_tag="P9303_05681"
FT   CDS_pept        complement(546584..548026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="melB"
FT                   /locus_tag="P9303_05681"
FT                   /product="putative GPH family sugar transporter"
FT                   /note="COG2211 Na+/melibiose symporter and related
FT                   transporters [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77320"
FT                   /db_xref="GOA:A2C760"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A2C760"
FT                   /protein_id="ABM77320.1"
FT   gene            548075..548145
FT                   /locus_tag="P9303_tRNAGlyVIMSS1309292"
FT                   /note="tRNA-Gly"
FT   tRNA            548075..548145
FT                   /locus_tag="P9303_tRNAGlyVIMSS1309292"
FT                   /product="tRNA-Gly"
FT   gene            complement(548162..550276)
FT                   /gene="glgX"
FT                   /locus_tag="P9303_05691"
FT   CDS_pept        complement(548162..550276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="P9303_05691"
FT                   /product="Putative isoamylase"
FT                   /EC_number=""
FT                   /note="COG1523 Type II secretory pathway, pullulanase PulA
FT                   and related glycosidases [Carbohydrate transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77321"
FT                   /db_xref="GOA:A2C761"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A2C761"
FT                   /protein_id="ABM77321.1"
FT                   AEEYASKLKL"
FT   gene            550309..550965
FT                   /locus_tag="P9303_05701"
FT   CDS_pept        550309..550965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05701"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77322"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A2C762"
FT                   /protein_id="ABM77322.1"
FT   gene            551125..551400
FT                   /gene="himA"
FT                   /locus_tag="P9303_05711"
FT   CDS_pept        551125..551400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="himA"
FT                   /locus_tag="P9303_05711"
FT                   /product="Bacterial histone-like DNA-binding protein"
FT                   /note="COG776 Bacterial nucleoid DNA-binding protein [DNA
FT                   replication, recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77323"
FT                   /db_xref="GOA:A2C763"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A2C763"
FT                   /protein_id="ABM77323.1"
FT   gene            551489..552409
FT                   /locus_tag="P9303_05721"
FT   CDS_pept        551489..552409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05721"
FT                   /product="Glutamyl/Glutaminyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77324"
FT                   /db_xref="GOA:A2C764"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C764"
FT                   /protein_id="ABM77324.1"
FT   gene            552500..552697
FT                   /locus_tag="P9303_05731"
FT   CDS_pept        552500..552697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05731"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77325"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="UniProtKB/TrEMBL:A2C765"
FT                   /protein_id="ABM77325.1"
FT   gene            552958..553104
FT                   /locus_tag="P9303_05741"
FT   CDS_pept        552958..553104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05741"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77326"
FT                   /db_xref="UniProtKB/TrEMBL:A2C766"
FT                   /protein_id="ABM77326.1"
FT                   RIS"
FT   gene            553019..553144
FT                   /locus_tag="P9303_05751"
FT   CDS_pept        553019..553144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05751"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77327"
FT                   /db_xref="UniProtKB/TrEMBL:A2C767"
FT                   /protein_id="ABM77327.1"
FT   gene            553166..553678
FT                   /locus_tag="P9303_05761"
FT   CDS_pept        553166..553678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05761"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77328"
FT                   /db_xref="UniProtKB/TrEMBL:A2C768"
FT                   /protein_id="ABM77328.1"
FT                   IGPITPR"
FT   gene            complement(553871..555574)
FT                   /locus_tag="P9303_05771"
FT   CDS_pept        complement(553871..555574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05771"
FT                   /product="conserved hypotheical protein"
FT                   /note="COG397 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05771"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77329"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:A2C769"
FT                   /protein_id="ABM77329.1"
FT   gene            555907..556128
FT                   /locus_tag="P9303_05781"
FT   CDS_pept        555907..556128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05781"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05781"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77330"
FT                   /db_xref="UniProtKB/TrEMBL:A2C770"
FT                   /protein_id="ABM77330.1"
FT   gene            556121..556321
FT                   /locus_tag="P9303_05791"
FT   CDS_pept        556121..556321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05791"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05791"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77331"
FT                   /db_xref="UniProtKB/TrEMBL:A2C771"
FT                   /protein_id="ABM77331.1"
FT   gene            556474..556734
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362605"
FT                   /note="Pseudogene derived from P9313_17511"
FT   gene            556736..556942
FT                   /locus_tag="P9303_05801"
FT   CDS_pept        556736..556942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05801"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05801"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77332"
FT                   /db_xref="GOA:A2C772"
FT                   /db_xref="UniProtKB/TrEMBL:A2C772"
FT                   /protein_id="ABM77332.1"
FT   gene            557371..557526
FT                   /locus_tag="P9303_05811"
FT   CDS_pept        557371..557526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05811"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05811"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77333"
FT                   /db_xref="UniProtKB/TrEMBL:A2C773"
FT                   /protein_id="ABM77333.1"
FT                   RLESPS"
FT   gene            complement(557563..557676)
FT                   /locus_tag="P9303_05821"
FT   CDS_pept        complement(557563..557676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05821"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05821"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77334"
FT                   /db_xref="UniProtKB/TrEMBL:A2C774"
FT                   /protein_id="ABM77334.1"
FT   gene            557752..557889
FT                   /locus_tag="P9303_05831"
FT   CDS_pept        557752..557889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05831"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05831"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77335"
