(data stored in ACNUC7421 zone)

EMBL: CP000557

ID   CP000557; SV 1; circular; genomic DNA; STD; PRO; 3550319 BP.
XX
AC   CP000557;
XX
PR   Project:PRJNA18655;
XX
DT   30-MAR-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Geobacillus thermodenitrificans NG80-2, complete genome.
XX
KW   .
XX
OS   Geobacillus thermodenitrificans NG80-2
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
XX
RN   [1]
RP   1-3550319
RX   DOI; 10.1073/pnas.0609650104.
RX   PUBMED; 17372208.
RA   Feng L., Wang W., Cheng J., Ren Y., Zhao G., Gao C., Tang Y., Liu X.,
RA   Han W., Peng X., Liu R., Wang L.;
RT   "Genome and proteome of long-chain alkane degrading Geobacillus
RT   thermodenitrificans NG80-2 isolated from a deep-subsurface oil reservoir";
RL   Proc. Natl. Acad. Sci. U.S.A. 104(13):5602-5607(2007).
XX
RN   [2]
RP   1-3550319
RA   Wang L., Feng L., Wang W., Cheng J., Ren Y., Zhao G., Gao C.;
RT   ;
RL   Submitted (22-JAN-2007) to the INSDC.
RL   TEDA School of Biological Sciences and Biotechnology, Nankai University,
RL   Hongda Street, TEDA, Tianjin 300457, The People's Republic of China
XX
DR   MD5; 7b856c1e40f2f7a67e0255ab34a4f09e.
DR   BioSample; SAMN02603899.
DR   EnsemblGenomes-Gn; EBG00001234742.
DR   EnsemblGenomes-Gn; EBG00001234743.
DR   EnsemblGenomes-Gn; EBG00001234744.
DR   EnsemblGenomes-Gn; EBG00001234745.
DR   EnsemblGenomes-Gn; EBG00001234746.
DR   EnsemblGenomes-Gn; EBG00001234747.
DR   EnsemblGenomes-Gn; EBG00001234748.
DR   EnsemblGenomes-Gn; EBG00001234749.
DR   EnsemblGenomes-Gn; EBG00001234750.
DR   EnsemblGenomes-Gn; EBG00001234751.
DR   EnsemblGenomes-Gn; EBG00001234752.
DR   EnsemblGenomes-Gn; EBG00001234753.
DR   EnsemblGenomes-Gn; EBG00001234754.
DR   EnsemblGenomes-Gn; EBG00001234755.
DR   EnsemblGenomes-Gn; EBG00001234756.
DR   EnsemblGenomes-Gn; EBG00001234757.
DR   EnsemblGenomes-Gn; EBG00001234758.
DR   EnsemblGenomes-Gn; EBG00001234759.
DR   EnsemblGenomes-Gn; EBG00001234760.
DR   EnsemblGenomes-Gn; EBG00001234761.
DR   EnsemblGenomes-Gn; EBG00001234762.
DR   EnsemblGenomes-Gn; EBG00001234763.
DR   EnsemblGenomes-Gn; EBG00001234764.
DR   EnsemblGenomes-Gn; EBG00001234765.
DR   EnsemblGenomes-Gn; EBG00001234766.
DR   EnsemblGenomes-Gn; EBG00001234767.
DR   EnsemblGenomes-Gn; EBG00001234768.
DR   EnsemblGenomes-Gn; EBG00001234769.
DR   EnsemblGenomes-Gn; EBG00001234770.
DR   EnsemblGenomes-Gn; EBG00001234771.
DR   EnsemblGenomes-Gn; EBG00001234772.
DR   EnsemblGenomes-Gn; EBG00001234773.
DR   EnsemblGenomes-Gn; EBG00001234774.
DR   EnsemblGenomes-Gn; EBG00001234775.
DR   EnsemblGenomes-Gn; EBG00001234776.
DR   EnsemblGenomes-Gn; EBG00001234777.
DR   EnsemblGenomes-Gn; EBG00001234778.
DR   EnsemblGenomes-Gn; EBG00001234779.
DR   EnsemblGenomes-Gn; EBG00001234780.
DR   EnsemblGenomes-Gn; EBG00001234781.
DR   EnsemblGenomes-Gn; EBG00001234782.
DR   EnsemblGenomes-Gn; EBG00001234783.
DR   EnsemblGenomes-Gn; EBG00001234784.
DR   EnsemblGenomes-Gn; EBG00001234785.
DR   EnsemblGenomes-Gn; EBG00001234786.
DR   EnsemblGenomes-Gn; EBG00001234787.
DR   EnsemblGenomes-Gn; EBG00001234788.
DR   EnsemblGenomes-Gn; EBG00001234789.
DR   EnsemblGenomes-Gn; EBG00001234790.
DR   EnsemblGenomes-Gn; EBG00001234791.
DR   EnsemblGenomes-Gn; EBG00001234792.
DR   EnsemblGenomes-Gn; EBG00001234793.
DR   EnsemblGenomes-Gn; EBG00001234794.
DR   EnsemblGenomes-Gn; EBG00001234795.
DR   EnsemblGenomes-Gn; EBG00001234796.
DR   EnsemblGenomes-Gn; EBG00001234797.
DR   EnsemblGenomes-Gn; EBG00001234798.
DR   EnsemblGenomes-Gn; EBG00001234799.
DR   EnsemblGenomes-Gn; EBG00001234800.
DR   EnsemblGenomes-Gn; EBG00001234801.
DR   EnsemblGenomes-Gn; EBG00001234802.
DR   EnsemblGenomes-Gn; EBG00001234803.
DR   EnsemblGenomes-Gn; EBG00001234804.
DR   EnsemblGenomes-Gn; EBG00001234805.
DR   EnsemblGenomes-Gn; EBG00001234806.
DR   EnsemblGenomes-Gn; EBG00001234807.
DR   EnsemblGenomes-Gn; EBG00001234808.
DR   EnsemblGenomes-Gn; EBG00001234809.
DR   EnsemblGenomes-Gn; EBG00001234810.
DR   EnsemblGenomes-Gn; EBG00001234811.
DR   EnsemblGenomes-Gn; EBG00001234812.
DR   EnsemblGenomes-Gn; EBG00001234813.
DR   EnsemblGenomes-Gn; EBG00001234814.
DR   EnsemblGenomes-Gn; EBG00001234815.
DR   EnsemblGenomes-Gn; EBG00001234816.
DR   EnsemblGenomes-Gn; EBG00001234817.
DR   EnsemblGenomes-Gn; EBG00001234818.
DR   EnsemblGenomes-Gn; EBG00001234819.
DR   EnsemblGenomes-Gn; EBG00001234820.
DR   EnsemblGenomes-Gn; EBG00001234821.
DR   EnsemblGenomes-Gn; EBG00001234822.
DR   EnsemblGenomes-Gn; EBG00001234823.
DR   EnsemblGenomes-Gn; EBG00001234824.
DR   EnsemblGenomes-Gn; EBG00001234825.
DR   EnsemblGenomes-Gn; EBG00001234826.
DR   EnsemblGenomes-Gn; EBG00001234827.
DR   EnsemblGenomes-Gn; EBG00001234828.
DR   EnsemblGenomes-Gn; EBG00001234829.
DR   EnsemblGenomes-Gn; EBG00001234830.
DR   EnsemblGenomes-Gn; EBG00001234831.
DR   EnsemblGenomes-Gn; EBG00001234832.
DR   EnsemblGenomes-Gn; EBG00001234833.
DR   EnsemblGenomes-Gn; EBG00001234834.
DR   EnsemblGenomes-Gn; EBG00001234835.
DR   EnsemblGenomes-Gn; EBG00001234836.
DR   EnsemblGenomes-Gn; EBG00001234837.
DR   EnsemblGenomes-Gn; EBG00001234838.