FT                   /db_xref="UniProtKB/TrEMBL:A2C775"
FT                   /protein_id="ABM77335.1"
FT                   "
FT   gene            557936..558283
FT                   /locus_tag="P9303_05841"
FT   CDS_pept        557936..558283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05841"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05841"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77336"
FT                   /db_xref="UniProtKB/TrEMBL:A2C776"
FT                   /protein_id="ABM77336.1"
FT                   LEEVSNSCRGL"
FT   gene            558410..558589
FT                   /locus_tag="P9303_05851"
FT   CDS_pept        558410..558589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05851"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05851"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77337"
FT                   /db_xref="UniProtKB/TrEMBL:A2C777"
FT                   /protein_id="ABM77337.1"
FT                   SYTAFGVITSFAAA"
FT   gene            558965..559156
FT                   /locus_tag="P9303_05861"
FT   CDS_pept        558965..559156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05861"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05861"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77338"
FT                   /db_xref="GOA:A2C778"
FT                   /db_xref="UniProtKB/TrEMBL:A2C778"
FT                   /protein_id="ABM77338.1"
FT                   VALWFLTAIGLISWNFSE"
FT   gene            complement(559310..559504)
FT                   /locus_tag="P9303_05871"
FT   CDS_pept        complement(559310..559504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05871"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05871"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77339"
FT                   /db_xref="UniProtKB/TrEMBL:A2C779"
FT                   /protein_id="ABM77339.1"
FT   gene            559358..559633
FT                   /locus_tag="P9303_05881"
FT   CDS_pept        559358..559633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05881"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77340"
FT                   /db_xref="UniProtKB/TrEMBL:A2C780"
FT                   /protein_id="ABM77340.1"
FT   gene            complement(560104..560856)
FT                   /locus_tag="P9303_05891"
FT   CDS_pept        complement(560104..560856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05891"
FT                   /product="Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold"
FT                   /note="COG2220 Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05891"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77341"
FT                   /db_xref="GOA:A2C781"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A2C781"
FT                   /protein_id="ABM77341.1"
FT   gene            complement(560863..561111)
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362606"
FT                   /note="Pseudogene derived from P9313_17391"
FT   gene            561634..561966
FT                   /locus_tag="P9303_05901"
FT   CDS_pept        561634..561966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05901"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05901"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77342"
FT                   /db_xref="GOA:A2C782"
FT                   /db_xref="UniProtKB/TrEMBL:A2C782"
FT                   /protein_id="ABM77342.1"
FT                   LSRSGG"
FT   gene            complement(562031..562216)
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362607"
FT                   /note="Pseudogene derived from P9313_17371"
FT   gene            562221..562370
FT                   /locus_tag="P9303_05911"
FT   CDS_pept        562221..562370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05911"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05911"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77343"
FT                   /db_xref="UniProtKB/TrEMBL:A2C783"
FT                   /protein_id="ABM77343.1"
FT                   QTNL"
FT   gene            complement(562367..562612)
FT                   /locus_tag="P9303_05921"
FT   CDS_pept        complement(562367..562612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05921"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05921"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77344"
FT                   /db_xref="UniProtKB/TrEMBL:A2C784"
FT                   /protein_id="ABM77344.1"
FT   gene            complement(562590..562772)
FT                   /locus_tag="P9303_05931"
FT   CDS_pept        complement(562590..562772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05931"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05931"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77345"
FT                   /db_xref="UniProtKB/TrEMBL:A2C785"
FT                   /protein_id="ABM77345.1"
FT                   VIAVVTTTCALWCGH"
FT   gene            complement(562996..563274)
FT                   /locus_tag="P9303_05941"
FT   CDS_pept        complement(562996..563274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05941"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05941"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77346"
FT                   /db_xref="UniProtKB/TrEMBL:A2C786"
FT                   /protein_id="ABM77346.1"
FT   gene            complement(563586..564050)
FT                   /locus_tag="P9303_05951"
FT   CDS_pept        complement(563586..564050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05951"
FT                   /product="Hypothetical protein"
FT                   /note="COG432 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05951"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77347"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A2C787"
FT                   /protein_id="ABM77347.1"
FT   gene            564334..564678
FT                   /locus_tag="P9303_05961"
FT   CDS_pept        564334..564678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05961"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05961"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77348"
FT                   /db_xref="GOA:A2C788"
FT                   /db_xref="UniProtKB/TrEMBL:A2C788"
FT                   /protein_id="ABM77348.1"
FT                   VEEKDNNGQS"
FT   gene            complement(564759..565016)
FT                   /locus_tag="P9303_05971"
FT   CDS_pept        complement(564759..565016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05971"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05971"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77349"
FT                   /db_xref="UniProtKB/TrEMBL:A2C789"
FT                   /protein_id="ABM77349.1"
FT   gene            complement(565242..565315)
FT                   /locus_tag="P9303_tRNAArgVIMSS1309268"
FT                   /note="tRNA-Arg"
FT   tRNA            complement(565242..565315)
FT                   /locus_tag="P9303_tRNAArgVIMSS1309268"
FT                   /product="tRNA-Arg"
FT   gene            565383..566207
FT                   /locus_tag="P9303_05981"
FT   CDS_pept        565383..566207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05981"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05981"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77350"