DR   EnsemblGenomes-Gn; EBG00001234839.
DR   EnsemblGenomes-Gn; EBG00001234840.
DR   EnsemblGenomes-Gn; EBG00001234841.
DR   EnsemblGenomes-Gn; EBG00001234842.
DR   EnsemblGenomes-Gn; EBG00001234843.
DR   EnsemblGenomes-Gn; EBG00001234844.
DR   EnsemblGenomes-Gn; EBG00001234845.
DR   EnsemblGenomes-Gn; EBG00001234846.
DR   EnsemblGenomes-Gn; EBG00001234847.
DR   EnsemblGenomes-Gn; EBG00001234848.
DR   EnsemblGenomes-Gn; EBG00001234849.
DR   EnsemblGenomes-Gn; EBG00001234850.
DR   EnsemblGenomes-Gn; EBG00001234851.
DR   EnsemblGenomes-Gn; EBG00001234852.
DR   EnsemblGenomes-Gn; EBG00001234853.
DR   EnsemblGenomes-Gn; EBG00001234854.
DR   EnsemblGenomes-Gn; EBG00001234855.
DR   EnsemblGenomes-Gn; EBG00001234856.
DR   EnsemblGenomes-Gn; EBG00001234857.
DR   EnsemblGenomes-Gn; EBG00001234858.
DR   EnsemblGenomes-Gn; EBG00001234859.
DR   EnsemblGenomes-Gn; EBG00001234860.
DR   EnsemblGenomes-Gn; EBG00001234861.
DR   EnsemblGenomes-Gn; EBG00001234862.
DR   EnsemblGenomes-Gn; EBG00001234863.
DR   EnsemblGenomes-Gn; EBG00001234864.
DR   EnsemblGenomes-Gn; EBG00001234865.
DR   EnsemblGenomes-Gn; EBG00001234866.
DR   EnsemblGenomes-Gn; EBG00001234867.
DR   EnsemblGenomes-Gn; EBG00001234868.
DR   EnsemblGenomes-Gn; EBG00001234869.
DR   EnsemblGenomes-Gn; EBG00001234870.
DR   EnsemblGenomes-Gn; EBG00001234871.
DR   EnsemblGenomes-Gn; EBG00001234872.
DR   EnsemblGenomes-Gn; EBG00001234873.
DR   EnsemblGenomes-Gn; EBG00001234874.
DR   EnsemblGenomes-Gn; EBG00001234875.
DR   EnsemblGenomes-Gn; EBG00001234876.
DR   EnsemblGenomes-Gn; EBG00001234877.
DR   EnsemblGenomes-Gn; EBG00001234878.
DR   EnsemblGenomes-Gn; EBG00001234879.
DR   EnsemblGenomes-Gn; EBG00001234880.
DR   EnsemblGenomes-Gn; EBG00001234881.
DR   EnsemblGenomes-Gn; EBG00001234882.
DR   EnsemblGenomes-Gn; EBG00001234883.
DR   EnsemblGenomes-Gn; EBG00001234884.
DR   EnsemblGenomes-Gn; EBG00001234885.
DR   EnsemblGenomes-Gn; EBG00001234886.
DR   EnsemblGenomes-Gn; EBG00001234887.
DR   EnsemblGenomes-Gn; EBG00001234888.
DR   EnsemblGenomes-Gn; EBG00001234889.
DR   EnsemblGenomes-Gn; EBG00001234890.
DR   EnsemblGenomes-Gn; EBG00001234891.
DR   EnsemblGenomes-Gn; EBG00001234892.
DR   EnsemblGenomes-Gn; EBG00001234893.
DR   EnsemblGenomes-Gn; EBG00001234894.
DR   EnsemblGenomes-Gn; EBG00001234895.
DR   EnsemblGenomes-Gn; EBG00001234896.
DR   EnsemblGenomes-Gn; EBG00001234897.
DR   EnsemblGenomes-Gn; EBG00001234898.
DR   EnsemblGenomes-Gn; EBG00001234899.
DR   EnsemblGenomes-Gn; EBG00001234900.
DR   EnsemblGenomes-Gn; EBG00001234901.
DR   EnsemblGenomes-Gn; EBG00001234902.
DR   EnsemblGenomes-Gn; EBG00001234903.
DR   EnsemblGenomes-Gn; EBG00001234904.
DR   EnsemblGenomes-Gn; EBG00001234905.
DR   EnsemblGenomes-Gn; EBG00001234906.
DR   EnsemblGenomes-Gn; EBG00001234907.
DR   EnsemblGenomes-Gn; EBG00001234908.
DR   EnsemblGenomes-Gn; EBG00001234909.
DR   EnsemblGenomes-Gn; EBG00001234910.
DR   EnsemblGenomes-Gn; GTNG_16s001.
DR   EnsemblGenomes-Gn; GTNG_16s002.
DR   EnsemblGenomes-Gn; GTNG_16s003.
DR   EnsemblGenomes-Gn; GTNG_16s004.
DR   EnsemblGenomes-Gn; GTNG_16s005.
DR   EnsemblGenomes-Gn; GTNG_16s006.
DR   EnsemblGenomes-Gn; GTNG_16s007.
DR   EnsemblGenomes-Gn; GTNG_16s008.
DR   EnsemblGenomes-Gn; GTNG_16s009.
DR   EnsemblGenomes-Gn; GTNG_16s010.
DR   EnsemblGenomes-Gn; GTNG_23s001.
DR   EnsemblGenomes-Gn; GTNG_23s002.
DR   EnsemblGenomes-Gn; GTNG_23s003.
DR   EnsemblGenomes-Gn; GTNG_23s004.
DR   EnsemblGenomes-Gn; GTNG_23s005.
DR   EnsemblGenomes-Gn; GTNG_23s006.
DR   EnsemblGenomes-Gn; GTNG_23s007.
DR   EnsemblGenomes-Gn; GTNG_23s008.
DR   EnsemblGenomes-Gn; GTNG_23s009.
DR   EnsemblGenomes-Gn; GTNG_23s010.
DR   EnsemblGenomes-Gn; GTNG_5s001.
DR   EnsemblGenomes-Gn; GTNG_5s002.
DR   EnsemblGenomes-Gn; GTNG_5s003.
DR   EnsemblGenomes-Gn; GTNG_5s004.
DR   EnsemblGenomes-Gn; GTNG_5s005.
DR   EnsemblGenomes-Gn; GTNG_5s006.
DR   EnsemblGenomes-Gn; GTNG_5s007.
DR   EnsemblGenomes-Gn; GTNG_5s008.
DR   EnsemblGenomes-Gn; GTNG_5s009.
DR   EnsemblGenomes-Gn; GTNG_5s010.
DR   EnsemblGenomes-Gn; GTNG_t001.
DR   EnsemblGenomes-Gn; GTNG_t002.
DR   EnsemblGenomes-Gn; GTNG_t003.
DR   EnsemblGenomes-Gn; GTNG_t004.
DR   EnsemblGenomes-Gn; GTNG_t005.
DR   EnsemblGenomes-Gn; GTNG_t006.
DR   EnsemblGenomes-Gn; GTNG_t007.
DR   EnsemblGenomes-Gn; GTNG_t008.
DR   EnsemblGenomes-Gn; GTNG_t009.
DR   EnsemblGenomes-Gn; GTNG_t010.
DR   EnsemblGenomes-Gn; GTNG_t011.
DR   EnsemblGenomes-Gn; GTNG_t012.
DR   EnsemblGenomes-Gn; GTNG_t013.
DR   EnsemblGenomes-Gn; GTNG_t014.
DR   EnsemblGenomes-Gn; GTNG_t015.
DR   EnsemblGenomes-Gn; GTNG_t016.
DR   EnsemblGenomes-Gn; GTNG_t017.
DR   EnsemblGenomes-Gn; GTNG_t018.
DR   EnsemblGenomes-Gn; GTNG_t019.
DR   EnsemblGenomes-Gn; GTNG_t020.
DR   EnsemblGenomes-Gn; GTNG_t021.
DR   EnsemblGenomes-Gn; GTNG_t022.
DR   EnsemblGenomes-Gn; GTNG_t023.
DR   EnsemblGenomes-Gn; GTNG_t024.
DR   EnsemblGenomes-Gn; GTNG_t025.
DR   EnsemblGenomes-Gn; GTNG_t026.
DR   EnsemblGenomes-Gn; GTNG_t027.
DR   EnsemblGenomes-Gn; GTNG_t028.
DR   EnsemblGenomes-Gn; GTNG_t029.
DR   EnsemblGenomes-Gn; GTNG_t030.
DR   EnsemblGenomes-Gn; GTNG_t031.
DR   EnsemblGenomes-Gn; GTNG_t032.
DR   EnsemblGenomes-Gn; GTNG_t033.
DR   EnsemblGenomes-Gn; GTNG_t034.
DR   EnsemblGenomes-Gn; GTNG_t035.
DR   EnsemblGenomes-Gn; GTNG_t036.
DR   EnsemblGenomes-Gn; GTNG_t037.
DR   EnsemblGenomes-Gn; GTNG_t038.
DR   EnsemblGenomes-Gn; GTNG_t039.
DR   EnsemblGenomes-Gn; GTNG_t040.
DR   EnsemblGenomes-Gn; GTNG_t041.
DR   EnsemblGenomes-Gn; GTNG_t042.
DR   EnsemblGenomes-Gn; GTNG_t043.
DR   EnsemblGenomes-Gn; GTNG_t044.
DR   EnsemblGenomes-Gn; GTNG_t045.
DR   EnsemblGenomes-Gn; GTNG_t046.
DR   EnsemblGenomes-Gn; GTNG_t047.
DR   EnsemblGenomes-Gn; GTNG_t048.
DR   EnsemblGenomes-Gn; GTNG_t049.
DR   EnsemblGenomes-Gn; GTNG_t050.
DR   EnsemblGenomes-Gn; GTNG_t051.
DR   EnsemblGenomes-Gn; GTNG_t052.
DR   EnsemblGenomes-Gn; GTNG_t053.
DR   EnsemblGenomes-Gn; GTNG_t054.
DR   EnsemblGenomes-Gn; GTNG_t055.
DR   EnsemblGenomes-Gn; GTNG_t056.
DR   EnsemblGenomes-Gn; GTNG_t057.
DR   EnsemblGenomes-Gn; GTNG_t058.
DR   EnsemblGenomes-Gn; GTNG_t059.
DR   EnsemblGenomes-Gn; GTNG_t060.
DR   EnsemblGenomes-Gn; GTNG_t061.
DR   EnsemblGenomes-Gn; GTNG_t062.
DR   EnsemblGenomes-Gn; GTNG_t063.
DR   EnsemblGenomes-Gn; GTNG_t064.
DR   EnsemblGenomes-Gn; GTNG_t065.
DR   EnsemblGenomes-Gn; GTNG_t066.
DR   EnsemblGenomes-Gn; GTNG_t067.
DR   EnsemblGenomes-Gn; GTNG_t068.
DR   EnsemblGenomes-Gn; GTNG_t069.
DR   EnsemblGenomes-Gn; GTNG_t070.
DR   EnsemblGenomes-Gn; GTNG_t071.
DR   EnsemblGenomes-Gn; GTNG_t072.
DR   EnsemblGenomes-Gn; GTNG_t073.
DR   EnsemblGenomes-Gn; GTNG_t074.
DR   EnsemblGenomes-Gn; GTNG_t075.
DR   EnsemblGenomes-Gn; GTNG_t076.
DR   EnsemblGenomes-Gn; GTNG_t077.
DR   EnsemblGenomes-Gn; GTNG_t078.
DR   EnsemblGenomes-Gn; GTNG_t079.
DR   EnsemblGenomes-Gn; GTNG_t080.
DR   EnsemblGenomes-Gn; GTNG_t081.
DR   EnsemblGenomes-Gn; GTNG_t082.
DR   EnsemblGenomes-Gn; GTNG_t083.
DR   EnsemblGenomes-Gn; GTNG_t084.
DR   EnsemblGenomes-Gn; GTNG_t085.
DR   EnsemblGenomes-Gn; GTNG_t086.
DR   EnsemblGenomes-Gn; GTNG_t087.
DR   EnsemblGenomes-Tr; EBT00001580243.
DR   EnsemblGenomes-Tr; EBT00001580244.
DR   EnsemblGenomes-Tr; EBT00001580245.
DR   EnsemblGenomes-Tr; EBT00001580246.
DR   EnsemblGenomes-Tr; EBT00001580247.
DR   EnsemblGenomes-Tr; EBT00001580248.
DR   EnsemblGenomes-Tr; EBT00001580249.
DR   EnsemblGenomes-Tr; EBT00001580250.
DR   EnsemblGenomes-Tr; EBT00001580251.
DR   EnsemblGenomes-Tr; EBT00001580252.
DR   EnsemblGenomes-Tr; EBT00001580253.
DR   EnsemblGenomes-Tr; EBT00001580254.
DR   EnsemblGenomes-Tr; EBT00001580255.
DR   EnsemblGenomes-Tr; EBT00001580256.
DR   EnsemblGenomes-Tr; EBT00001580257.
DR   EnsemblGenomes-Tr; EBT00001580258.
DR   EnsemblGenomes-Tr; EBT00001580259.
DR   EnsemblGenomes-Tr; EBT00001580260.
DR   EnsemblGenomes-Tr; EBT00001580261.
DR   EnsemblGenomes-Tr; EBT00001580262.
DR   EnsemblGenomes-Tr; EBT00001580263.
DR   EnsemblGenomes-Tr; EBT00001580264.
DR   EnsemblGenomes-Tr; EBT00001580265.
DR   EnsemblGenomes-Tr; EBT00001580266.
DR   EnsemblGenomes-Tr; EBT00001580267.
DR   EnsemblGenomes-Tr; EBT00001580268.
DR   EnsemblGenomes-Tr; EBT00001580269.
DR   EnsemblGenomes-Tr; EBT00001580270.
DR   EnsemblGenomes-Tr; EBT00001580271.
DR   EnsemblGenomes-Tr; EBT00001580272.
DR   EnsemblGenomes-Tr; EBT00001580273.
DR   EnsemblGenomes-Tr; EBT00001580274.
DR   EnsemblGenomes-Tr; EBT00001580275.
DR   EnsemblGenomes-Tr; EBT00001580276.
DR   EnsemblGenomes-Tr; EBT00001580277.
DR   EnsemblGenomes-Tr; EBT00001580278.
DR   EnsemblGenomes-Tr; EBT00001580279.
DR   EnsemblGenomes-Tr; EBT00001580280.
DR   EnsemblGenomes-Tr; EBT00001580281.
DR   EnsemblGenomes-Tr; EBT00001580282.
DR   EnsemblGenomes-Tr; EBT00001580283.
DR   EnsemblGenomes-Tr; EBT00001580284.
DR   EnsemblGenomes-Tr; EBT00001580285.
DR   EnsemblGenomes-Tr; EBT00001580286.
DR   EnsemblGenomes-Tr; EBT00001580287.
DR   EnsemblGenomes-Tr; EBT00001580288.
DR   EnsemblGenomes-Tr; EBT00001580289.
DR   EnsemblGenomes-Tr; EBT00001580290.
DR   EnsemblGenomes-Tr; EBT00001580291.
DR   EnsemblGenomes-Tr; EBT00001580292.