FT                   /db_xref="UniProtKB/TrEMBL:A2C790"
FT                   /protein_id="ABM77350.1"
FT   gene            complement(566244..566471)
FT                   /locus_tag="P9303_05991"
FT   CDS_pept        complement(566244..566471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_05991"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_05991"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77351"
FT                   /db_xref="GOA:A2C791"
FT                   /db_xref="UniProtKB/TrEMBL:A2C791"
FT                   /protein_id="ABM77351.1"
FT   gene            complement(566515..567384)
FT                   /locus_tag="P9303_06001"
FT   CDS_pept        complement(566515..567384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06001"
FT                   /product="putative tetrapyrrole methylase family protein"
FT                   /note="COG313 Predicted methyltransferases [General
FT                   function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77352"
FT                   /db_xref="GOA:A2C792"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A2C792"
FT                   /protein_id="ABM77352.1"
FT                   QMVENESE"
FT   gene            567322..568326
FT                   /gene="cysQ"
FT                   /locus_tag="P9303_06011"
FT   CDS_pept        567322..568326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="P9303_06011"
FT                   /product="CysQ"
FT                   /EC_number=""
FT                   /note="COG1218 3'-Phosphoadenosine 5'-phosphosulfate (PAPS)
FT                   3'-phosphatase [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77353"
FT                   /db_xref="GOA:A2C793"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:A2C793"
FT                   /protein_id="ABM77353.1"
FT   gene            complement(568343..570508)
FT                   /locus_tag="P9303_06021"
FT   CDS_pept        complement(568343..570508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06021"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number=""
FT                   /note="COG1185 Polyribonucleotide nucleotidyltransferase
FT                   (polynucleotide phosphorylase) [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77354"
FT                   /db_xref="GOA:A2C794"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C794"
FT                   /protein_id="ABM77354.1"
FT   gene            complement(570695..570997)
FT                   /gene="rpsN"
FT                   /locus_tag="P9303_06031"
FT   CDS_pept        complement(570695..570997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="P9303_06031"
FT                   /product="30S Ribosomal protein S14"
FT                   /note="COG199 Ribosomal protein S14 [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77355"
FT                   /db_xref="GOA:A2C795"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C795"
FT                   /protein_id="ABM77355.1"
FT   gene            complement(570979..571095)
FT                   /locus_tag="P9303_06041"
FT   CDS_pept        complement(570979..571095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06041"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77356"
FT                   /db_xref="UniProtKB/TrEMBL:A2C796"
FT                   /protein_id="ABM77356.1"
FT   gene            complement(571106..572188)
FT                   /locus_tag="P9303_06051"
FT   CDS_pept        complement(571106..572188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06051"
FT                   /product="Predicted membrane-associated Zn-dependent
FT                   proteases 1"
FT                   /note="COG750 Predicted membrane-associated Zn-dependent
FT                   proteases 1 [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77357"
FT                   /db_xref="GOA:A2C797"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A2C797"
FT                   /protein_id="ABM77357.1"
FT   gene            complement(572208..573485)
FT                   /gene="serS"
FT                   /locus_tag="P9303_06061"
FT   CDS_pept        complement(572208..573485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="P9303_06061"
FT                   /product="Seryl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="COG172 Seryl-tRNA synthetase [Translation, ribosomal
FT                   structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77358"
FT                   /db_xref="GOA:A2C798"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C798"
FT                   /protein_id="ABM77358.1"
FT   gene            complement(573560..575050)
FT                   /locus_tag="P9303_06071"
FT   CDS_pept        complement(573560..575050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06071"
FT                   /product="ATPase"
FT                   /note="COG464 ATPases of the AAA+ class [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77359"
FT                   /db_xref="GOA:A2C799"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C799"
FT                   /protein_id="ABM77359.1"
FT   gene            complement(575047..575577)
FT                   /locus_tag="P9303_06081"
FT   CDS_pept        complement(575047..575577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06081"
FT                   /product="Predicted metal-binding, possibly nucleic
FT                   acid-binding protein"
FT                   /note="COG1399 Predicted metal-binding, possibly nucleic
FT                   acid-binding protein [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77360"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7A0"
FT                   /protein_id="ABM77360.1"
FT                   DPRWAALQKLNSP"
FT   gene            complement(575574..576707)
FT                   /gene="yidC"
FT                   /locus_tag="P9303_06091"
FT   CDS_pept        complement(575574..576707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidC"
FT                   /locus_tag="P9303_06091"
FT                   /product="Putative inner membrane protein"
FT                   /note="similar to 60 kDa inner membrane protein family;
FT                   COG706 Preprotein translocase subunit YidC [Intracellular
FT                   trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77361"
FT                   /db_xref="GOA:A2C7A1"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7A1"
FT                   /protein_id="ABM77361.1"
FT   gene            complement(576789..577196)
FT                   /locus_tag="P9303_06101"
FT   CDS_pept        complement(576789..577196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77362"
FT                   /db_xref="GOA:A2C7A2"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7A2"
FT                   /protein_id="ABM77362.1"
FT   gene            complement(577193..577579)
FT                   /gene="rnpA"
FT                   /locus_tag="P9303_06111"
FT   CDS_pept        complement(577193..577579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="P9303_06111"
FT                   /product="Bacterial ribonuclease P protein component"
FT                   /EC_number=""
FT                   /note="COG594 RNase P protein component [Translation,
FT                   ribosomal structure and biogenesis]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77363"
FT                   /db_xref="GOA:A2C7A3"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C7A3"
FT                   /protein_id="ABM77363.1"
FT   gene            complement(577640..577777)
FT                   /gene="rpl34"
FT                   /gene_synonym="rpmH"
FT                   /locus_tag="P9303_06121"
FT   CDS_pept        complement(577640..577777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl34"
FT                   /gene_synonym="rpmH"
FT                   /locus_tag="P9303_06121"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77364"
FT                   /db_xref="GOA:A2C7A4"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C7A4"
FT                   /protein_id="ABM77364.1"
FT                   "
FT   gene            complement(577826..578416)
FT                   /locus_tag="P9303_06131"
FT   CDS_pept        complement(577826..578416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77365"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7A5"
FT                   /protein_id="ABM77365.1"
FT   gene            complement(578544..578930)
FT                   /gene="aroH"
FT                   /locus_tag="P9303_06141"
FT   CDS_pept        complement(578544..578930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroH"
FT                   /locus_tag="P9303_06141"
FT                   /product="Chorismate mutase"
FT                   /EC_number=""
FT                   /note="COG4401 Chorismate mutase [Amino acid transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77366"
FT                   /db_xref="GOA:A2C7A6"
FT                   /db_xref="InterPro:IPR008243"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7A6"
FT                   /protein_id="ABM77366.1"
FT   gene            complement(578927..579739)
FT                   /gene="sppA"
FT                   /locus_tag="P9303_06151"
FT   CDS_pept        complement(578927..579739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="P9303_06151"
FT                   /product="signal peptide peptidase SppA (protease IV)"
FT                   /note="COG616 Periplasmic serine proteases (ClpP class)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones / Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77367"
FT                   /db_xref="GOA:A2C7A7"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7A7"
FT                   /protein_id="ABM77367.1"
FT   gene            579793..580752
FT                   /locus_tag="P9303_06161"
FT   CDS_pept        579793..580752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06161"
FT                   /product="putative SMR family transporter"
FT                   /note="possible pecM homolog; COG697 Permeases of the
FT                   drug/metabolite transporter (DMT) superfamily [Carbohydrate
FT                   transport and metabolism / Amino acid transport and
FT                   metabolism / General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77368"
FT                   /db_xref="GOA:A2C7A8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7A8"
FT                   /protein_id="ABM77368.1"
FT   gene            580871..582712
FT                   /locus_tag="P9303_06171"
FT   CDS_pept        580871..582712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06171"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase"
FT                   /note="COG1807 4-amino-4-deoxy-L-arabinose transferase and
FT                   related glycosyltransferases of PMT family [Cell envelope
FT                   biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77369"
FT                   /db_xref="GOA:A2C7A9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7A9"
FT                   /protein_id="ABM77369.1"
FT   gene            complement(582910..583743)
FT                   /locus_tag="P9303_06181"
FT   CDS_pept        complement(582910..583743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06181"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77370"
FT                   /db_xref="GOA:A2C7B0"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7B0"
FT                   /protein_id="ABM77370.1"
FT   gene            584234..584452
FT                   /locus_tag="P9303_06191"
FT   CDS_pept        584234..584452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06191"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77371"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7B1"
FT                   /protein_id="ABM77371.1"
FT   gene            complement(584563..585105)
FT                   /locus_tag="P9303_06201"
FT   CDS_pept        complement(584563..585105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77372"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7B2"
FT                   /protein_id="ABM77372.1"
FT                   FCRRLQLADPPQSETNA"
FT   gene            585172..585975
FT                   /gene="pspA"
FT                   /locus_tag="P9303_06211"
FT   CDS_pept        585172..585975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="P9303_06211"
FT                   /product="membrane-associated 30 kDa protein"
FT                   /note="chloroplast membrane-associated 30 kDa protein-like
FT                   protein; COG1842 Phage shock protein A (IM30), suppresses
FT                   sigma54-dependent transcription [Transcription / Signal
FT                   transduction mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77373"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7B3"
FT                   /protein_id="ABM77373.1"
FT   gene            586101..587297
FT                   /locus_tag="P9303_06221"
FT   CDS_pept        586101..587297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06221"
FT                   /product="Aminotransferases class-I"
FT                   /note="COG436 Aspartate/tyrosine/aromatic aminotransferase
FT                   [Amino acid transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77374"
FT                   /db_xref="GOA:A2C7B4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7B4"
FT                   /protein_id="ABM77374.1"
FT   gene            587284..588042
FT                   /gene="birA"
FT                   /locus_tag="P9303_06231"
FT   CDS_pept        587284..588042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="P9303_06231"
FT                   /product="putative Biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number=""
FT                   /note="COG340 Biotin-(acetyl-CoA carboxylase) ligase
FT                   [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77375"
FT                   /db_xref="GOA:A2C7B5"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7B5"
FT                   /protein_id="ABM77375.1"
FT   gene            complement(588062..588187)
FT                   /locus_tag="P9303_06241"
FT   CDS_pept        complement(588062..588187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06241"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77376"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7B6"
FT                   /protein_id="ABM77376.1"
FT   gene            588094..589065
FT                   /locus_tag="P9303_06251"
FT   CDS_pept        588094..589065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06251"
FT                   /product="Peptidase family M23/M37"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77377"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7B7"
FT                   /protein_id="ABM77377.1"