DR   EnsemblGenomes-Tr; EBT00001580293.
DR   EnsemblGenomes-Tr; EBT00001580294.
DR   EnsemblGenomes-Tr; EBT00001580295.
DR   EnsemblGenomes-Tr; EBT00001580296.
DR   EnsemblGenomes-Tr; EBT00001580297.
DR   EnsemblGenomes-Tr; EBT00001580298.
DR   EnsemblGenomes-Tr; EBT00001580299.
DR   EnsemblGenomes-Tr; EBT00001580300.
DR   EnsemblGenomes-Tr; EBT00001580301.
DR   EnsemblGenomes-Tr; EBT00001580302.
DR   EnsemblGenomes-Tr; EBT00001580303.
DR   EnsemblGenomes-Tr; EBT00001580304.
DR   EnsemblGenomes-Tr; EBT00001580305.
DR   EnsemblGenomes-Tr; EBT00001580306.
DR   EnsemblGenomes-Tr; EBT00001580307.
DR   EnsemblGenomes-Tr; EBT00001580308.
DR   EnsemblGenomes-Tr; EBT00001580309.
DR   EnsemblGenomes-Tr; EBT00001580310.
DR   EnsemblGenomes-Tr; EBT00001580311.
DR   EnsemblGenomes-Tr; EBT00001580312.
DR   EnsemblGenomes-Tr; EBT00001580313.
DR   EnsemblGenomes-Tr; EBT00001580314.
DR   EnsemblGenomes-Tr; EBT00001580315.
DR   EnsemblGenomes-Tr; EBT00001580316.
DR   EnsemblGenomes-Tr; EBT00001580317.
DR   EnsemblGenomes-Tr; EBT00001580318.
DR   EnsemblGenomes-Tr; EBT00001580319.
DR   EnsemblGenomes-Tr; EBT00001580320.
DR   EnsemblGenomes-Tr; EBT00001580321.
DR   EnsemblGenomes-Tr; EBT00001580322.
DR   EnsemblGenomes-Tr; EBT00001580323.
DR   EnsemblGenomes-Tr; EBT00001580324.
DR   EnsemblGenomes-Tr; EBT00001580325.
DR   EnsemblGenomes-Tr; EBT00001580326.
DR   EnsemblGenomes-Tr; EBT00001580327.
DR   EnsemblGenomes-Tr; EBT00001580328.
DR   EnsemblGenomes-Tr; EBT00001580329.
DR   EnsemblGenomes-Tr; EBT00001580330.
DR   EnsemblGenomes-Tr; EBT00001580331.
DR   EnsemblGenomes-Tr; EBT00001580332.
DR   EnsemblGenomes-Tr; EBT00001580333.
DR   EnsemblGenomes-Tr; EBT00001580334.
DR   EnsemblGenomes-Tr; EBT00001580335.
DR   EnsemblGenomes-Tr; EBT00001580336.
DR   EnsemblGenomes-Tr; EBT00001580337.
DR   EnsemblGenomes-Tr; EBT00001580338.
DR   EnsemblGenomes-Tr; EBT00001580339.
DR   EnsemblGenomes-Tr; EBT00001580340.
DR   EnsemblGenomes-Tr; EBT00001580341.
DR   EnsemblGenomes-Tr; EBT00001580342.
DR   EnsemblGenomes-Tr; EBT00001580343.
DR   EnsemblGenomes-Tr; EBT00001580344.
DR   EnsemblGenomes-Tr; EBT00001580345.
DR   EnsemblGenomes-Tr; EBT00001580346.
DR   EnsemblGenomes-Tr; EBT00001580347.
DR   EnsemblGenomes-Tr; EBT00001580348.
DR   EnsemblGenomes-Tr; EBT00001580349.
DR   EnsemblGenomes-Tr; EBT00001580350.
DR   EnsemblGenomes-Tr; EBT00001580351.
DR   EnsemblGenomes-Tr; EBT00001580352.
DR   EnsemblGenomes-Tr; EBT00001580353.
DR   EnsemblGenomes-Tr; EBT00001580354.
DR   EnsemblGenomes-Tr; EBT00001580355.
DR   EnsemblGenomes-Tr; EBT00001580356.
DR   EnsemblGenomes-Tr; EBT00001580357.
DR   EnsemblGenomes-Tr; EBT00001580358.
DR   EnsemblGenomes-Tr; EBT00001580359.
DR   EnsemblGenomes-Tr; EBT00001580360.
DR   EnsemblGenomes-Tr; EBT00001580361.
DR   EnsemblGenomes-Tr; EBT00001580362.
DR   EnsemblGenomes-Tr; EBT00001580363.
DR   EnsemblGenomes-Tr; EBT00001580364.
DR   EnsemblGenomes-Tr; EBT00001580365.
DR   EnsemblGenomes-Tr; EBT00001580366.
DR   EnsemblGenomes-Tr; EBT00001580367.
DR   EnsemblGenomes-Tr; EBT00001580368.
DR   EnsemblGenomes-Tr; EBT00001580369.
DR   EnsemblGenomes-Tr; EBT00001580370.
DR   EnsemblGenomes-Tr; EBT00001580371.
DR   EnsemblGenomes-Tr; EBT00001580372.
DR   EnsemblGenomes-Tr; EBT00001580373.
DR   EnsemblGenomes-Tr; EBT00001580374.
DR   EnsemblGenomes-Tr; EBT00001580375.
DR   EnsemblGenomes-Tr; EBT00001580376.
DR   EnsemblGenomes-Tr; EBT00001580377.
DR   EnsemblGenomes-Tr; EBT00001580378.
DR   EnsemblGenomes-Tr; EBT00001580379.
DR   EnsemblGenomes-Tr; EBT00001580380.
DR   EnsemblGenomes-Tr; EBT00001580381.
DR   EnsemblGenomes-Tr; EBT00001580382.
DR   EnsemblGenomes-Tr; EBT00001580383.
DR   EnsemblGenomes-Tr; EBT00001580384.
DR   EnsemblGenomes-Tr; EBT00001580385.
DR   EnsemblGenomes-Tr; EBT00001580386.
DR   EnsemblGenomes-Tr; EBT00001580387.
DR   EnsemblGenomes-Tr; EBT00001580388.
DR   EnsemblGenomes-Tr; EBT00001580389.
DR   EnsemblGenomes-Tr; EBT00001580390.
DR   EnsemblGenomes-Tr; EBT00001580391.
DR   EnsemblGenomes-Tr; EBT00001580392.
DR   EnsemblGenomes-Tr; EBT00001580393.
DR   EnsemblGenomes-Tr; EBT00001580394.
DR   EnsemblGenomes-Tr; EBT00001580395.
DR   EnsemblGenomes-Tr; EBT00001580396.
DR   EnsemblGenomes-Tr; EBT00001580397.
DR   EnsemblGenomes-Tr; EBT00001580398.
DR   EnsemblGenomes-Tr; EBT00001580399.
DR   EnsemblGenomes-Tr; EBT00001580400.
DR   EnsemblGenomes-Tr; EBT00001580401.
DR   EnsemblGenomes-Tr; EBT00001580402.
DR   EnsemblGenomes-Tr; EBT00001580403.
DR   EnsemblGenomes-Tr; EBT00001580404.
DR   EnsemblGenomes-Tr; EBT00001580405.
DR   EnsemblGenomes-Tr; EBT00001580406.
DR   EnsemblGenomes-Tr; EBT00001580407.
DR   EnsemblGenomes-Tr; EBT00001580408.
DR   EnsemblGenomes-Tr; EBT00001580409.
DR   EnsemblGenomes-Tr; EBT00001580410.
DR   EnsemblGenomes-Tr; EBT00001580411.
DR   EnsemblGenomes-Tr; GTNG_16s001-1.