FT   gene            complement(590201..590923)
FT                   /locus_tag="P9303_06261"
FT   CDS_pept        complement(590201..590923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06261"
FT                   /product="two-component response regulator"
FT                   /note="COG745 Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77378"
FT                   /db_xref="GOA:A2C7B8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7B8"
FT                   /protein_id="ABM77378.1"
FT                   AATMIHTVRGVGFILRAE"
FT   gene            complement(591008..591424)
FT                   /locus_tag="P9303_06271"
FT   CDS_pept        complement(591008..591424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06271"
FT                   /product="Response regulator receiver domain"
FT                   /note="COG784 FOG: CheY-like receiver [Signal transduction
FT                   mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77379"
FT                   /db_xref="GOA:A2C7B9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7B9"
FT                   /protein_id="ABM77379.1"
FT   gene            complement(591421..592161)
FT                   /gene="salX"
FT                   /locus_tag="P9303_06281"
FT   CDS_pept        complement(591421..592161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="salX"
FT                   /locus_tag="P9303_06281"
FT                   /product="possible ABC transporter, ATP binding protein"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77380"
FT                   /db_xref="GOA:A2C7C0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7C0"
FT                   /protein_id="ABM77380.1"
FT   gene            complement(592154..593725)
FT                   /gene="ndhB"
FT                   /locus_tag="P9303_06291"
FT   CDS_pept        complement(592154..593725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhB"
FT                   /locus_tag="P9303_06291"
FT                   /product="putative NADH dehydrogenase (complex I) subunit
FT                   (chain 2)"
FT                   /EC_number=""
FT                   /note="COG1007 NADH:ubiquinone oxidoreductase subunit 2
FT                   (chain N) [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77381"
FT                   /db_xref="GOA:A2C7C1"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C7C1"
FT                   /protein_id="ABM77381.1"
FT                   SQRSIG"
FT   gene            593802..596552
FT                   /gene="topA"
FT                   /locus_tag="P9303_06301"
FT   CDS_pept        593802..596552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="P9303_06301"
FT                   /product="Prokaryotic DNA topoisomerase"
FT                   /EC_number=""
FT                   /note="COG550 Topoisomerase IA [DNA replication,
FT                   recombination, and repair]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77382"
FT                   /db_xref="GOA:A2C7C2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7C2"
FT                   /protein_id="ABM77382.1"
FT   gene            596552..597028
FT                   /locus_tag="P9303_06311"
FT   CDS_pept        596552..597028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77383"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7C3"
FT                   /protein_id="ABM77383.1"
FT   gene            597025..597705
FT                   /locus_tag="P9303_06321"
FT   CDS_pept        597025..597705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06321"
FT                   /product="Predicted membrane protein"
FT                   /note="COG4241 Predicted membrane protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77384"
FT                   /db_xref="GOA:A2C7C4"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7C4"
FT                   /protein_id="ABM77384.1"
FT                   LDPL"
FT   gene            597611..598888
FT                   /gene="cobT"
FT                   /locus_tag="P9303_06331"
FT   CDS_pept        597611..598888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="P9303_06331"
FT                   /product="NaMN:DMB phosphoribosyltransferase"
FT                   /note="COG2038 NaMN:DMB phosphoribosyltransferase [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77385"
FT                   /db_xref="GOA:A2C7C5"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7C5"
FT                   /protein_id="ABM77385.1"
FT   gene            598918..599937
FT                   /locus_tag="P9303_06341"
FT   CDS_pept        598918..599937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77386"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7C6"
FT                   /protein_id="ABM77386.1"
FT   gene            complement(599926..601062)
FT                   /locus_tag="P9303_06351"
FT   CDS_pept        complement(599926..601062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06351"
FT                   /product="Aldo/keto reductase family protein"
FT                   /note="COG1453 Predicted oxidoreductases of the aldo/keto
FT                   reductase family [General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77387"
FT                   /db_xref="GOA:A2C7C7"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7C7"
FT                   /protein_id="ABM77387.1"
FT   gene            complement(601059..601643)
FT                   /locus_tag="P9303_06361"
FT   CDS_pept        complement(601059..601643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06361"
FT                   /product="DUF151"
FT                   /note="COG1259 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77388"
FT                   /db_xref="GOA:A2C7C8"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7C8"
FT                   /protein_id="ABM77388.1"
FT   gene            601713..602375
FT                   /gene="ribE"
FT                   /locus_tag="P9303_06371"
FT   CDS_pept        601713..602375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="P9303_06371"
FT                   /product="Putative Riboflavin synthase alpha chain"
FT                   /EC_number=""
FT                   /note="COG307 Riboflavin synthase alpha chain [Coenzyme
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77389"
FT                   /db_xref="GOA:A2C7C9"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7C9"
FT                   /protein_id="ABM77389.1"
FT   gene            602468..603058
FT                   /locus_tag="P9303_06381"
FT   CDS_pept        602468..603058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06381"
FT                   /product="Conserved hypothetical protein"
FT                   /note="COG3247 Uncharacterized conserved protein [Function
FT                   unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77390"
FT                   /db_xref="GOA:A2C7D0"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7D0"
FT                   /protein_id="ABM77390.1"
FT   gene            complement(603162..603524)
FT                   /locus_tag="P9303_06391"
FT   CDS_pept        complement(603162..603524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77391"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7D1"
FT                   /protein_id="ABM77391.1"
FT                   SGAIWLLPLENEGDKK"
FT   gene            complement(603620..604243)
FT                   /gene="ctaE"
FT                   /locus_tag="P9303_06401"