DR   EnsemblGenomes-Tr; GTNG_16s002-1.
DR   EnsemblGenomes-Tr; GTNG_16s003-1.
DR   EnsemblGenomes-Tr; GTNG_16s004-1.
DR   EnsemblGenomes-Tr; GTNG_16s005-1.
DR   EnsemblGenomes-Tr; GTNG_16s006-1.
DR   EnsemblGenomes-Tr; GTNG_16s007-1.
DR   EnsemblGenomes-Tr; GTNG_16s008-1.
DR   EnsemblGenomes-Tr; GTNG_16s009-1.
DR   EnsemblGenomes-Tr; GTNG_16s010-1.
DR   EnsemblGenomes-Tr; GTNG_23s001-1.
DR   EnsemblGenomes-Tr; GTNG_23s002-1.
DR   EnsemblGenomes-Tr; GTNG_23s003-1.
DR   EnsemblGenomes-Tr; GTNG_23s004-1.
DR   EnsemblGenomes-Tr; GTNG_23s005-1.
DR   EnsemblGenomes-Tr; GTNG_23s006-1.
DR   EnsemblGenomes-Tr; GTNG_23s007-1.
DR   EnsemblGenomes-Tr; GTNG_23s008-1.
DR   EnsemblGenomes-Tr; GTNG_23s009-1.
DR   EnsemblGenomes-Tr; GTNG_23s010-1.
DR   EnsemblGenomes-Tr; GTNG_5s001-1.
DR   EnsemblGenomes-Tr; GTNG_5s002-1.
DR   EnsemblGenomes-Tr; GTNG_5s003-1.
DR   EnsemblGenomes-Tr; GTNG_5s004-1.
DR   EnsemblGenomes-Tr; GTNG_5s005-1.
DR   EnsemblGenomes-Tr; GTNG_5s006-1.
DR   EnsemblGenomes-Tr; GTNG_5s007-1.
DR   EnsemblGenomes-Tr; GTNG_5s008-1.
DR   EnsemblGenomes-Tr; GTNG_5s009-1.
DR   EnsemblGenomes-Tr; GTNG_5s010-1.
DR   EnsemblGenomes-Tr; GTNG_t001-1.
DR   EnsemblGenomes-Tr; GTNG_t002-1.
DR   EnsemblGenomes-Tr; GTNG_t003-1.
DR   EnsemblGenomes-Tr; GTNG_t004-1.
DR   EnsemblGenomes-Tr; GTNG_t005-1.
DR   EnsemblGenomes-Tr; GTNG_t006-1.
DR   EnsemblGenomes-Tr; GTNG_t007-1.
DR   EnsemblGenomes-Tr; GTNG_t008-1.
DR   EnsemblGenomes-Tr; GTNG_t009-1.
DR   EnsemblGenomes-Tr; GTNG_t010-1.
DR   EnsemblGenomes-Tr; GTNG_t011-1.
DR   EnsemblGenomes-Tr; GTNG_t012-1.
DR   EnsemblGenomes-Tr; GTNG_t013-1.
DR   EnsemblGenomes-Tr; GTNG_t014-1.
DR   EnsemblGenomes-Tr; GTNG_t015-1.
DR   EnsemblGenomes-Tr; GTNG_t016-1.
DR   EnsemblGenomes-Tr; GTNG_t017-1.
DR   EnsemblGenomes-Tr; GTNG_t018-1.
DR   EnsemblGenomes-Tr; GTNG_t019-1.
DR   EnsemblGenomes-Tr; GTNG_t020-1.
DR   EnsemblGenomes-Tr; GTNG_t021-1.
DR   EnsemblGenomes-Tr; GTNG_t022-1.
DR   EnsemblGenomes-Tr; GTNG_t023-1.
DR   EnsemblGenomes-Tr; GTNG_t024-1.
DR   EnsemblGenomes-Tr; GTNG_t025-1.
DR   EnsemblGenomes-Tr; GTNG_t026-1.
DR   EnsemblGenomes-Tr; GTNG_t027-1.
DR   EnsemblGenomes-Tr; GTNG_t028-1.
DR   EnsemblGenomes-Tr; GTNG_t029-1.
DR   EnsemblGenomes-Tr; GTNG_t030-1.
DR   EnsemblGenomes-Tr; GTNG_t031-1.
DR   EnsemblGenomes-Tr; GTNG_t032-1.
DR   EnsemblGenomes-Tr; GTNG_t033-1.
DR   EnsemblGenomes-Tr; GTNG_t034-1.
DR   EnsemblGenomes-Tr; GTNG_t035-1.
DR   EnsemblGenomes-Tr; GTNG_t036-1.
DR   EnsemblGenomes-Tr; GTNG_t037-1.
DR   EnsemblGenomes-Tr; GTNG_t038-1.
DR   EnsemblGenomes-Tr; GTNG_t039-1.
DR   EnsemblGenomes-Tr; GTNG_t040-1.
DR   EnsemblGenomes-Tr; GTNG_t041-1.
DR   EnsemblGenomes-Tr; GTNG_t042-1.
DR   EnsemblGenomes-Tr; GTNG_t043-1.
DR   EnsemblGenomes-Tr; GTNG_t044-1.
DR   EnsemblGenomes-Tr; GTNG_t045-1.
DR   EnsemblGenomes-Tr; GTNG_t046-1.
DR   EnsemblGenomes-Tr; GTNG_t047-1.
DR   EnsemblGenomes-Tr; GTNG_t048-1.
DR   EnsemblGenomes-Tr; GTNG_t049-1.
DR   EnsemblGenomes-Tr; GTNG_t050-1.
DR   EnsemblGenomes-Tr; GTNG_t051-1.
DR   EnsemblGenomes-Tr; GTNG_t052-1.
DR   EnsemblGenomes-Tr; GTNG_t053-1.
DR   EnsemblGenomes-Tr; GTNG_t054-1.
DR   EnsemblGenomes-Tr; GTNG_t055-1.
DR   EnsemblGenomes-Tr; GTNG_t056-1.
DR   EnsemblGenomes-Tr; GTNG_t057-1.
DR   EnsemblGenomes-Tr; GTNG_t058-1.
DR   EnsemblGenomes-Tr; GTNG_t059-1.
DR   EnsemblGenomes-Tr; GTNG_t060-1.
DR   EnsemblGenomes-Tr; GTNG_t061-1.
DR   EnsemblGenomes-Tr; GTNG_t062-1.
DR   EnsemblGenomes-Tr; GTNG_t063-1.
DR   EnsemblGenomes-Tr; GTNG_t064-1.
DR   EnsemblGenomes-Tr; GTNG_t065-1.
DR   EnsemblGenomes-Tr; GTNG_t066-1.
DR   EnsemblGenomes-Tr; GTNG_t067-1.
DR   EnsemblGenomes-Tr; GTNG_t068-1.
DR   EnsemblGenomes-Tr; GTNG_t069-1.
DR   EnsemblGenomes-Tr; GTNG_t070-1.
DR   EnsemblGenomes-Tr; GTNG_t071-1.
DR   EnsemblGenomes-Tr; GTNG_t072-1.
DR   EnsemblGenomes-Tr; GTNG_t073-1.
DR   EnsemblGenomes-Tr; GTNG_t074-1.
DR   EnsemblGenomes-Tr; GTNG_t075-1.
DR   EnsemblGenomes-Tr; GTNG_t076-1.
DR   EnsemblGenomes-Tr; GTNG_t077-1.
DR   EnsemblGenomes-Tr; GTNG_t078-1.
DR   EnsemblGenomes-Tr; GTNG_t079-1.
DR   EnsemblGenomes-Tr; GTNG_t080-1.
DR   EnsemblGenomes-Tr; GTNG_t081-1.
DR   EnsemblGenomes-Tr; GTNG_t082-1.