FT   CDS_pept        complement(603620..604243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaE"
FT                   /locus_tag="P9303_06401"
FT                   /product="Cytochrome c oxidase, subunit III"
FT                   /EC_number=""
FT                   /note="COG1845 Heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 3 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77392"
FT                   /db_xref="GOA:A2C7D2"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7D2"
FT                   /protein_id="ABM77392.1"
FT   gene            complement(604240..605916)
FT                   /gene="cyoB"
FT                   /locus_tag="P9303_06411"
FT   CDS_pept        complement(604240..605916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="P9303_06411"
FT                   /product="Cytochrome c oxidase, subunit I"
FT                   /EC_number=""
FT                   /note="COG843 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 1 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77393"
FT                   /db_xref="GOA:A2C7D3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7D3"
FT                   /protein_id="ABM77393.1"
FT   gene            complement(605913..606737)
FT                   /gene="ctaC"
FT                   /locus_tag="P9303_06421"
FT   CDS_pept        complement(605913..606737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaC"
FT                   /locus_tag="P9303_06421"
FT                   /product="putative cytochrome c oxidase, subunit 2"
FT                   /EC_number=""
FT                   /note="COG1622 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 2 [Energy production and conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77394"
FT                   /db_xref="GOA:A2C7D4"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7D4"
FT                   /protein_id="ABM77394.1"
FT   gene            606863..607027
FT                   /locus_tag="P9303_06431"
FT   CDS_pept        606863..607027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06431"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77395"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7D5"
FT                   /protein_id="ABM77395.1"
FT                   SPSTYSISL"
FT   gene            607037..607960
FT                   /gene="ctaA"
FT                   /locus_tag="P9303_06441"
FT   CDS_pept        607037..607960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="P9303_06441"
FT                   /product="Uncharacterized protein required for cytochrome
FT                   oxidase assembly"
FT                   /note="COG1612 Uncharacterized protein required for
FT                   cytochrome oxidase assembly [Posttranslational
FT                   modification, protein turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77396"
FT                   /db_xref="GOA:A2C7D6"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7D6"
FT                   /protein_id="ABM77396.1"
FT   gene            607953..608954
FT                   /gene="ctaB"
FT                   /locus_tag="P9303_06451"
FT   CDS_pept        607953..608954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="P9303_06451"
FT                   /product="putative protoheme IX farnesyltransferase"
FT                   /note="COG109 Polyprenyltransferase (cytochrome oxidase
FT                   assembly factor) [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77397"
FT                   /db_xref="GOA:A2C7D7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C7D7"
FT                   /protein_id="ABM77397.1"
FT   gene            609041..610054
FT                   /gene="ccmA"
FT                   /locus_tag="P9303_06461"
FT   CDS_pept        609041..610054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="P9303_06461"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /EC_number=""
FT                   /note="COG1131 ABC-type multidrug transport system, ATPase
FT                   component [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77398"
FT                   /db_xref="GOA:A2C7D8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7D8"
FT                   /protein_id="ABM77398.1"
FT   gene            610131..610985
FT                   /locus_tag="P9303_06471"
FT   CDS_pept        610131..610985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06471"
FT                   /product="putative multidrug efflux ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77399"
FT                   /db_xref="GOA:A2C7D9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7D9"
FT                   /protein_id="ABM77399.1"
FT                   KLA"
FT   gene            complement(611046..611225)
FT                   /locus_tag="P9303_06481"
FT   CDS_pept        complement(611046..611225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06481"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77400"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7E0"
FT                   /protein_id="ABM77400.1"
FT                   IQRTIASAKGSAMS"
FT   gene            611260..611952
FT                   /locus_tag="P9303_06491"
FT   CDS_pept        611260..611952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06491"
FT                   /product="FMN-binding protein (core region)"
FT                   /EC_number=""
FT                   /note="COG3010 Putative N-acetylmannosamine-6-phosphate
FT                   epimerase [Carbohydrate transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77401"
FT                   /db_xref="GOA:A2C7E1"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7E1"
FT                   /protein_id="ABM77401.1"
FT                   NYCRTLAA"
FT   gene            complement(612102..613796)
FT                   /gene="groL"
FT                   /locus_tag="P9303_06501"
FT   CDS_pept        complement(612102..613796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="P9303_06501"
FT                   /product="GroEL2 protein (Chaperonin cpn60 2)"
FT                   /EC_number=""
FT                   /note="COG459 Chaperonin GroEL (HSP60 family)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77402"
FT                   /db_xref="GOA:A2C7E2"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C7E2"
FT                   /protein_id="ABM77402.1"
FT   gene            613926..614102
FT                   /locus_tag="P9303_06511"
FT   CDS_pept        613926..614102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06511"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77403"
FT                   /db_xref="GOA:A2C7E3"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7E3"
FT                   /protein_id="ABM77403.1"
FT                   RRLRDELGQPLES"
FT   gene            complement(614126..614914)
FT                   /locus_tag="P9303_06521"
FT   CDS_pept        complement(614126..614914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06521"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number=""
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77404"
FT                   /db_xref="GOA:A2C7E4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7E4"
FT                   /protein_id="ABM77404.1"
FT   gene            complement(614926..616005)
FT                   /locus_tag="P9303_06531"
FT   CDS_pept        complement(614926..616005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06531"