DR   EnsemblGenomes-Tr; GTNG_t083-1.
DR   EnsemblGenomes-Tr; GTNG_t084-1.
DR   EnsemblGenomes-Tr; GTNG_t085-1.
DR   EnsemblGenomes-Tr; GTNG_t086-1.
DR   EnsemblGenomes-Tr; GTNG_t087-1.
DR   EuropePMC; PMC1838512; 17372208.
DR   EuropePMC; PMC2632007; 19074389.
DR   EuropePMC; PMC3346416; 22447612.
DR   EuropePMC; PMC4718643; 26171785.
DR   EuropePMC; PMC4771647; 27026935.
DR   EuropePMC; PMC4982221; 27525040.
DR   EuropePMC; PMC4995803; 27559429.
DR   EuropePMC; PMC5109656; 27842516.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01412; BsrG.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000557.
DR   SILVA-SSU; CP000557.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3550319
FT                   /organism="Geobacillus thermodenitrificans NG80-2"
FT                   /strain="NG80-2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:420246"
FT   gene            209..1561
FT                   /gene="dnaA"
FT                   /locus_tag="GTNG_0001"
FT   CDS_pept        209..1561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="GTNG_0001"
FT                   /product="DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65388"
FT                   /db_xref="GOA:A4IJ84"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJ84"
FT                   /protein_id="ABO65388.1"
FT                   /translation="MENIHDLWDRVLGEIERKISKPSFETWLKSTKAHSLRGDTLVIVA
FT                   PNEFARDWLDSRYSHLIAETIYAITGEELAVKFIIPPNQADEKLELPSSAKKQRKPYEE
FT                   ANDFPQSMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLM
FT                   HAIGHYVIEHNPSAKVVYLSSEKFTNEFINAIRDNRPDDFRNKYRNVDVLLIDDIQFLA
FT                   GKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLE
FT                   TRIAILRKKAKAEGFDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKEITADLA
FT                   AEALKDIIPSAKPKVITIQDIQRVVGQHFNIKLEDFKAKKRTKSVAFPRQIAMYLSREL
FT                   TDCSLPKIGDEFGGRDHTTVIHAHEKISKLLQTDTQLQKHLKEIQEKLKQL"
FT   gene            1733..2869
FT                   /locus_tag="GTNG_0002"
FT   CDS_pept        1733..2869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65389"
FT                   /db_xref="GOA:A4IJ85"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJ85"
FT                   /protein_id="ABO65389.1"
FT                   /translation="MNISIDREALAKSVQDVMKAVSTRTTIPILTGIKLTANAHGMTLT
FT                   GSDSDISIESFIPLEKEGRLLVDVKRPGSIVLQARFFAEIVKKLPQQTIEIETEDNFLT
FT                   VIRSGHSEFRLNGLNAEEYPRLPQIEEENVFQIPADLLKTLIRQTVFAVSTSETRPILT
FT                   GVNWKVENGELICTATDSHRLAMRKVKIEAENAISYNVVIPGKSLNELSKILDDGNAPV
FT                   SIVITANQVLFKAEHLLFFSRLLDGNYPETARLIPTDSKTNMVVNAKEFLQAIDRASLL
FT                   AREGRNNVVKLTTLPGGLLEISSISPEIGKVTEQLQTESIEGEELNISFSAKYMMDALR
FT                   ALDGNDIQISFTGAMRPFLLRPLHTDSMLQLILPVRTY"
FT   gene            3059..3280
FT                   /locus_tag="GTNG_0003"
FT   CDS_pept        3059..3280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0003"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65390"
FT                   /db_xref="GOA:A4IJ86"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJ86"
FT                   /protein_id="ABO65390.1"
FT                   /translation="MEQKVTITTETITLGQLLKLVNLIETGGAAKWFLQEYNVFVNGEK
FT                   EDRRGRKLKDGDRVEIERIGTFIVTQVE"
FT   gene            3292..4410
FT                   /gene="recF"
FT                   /locus_tag="GTNG_0004"
FT   CDS_pept        3292..4410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="GTNG_0004"
FT                   /product="RecF"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65391"
FT                   /db_xref="GOA:A4IJ87"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJ87"
FT                   /protein_id="ABO65391.1"
FT                   /translation="MFLTNLTLTNYRNYEHETLSFDQGVNIILGENAQGKTNMMEAIYV
FT                   LAMAKSHRTTNDKDLIRWNEDYAKIEGRAEKRSGSLALELTISKKGKKARCNHIEQQRL
FT                   SQYVGHLNVVMFAPEDLNLVKGSPQVRRRFIDMEIGQVSPVYIHDLSQYQKLLQQRNHY
FT                   LKMMQAREQHDEAVLDVLTEQLMVLAAKITLRRRQFLALLEQWAMPIHHEISRGAERLH
FT                   IRYEPSVDVSEKAELSRIVEAYSETFAAMREREIQRGTTLVGPHRDDIAFIVNGKNVQT
FT                   FGSQGQQRTTALAVKLAEIELIFSELGDYPILLLDDVLSELDDFRQTHLLDAIRKKVQT
FT                   FVTTTSIDGIKHDLIQEAAIYRVHSGSVAAPS"
FT   gene            4456..6378
FT                   /locus_tag="GTNG_0005"
FT   CDS_pept        4456..6378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65392"
FT                   /db_xref="GOA:A4IJ88"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJ88"
FT                   /protein_id="ABO65392.1"
FT                   /translation="MTMEQRVEQAYDASQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLV
FT                   WEIVDNSIDEALAGYCTEIHVTIGEDNSITIADNGRGIPVDVHEATGRPAVEVIMTVLH
FT                   AGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVYVYRDGKIHYQKYERGEPRTDLQVID
FT                   ETDRTGTTTRFKPDPEIFTETTEFDYETLATRLRELAFLNRGLKITLTDERVDNRKNEY
FT                   FYEGGIRSYVRHLNRTREVLHEEPIYIAGERDGIAVEIALQYNDGYTSNIYSFVNNIHT
FT                   HEGGTHESGFKMALTRIINDYARKQQIFKDNDANLTGEDVREGLTAIVSIKHPAPQFEG
FT                   QTKTKLGNSDARTVTDAVFSEQFETFLLEHPAVARKIVEKGMMAARARVAAKKARELTR
FT                   RKSALEISNLPGKLADCSSRDPSISELYVVEGDSAGGSAKQGRDRHFQAILPLRGKILN
FT                   VEKARLDKILSNNEVRAIITALGTGIGEDFDISKARYHKVIIMTDADVDGAHIRTLLLT
FT                   FFYRYMRELIERGYIYIAQPPLYKIEQGKQVRYAYNDRQLEKILAELPAQPKPMIQRYK
FT                   GLGEMNPEQLWETTMNPETRTLLQVSLQDAIDADETFEILMGDKVEPRRQFIEENARYV
FT                   KNLDI"
FT   gene            6531..8999
FT                   /locus_tag="GTNG_0006"
FT   CDS_pept        6531..8999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0006"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65393"
FT                   /db_xref="GOA:A4IJ89"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJ89"
FT                   /protein_id="ABO65393.1"
FT                   /translation="MAEHEQPRIREVNISQEMRSSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYAMHDLGMTADKPYKKSARIVGEVIGKYHPHGDAAVYDTMVRMAQDFNYRYMLV
FT                   DGHGNFGSIDGDAAAAMRYTEARMSKIAMELLRDINKDTIDYQDNYDGSEKEPVVLPSR
FT                   FPNLLVNGSSGIAVGMATNIPPHQLGEVIDALLALSQNPEMTVADLMEYIPGPDFPTAG
FT                   QIIGRSGIRKAYETGRGSITLRAKAEIEQHANGKETIIVSELPYQVNKAKLIERIAELV