FT                   /product="putative potassium channel, VIC family protein"
FT                   /note="COG569 K+ transport systems, NAD-binding component
FT                   [Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77405"
FT                   /db_xref="GOA:A2C7E5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7E5"
FT                   /protein_id="ABM77405.1"
FT   gene            complement(616002..617060)
FT                   /locus_tag="P9303_06541"
FT   CDS_pept        complement(616002..617060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06541"
FT                   /product="ADP-heptose:LPS heptosyltransferase"
FT                   /note="COG859 ADP-heptose:LPS heptosyltransferase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77406"
FT                   /db_xref="GOA:A2C7E6"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7E6"
FT                   /protein_id="ABM77406.1"
FT                   NQQEVLNALGFQ"
FT   gene            616861..617607
FT                   /gene="ispD"
FT                   /locus_tag="P9303_06551"
FT   CDS_pept        616861..617607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="P9303_06551"
FT                   /product="putative 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number=""
FT                   /note="COG1211 4-diphosphocytidyl-2-methyl-D-erithritol
FT                   synthase [Lipid metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77407"
FT                   /db_xref="GOA:A2C7E7"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7E7"
FT                   /protein_id="ABM77407.1"
FT   gene            617611..618195
FT                   /locus_tag="P9303_06561"
FT   CDS_pept        617611..618195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06561"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77408"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7E8"
FT                   /protein_id="ABM77408.1"
FT   gene            complement(618247..619146)
FT                   /locus_tag="P9303_06571"
FT   CDS_pept        complement(618247..619146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06571"
FT                   /product="Putative carboxypeptidase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG1619 Uncharacterized proteins, homologs of
FT                   microcin C7 resistance protein MccF [Defense mechanisms]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77409"
FT                   /db_xref="GOA:A2C7E9"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7E9"
FT                   /protein_id="ABM77409.1"
FT                   LGRQAQLDGSHGRLILLR"
FT   gene            complement(619150..620043)
FT                   /gene="ubiA"
FT                   /locus_tag="P9303_06581"
FT   CDS_pept        complement(619150..620043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="P9303_06581"
FT                   /product="probable 4-hydroxybenzoate-octaprenyltransferase"
FT                   /note="COG382 4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77410"
FT                   /db_xref="GOA:A2C7F0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7F0"
FT                   /protein_id="ABM77410.1"
FT                   LLGAMLLLGLILGRIS"
FT   gene            620151..621797
FT                   /gene="ppx"
FT                   /locus_tag="P9303_06591"
FT   CDS_pept        620151..621797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="P9303_06591"
FT                   /product="putative exopolyphosphatase"
FT                   /EC_number=""
FT                   /note="COG248 Exopolyphosphatase [Nucleotide transport and
FT                   metabolism / Inorganic ion transport and metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77411"
FT                   /db_xref="GOA:A2C7F1"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7F1"
FT                   /protein_id="ABM77411.1"
FT   gene            complement(621996..622706)
FT                   /locus_tag="P9303_06601"
FT   CDS_pept        complement(621996..622706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06601"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG1426 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77412"
FT                   /db_xref="GOA:A2C7F2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7F2"
FT                   /protein_id="ABM77412.1"
FT                   QQKTQPGTNPNPQQ"
FT   gene            complement(622849..622920)
FT                   /locus_tag="P9303_tRNAValVIMSS1309267"
FT                   /note="tRNA-Val"
FT   tRNA            complement(622849..622920)
FT                   /locus_tag="P9303_tRNAValVIMSS1309267"
FT                   /product="tRNA-Val"
FT   gene            complement(622948..623703)
FT                   /gene="cobM"
FT                   /locus_tag="P9303_06621"
FT   CDS_pept        complement(622948..623703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /locus_tag="P9303_06621"
FT                   /product="putative precorrin-4 C11-methyltransferase"
FT                   /EC_number=""
FT                   /note="COG2875 Precorrin-4 methylase [Coenzyme metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77413"
FT                   /db_xref="GOA:A2C7F3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7F3"
FT                   /protein_id="ABM77413.1"
FT   gene            complement(623703..624617)
FT                   /gene="lgt"
FT                   /locus_tag="P9303_06631"
FT   CDS_pept        complement(623703..624617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="P9303_06631"
FT                   /product="putative prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /note="COG682 Prolipoprotein diacylglyceryltransferase
FT                   [Cell envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77414"
FT                   /db_xref="GOA:A2C7F4"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C7F4"
FT                   /protein_id="ABM77414.1"
FT   gene            complement(624638..625570)
FT                   /gene="petA"
FT                   /locus_tag="P9303_06641"
FT   CDS_pept        complement(624638..625570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="P9303_06641"
FT                   /product="Cytochrome f"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77415"
FT                   /db_xref="GOA:A2C7F5"
FT                   /db_xref="InterPro:IPR002325"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR024058"
FT                   /db_xref="InterPro:IPR024094"
FT                   /db_xref="InterPro:IPR036826"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C7F5"
FT                   /protein_id="ABM77415.1"
FT   gene            complement(625624..626160)
FT                   /gene="petC"
FT                   /locus_tag="P9303_06651"
FT   CDS_pept        complement(625624..626160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="P9303_06651"
FT                   /product="Rieske iron-sulfur protein"
FT                   /EC_number=""
FT                   /note="COG723 Rieske Fe-S protein [Energy production and
FT                   conversion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77416"
FT                   /db_xref="GOA:A2C7F6"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023960"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C7F6"
FT                   /protein_id="ABM77416.1"