FT                   RERKIDGITDLRDESDRNGMRIVIEVRRDANAKVVLNNLYKYTALQTSFGINMLALVNG
FT                   EPKVLNLKECLEHYLNHQKTVIRRRTAFELKKAEARAHILEGLRIALDHLDEVIDLIRR
FT                   SQTTEAAREGLMERFSLSERQAQAILDMRLQRLTGLEREKIEQEYQDIVRLIAELRAVL
FT                   ADEEKVLQIIRDELSEIKERFNDERRTEIVVGAVEQLDDEDLIPHEHIVITLTHKGYIK
FT                   RLPLSTYRSQKRGGRGVQGMHTSEDDFVEHLLITSTHDTVLFFTNKGKVYQAKGYEIPE
FT                   FGRTAKGLPIINLLELDKDEWINAMIPIETFDDERYLVFSTKQGIAKRSSLSSFAHIRN
FT                   NGLIAIHLREGDELISVRLTDGQKHLIIGTKNGMLIRFPETDVRTMGRSATGVKAITLD
FT                   DNDEVVSMEILEDHHDVLVVTKKGFGKRTPASEYRVQSRGGKGLKTCNVTERNGSVVAV
FT                   TTVVGNEDLMVITTSGVLIRISVSDISRTGRVAQGVKLIRLSGEDEHECVATVAKVTEE
FT                   EKEEEEGHSA"
FT   gene            9128..10189
FT                   /locus_tag="GTNG_0007"
FT   CDS_pept        9128..10189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0007"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65394"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJ90"
FT                   /protein_id="ABO65394.1"
FT                   /translation="MVRVKLEQLREGCVLAQDVIGKTKKPIMPKKTVITKQLLHVLSKF
FT                   LINEVEIEPVLANGEPFLAGDSASTKADERPVMLYLQAVQRYKKAFQSWQAGGAVDIVE
FT                   IREIAIPLFNKMIKHKRELLMLHHYTTKEEYLYHHAVSVGLLAGFLAMQLGYGQGECHQ
FT                   IVLAGVLSDCGMAKISSQILMKPSALTEAEFREIEQHPILGYRMVQNIAALNQGAKLAV
FT                   LQHHERNDGSGYPLRVKAEKIHPYGQLIAVADVYYAMTSERLYRRKQSPFRAIEAIQRE
FT                   QFGRLNAEVVALLVNHLISLQTGAIVKLSNGETAEVIFIQPDEPARPIVKVMKTGQLLS
FT                   LVEQRDLYIEEIL"
FT   gene            10618..12168
FT                   /locus_tag="GTNG_16s001"
FT   rRNA            10618..12168
FT                   /locus_tag="GTNG_16s001"
FT                   /product="16S ribosomal RNA"
FT   gene            12396..12469
FT                   /locus_tag="GTNG_t001"
FT   tRNA            12396..12469
FT                   /locus_tag="GTNG_t001"
FT                   /product="tRNA-Ile"
FT   gene            12481..12556
FT                   /locus_tag="GTNG_t002"
FT   tRNA            12481..12556
FT                   /locus_tag="GTNG_t002"
FT                   /product="tRNA-Ala"
FT   gene            12744..15672
FT                   /locus_tag="GTNG_23s001"
FT   rRNA            12744..15672
FT                   /locus_tag="GTNG_23s001"
FT                   /product="23S ribosomal RNA"
FT   gene            15771..15887
FT                   /locus_tag="GTNG_5s001"
FT   rRNA            15771..15887
FT                   /locus_tag="GTNG_5s001"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(15924..16910)
FT                   /gene="yaaC"
FT                   /locus_tag="GTNG_0008"
FT   CDS_pept        complement(15924..16910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaC"
FT                   /locus_tag="GTNG_0008"
FT                   /product="YaaC"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65395"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJ91"
FT                   /protein_id="ABO65395.1"
FT                   /translation="MFGNTKSAFNLSVFRSADTAQHFLQQCYKQQQRDDAVQRSYTNCY
FT                   PFLYYLEHGQNFYAAAQQAPLSIKPVLLFYGMVQLLKACLLTVDPNYPESTSVLAHGVS
FT                   TRKRKKQGYEFLDDEVKVQKNGLFTHFSEKMFHVKQEAGEKFRMGTLLQRICELHETFF
FT                   FLGGRKKPLSLPIVHNVSPPILAIPKTILDHYHMSLSRFIQYIGEEGQGRKLVFIKEDG
FT                   EFLYFETATPLSSVGEGPFLFHLNGTYHIPTKKEKIFTLPEIHAHYLLLYNLSMISRYE
FT                   TEWWSELLHSYSSKAYIFILQFLSVSAEKVPLLLNEYLMQKLLAKPN"
FT   gene            17037..18503
FT                   /gene="guaB"
FT                   /locus_tag="GTNG_0009"
FT   CDS_pept        17037..18503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="GTNG_0009"
FT                   /product="Inosine-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65396"
FT                   /db_xref="GOA:A4IJ92"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJ92"
FT                   /protein_id="ABO65396.1"
FT                   /translation="MWEAKFAKEGLTFDDVLLIPAKSDVLPRDVDVTTRLSDTLQLNIP
FT                   IISAGMDTVTEAEMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITDPFFLTP
FT                   DHQVYDAEHLMGKYRISGVPIVNNAEEQKLVGIITNRDLRFIQDYSIKISEVMTKENLI
FT                   TAPVGTTLEEAEKILQQHKVEKLPLVDENGILKGLITIKDIEKVIEFPNSAKDAKGRLV
FT                   VGAAVGVTADTMIRVKKLVEAGVDVIVVDTAHGHSKGVLETVANIRRQYPDLNIIAGNV
FT                   ATAEATRDLIEAGANIIKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGVPIIA
FT                   DGGIKYSGDIVKAMAAGAHAVMLGSLLAGVSESPGETEIYQGRRFKVYRGMGSVASMER
FT                   GSKDRYFQEEAKKFVPEGIEGRVPYKGPLADTIYQLVGGLRAGMGYCGTRNLDELREKT
FT                   QFIRMTGAGLRESHPHDVQITKEAPNYSAF"
FT   gene            18607..19965
FT                   /locus_tag="GTNG_0010"
FT   CDS_pept        18607..19965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0010"
FT                   /product="D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65397"
FT                   /db_xref="GOA:A4IJ93"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJ93"
FT                   /protein_id="ABO65397.1"
FT                   /translation="METKKRNWFVWLLSICLCLTLWPFQATVKAESAPLDIRADAAILV
FT                   DAQTGRILYEKNIDAVLGIASMTKMMTEYLLLDAIKAKRVKWDQTYTPSDYVYRLSQDR
FT                   SLSNVPLRKDGQYTVRELYEAMAIYSANAATVAIAEIIAGSEKNFVRMMNEKGKELGLK
FT                   DYKFVNSTGLSNSDLKGFHPQGTSQDEENVMSARAMATLAYRLLKDHPEVLETASIPKK
FT                   LFREGTDDEIRMDNWNWMLPGLVYGYEGVDGLKTGYTEFAGNCFTGTAKRNGVRLISVV
FT                   MNAKNASGKTTKEARFEETKKLFNYGFNQYSLQTLYPKGYQLKGKEKLPVAKGKEKEVR
FT                   VKTGKKLSLLVRNGEEKQYKPVYVLDKKKMTNEGKLTAPLKKGETVGYMTLEYKGDDSL
FT                   AFLSPDMQKNIRVPLVTTVEVEKANWFVLSMRAIGGLFADLWTSAVKAVKGWL"
FT   gene            20095..20979
FT                   /locus_tag="GTNG_0011"
FT   CDS_pept        20095..20979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0011"
FT                   /product="Pyridoxine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65398"
FT                   /db_xref="GOA:A4IJ94"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJ94"
FT                   /protein_id="ABO65398.1"
FT                   /translation="MALTGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEAAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTVVEEVMNAVSIPVMAKVRIGHYVEARVLEALGVDYIDES