FT                   WTETDFRTGEKPWWT"
FT   gene            626322..626547
FT                   /pseudo
FT                   /locus_tag="P9303_pseudoVIMSS1362608"
FT                   /note="frameshift; Pseudogene derived from P9313_16641"
FT   gene            complement(626549..627289)
FT                   /gene="tatC"
FT                   /locus_tag="P9303_06661"
FT   CDS_pept        complement(626549..627289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="P9303_06661"
FT                   /product="protein secretion component, Tat family protein"
FT                   /note="COG805 Sec-independent protein secretion pathway
FT                   component TatC [Intracellular trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77417"
FT                   /db_xref="GOA:A2C7F7"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7F7"
FT                   /protein_id="ABM77417.1"
FT   gene            complement(627414..629201)
FT                   /locus_tag="P9303_06671"
FT   CDS_pept        complement(627414..629201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06671"
FT                   /product="possible secreted protein MPB70 precursor"
FT                   /note="COG1293 Predicted RNA-binding protein homologous to
FT                   eukaryotic snRNP [Transcription]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77418"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7F8"
FT                   /protein_id="ABM77418.1"
FT   gene            629196..629774
FT                   /gene="gmk"
FT                   /locus_tag="P9303_06681"
FT   CDS_pept        629196..629774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="P9303_06681"
FT                   /product="Guanylate kinase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG194 Guanylate kinase [Nucleotide transport and
FT                   metabolism]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06681"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77419"
FT                   /db_xref="GOA:A2C7F9"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7F9"
FT                   /protein_id="ABM77419.1"
FT   gene            complement(629916..630038)
FT                   /gene="psaJ"
FT                   /locus_tag="P9303_06691"
FT   CDS_pept        complement(629916..630038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaJ"
FT                   /locus_tag="P9303_06691"
FT                   /product="Photosystem I PsaJ protein (subunit IX)"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06691"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77420"
FT                   /db_xref="GOA:A2C7G0"
FT                   /db_xref="InterPro:IPR002615"
FT                   /db_xref="InterPro:IPR036062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C7G0"
FT                   /protein_id="ABM77420.1"
FT   gene            complement(630084..630596)
FT                   /gene="psaF"
FT                   /locus_tag="P9303_06701"
FT   CDS_pept        complement(630084..630596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaF"
FT                   /locus_tag="P9303_06701"
FT                   /product="Photosystem I PsaF protein (subunit III)"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06701"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77421"
FT                   /db_xref="GOA:A2C7G1"
FT                   /db_xref="InterPro:IPR003666"
FT                   /db_xref="InterPro:IPR036577"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7G1"
FT                   /protein_id="ABM77421.1"
FT                   KITVSPR"
FT   gene            630674..631744
FT                   /gene="qri7"
FT                   /locus_tag="P9303_06711"
FT   CDS_pept        630674..631744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qri7"
FT                   /locus_tag="P9303_06711"
FT                   /product="probable o-sialoglycoprotein endopeptidase"
FT                   /EC_number=""
FT                   /note="COG533 Metal-dependent proteases with possible
FT                   chaperone activity [Posttranslational modification, protein
FT                   turnover, chaperones]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06711"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77422"
FT                   /db_xref="GOA:A2C7G2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2C7G2"
FT                   /protein_id="ABM77422.1"
FT                   WPLDKTEDLYHSPPPF"
FT   gene            631782..631985
FT                   /locus_tag="P9303_06721"
FT   CDS_pept        631782..631985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06721"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06721"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77423"
FT                   /db_xref="GOA:A2C7G3"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7G3"
FT                   /protein_id="ABM77423.1"
FT   gene            complement(631842..632006)
FT                   /locus_tag="P9303_06731"
FT   CDS_pept        complement(631842..632006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06731"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06731"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77424"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7G4"
FT                   /protein_id="ABM77424.1"
FT                   WSEPSSPSV"
FT   gene            complement(631993..633264)
FT                   /locus_tag="P9303_06741"
FT   CDS_pept        complement(631993..633264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06741"
FT                   /product="PilT2-like protein"
FT                   /note="COG2805 Tfp pilus assembly protein, pilus retraction
FT                   ATPase PilT [Cell motility and secretion / Intracellular
FT                   trafficking and secretion]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06741"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77425"
FT                   /db_xref="GOA:A2C7G5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7G5"
FT                   /protein_id="ABM77425.1"
FT   gene            633295..634407
FT                   /gene="wecB"
FT                   /locus_tag="P9303_06751"
FT   CDS_pept        633295..634407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecB"
FT                   /locus_tag="P9303_06751"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number=""
FT                   /note="COG381 UDP-N-acetylglucosamine 2-epimerase [Cell
FT                   envelope biogenesis, outer membrane]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06751"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77426"
FT                   /db_xref="GOA:A2C7G6"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7G6"
FT                   /protein_id="ABM77426.1"
FT   gene            634331..634978
FT                   /locus_tag="P9303_06761"
FT   CDS_pept        634331..634978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="P9303_06761"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="COG4333 Uncharacterized protein conserved in
FT                   bacteria [Function unknown]"
FT                   /db_xref="EnsemblGenomes-Gn:P9303_06761"
FT                   /db_xref="EnsemblGenomes-Tr:ABM77427"
FT                   /db_xref="InterPro:IPR012441"
FT                   /db_xref="UniProtKB/TrEMBL:A2C7G7"
FT                   /protein_id="ABM77427.1"
FT   gene            634978..635223