FT                   EVLTPADEEFHIDKRQFTVPFVCGCRDLGEAARRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQIRKVVSMSEDELVAEAKQLGAPVEVLREIKRIGRLPVVNFAAGGVATPADAA
FT                   LMMHLGADGVFVGSGIFKSENPEKYARAIVEATTHYEDYELIAHLSKGLGGAMRGIDVA
FT                   TLLPEHRMQERGW"
FT   gene            21004..21591
FT                   /locus_tag="GTNG_0012"
FT   CDS_pept        21004..21591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0012"
FT                   /product="Glutamine amidotransferase Sno family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65399"
FT                   /db_xref="GOA:A4IJ95"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJ95"
FT                   /protein_id="ABO65399.1"
FT                   /translation="MKIGVLGLQGAVQEHVRAIEACGAEAVVVKKTEQLTGLDGLVLPG
FT                   GESTTMRRLIDRYGLMEPLKQFAADGKPMFGTCAGLILLAKRIVGYDEPHLGLMDITVE
FT                   RNSFGRQRESFEAELSIKGVGDGFVGVFIRAPHIVEVGDEVEVLATYNDRIVAARQGQF
FT                   LGCSFHPELTDDHRLMRYFLNMVKEAKTVSSI"
FT   gene            21871..23145
FT                   /locus_tag="GTNG_0013"
FT   CDS_pept        21871..23145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0013"
FT                   /product="Seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65400"
FT                   /db_xref="GOA:A4IJ96"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJ96"
FT                   /protein_id="ABO65400.1"
FT                   /translation="MLDVKLLRTQFQEVKEKLLQRGDDLANIDRFEQLDKERRRLIAQV
FT                   EELKSKRNEVSQQIAVLKREKKDAESLIAEMREVGDRIKQMDEQIRQLEEELDSLLLSI
FT                   PNVPHESVPVGQSEEDNVEVRRWGEPRSFSFEPKPHWDIADQLGLLDFERAAKVAGSRF
FT                   VFYKGLGARLERALINFMLDIHLDEFGYQEVLPPYLVNRASMIGTGQLPKFAEDAFHLD
FT                   NEDYFLIPTAEVPVTNLHRDEILTADDLPLYYAAYSACFRAEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYDELEKLTHQAETILQRLGLPYRVVALCTGDLGFSAAKTYDIEVW
FT                   LPSYGTYREISSCSNFEAFQARRANIRFRREPKAKPEYVHTLNGSGLAIGRTVAAILEN
FT                   YQQEDGSVVIPGALRPYMGNRDVIR"
FT   gene            complement(23402..24688)
FT                   /locus_tag="GTNG_0014"
FT   CDS_pept        complement(23402..24688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0014"
FT                   /product="Spore peptidoglycan hydrolase,
FT                   N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65401"
FT                   /db_xref="GOA:A4IJ97"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJ97"
FT                   /protein_id="ABO65401.1"
FT                   /translation="MQIHVIQSGQTLSGIAEAYGTTVEEIVRANKLPNPDELVVGQTLV
FT                   IPIVGRFYWVQRGDSLWSIARRFSLPMQRLAEVNRLSLNAPLRVGQRLYIPPGAKRRAE
FT                   FNAYIEPRGTTVSPALEASAREAAPYLTYLSPFYFSIRRDATLQGPPLDDFPAIARANR
FT                   VTLVMVVANIENGQFSDELGALILTNETLQNRLLDNIVATARQYGFRDIHFDFEYLRPE
FT                   DREAYNAFLRKAKRRFEREGWLISTALAPKTSATQRGRWYEAHDYRAHGQIVDFVVIMT
FT                   YEWGYSGGPPMPVSPIGPVRRVLEYALSEMPAGKILMGQNLYGYDWTLPYVPGGPYARA
FT                   ISPQQAIALAAKYNVAIEYDVEAQAPHFRYRDENGREHEVWFEDARSIQAKFNLVKELG
FT                   LRGVSYWKLGLDFPQNWLLINDQFTVVKK"
FT   gene            24771..25256
FT                   /locus_tag="GTNG_0015"
FT   CDS_pept        24771..25256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0015"
FT                   /product="Cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65402"
FT                   /db_xref="GOA:A4IJ98"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJ98"
FT                   /protein_id="ABO65402.1"
FT                   /translation="MMNNDEYYMRLAIEEAKKAEQIGEVPIGAVIVQDGRVIARAHNLR
FT                   ETEQRAIAHAEILAIAEACQATGSWRLERATLYVTLEPCAMCAGAIVLSRIERVVFGAS
FT                   DPKGGCAGTLMNLLQESRFNHQADVTSGVLASECGSLLSDFFRRLRERKKNVGGSSN"
FT   gene            25688..27367
FT                   /gene="dnaZX"
FT                   /locus_tag="GTNG_0016"
FT   CDS_pept        25688..27367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaZX"
FT                   /locus_tag="GTNG_0016"
FT                   /product="DnaZX"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65403"
FT                   /db_xref="GOA:A4IJ99"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJ99"
FT                   /protein_id="ABO65403.1"
FT                   /translation="MAYQALYRVFRPQRFADMVGQEHVTKTLQSALLQHKISHAYLFSG
FT                   PRGTGKTSAAKIFAKAVNCEHAPAAEPCNECPVCLGITNGTVPDVLEIDAASNNRVDEI
FT                   RDIREKVKFAPTSVRYKVYIIDEVHMLSIGAFNALLKTLEEPPKHVIFILATTEPHKIP
FT                   ATIISRCQRFDFRRIPLSAIVSRLKYVANAQGVEASDEALSAIARAADGGMRDALSLLD
FT                   QAISFSNGKLEVDDVLSMTGAASFAALADFIGAIYRKDTAAVLQQFETMMAQGKDPNRL
FT                   VEDLILYCRDLLLYKTAPHVEGAIQIAVVDEAFISLSETIPLSDLYGAIELLNKSQQEM
FT                   KWTNHPRLLLEVALVRLCHQPAAAPSLSASELEPLVKRIETLEAELRRLKEQPSASPSA
FT                   AAPAKKTTKVAKTGGYKAPVGRIHELLKQATHEDLALIKGRWADVLDTLKRQHKVSHAA
FT                   LLQESEPVAASASAFVLKFKYEIHCKMATDPASSVKENVEAILFEMTNRRFEMVAIPEE
FT                   EWGKIREDFIRNKEAKAEKSEEEPLIAEAKRLFGEELIEIKE"
FT   gene            27390..27716
FT                   /locus_tag="GTNG_0017"
FT   CDS_pept        27390..27716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0017"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65404"
FT                   /db_xref="GOA:A4IJA0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJA0"
FT                   /protein_id="ABO65404.1"
FT                   /translation="MMRGGMGNMQKMLKQMQKMQKEMQKAQEELAEKTVEGTAGGGMVT
FT                   VVANGHKQILEVKIKEEVVDPDDIEMLQDLILAATNDALKKVDELANDMMGQFTKGLNI
FT                   PGLF"
FT   gene            27726..28322
FT                   /gene="recR"
FT                   /locus_tag="GTNG_0018"
FT   CDS_pept        27726..28322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="GTNG_0018"
FT                   /product="RecR"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65405"
FT                   /db_xref="GOA:A4IJA1"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJA1"
FT                   /protein_id="ABO65405.1"
FT                   /translation="MHYPEPISKLIDSFMKLPGIGPKTAARLAFHVLAMKEDTVLEFAK
FT                   ALVDVKRHIHYCTICGHITDTDPCYICKDERRDRTMICVVQDPKDVIAMEKMKEYNGLY
FT                   HVLHGAISPMEGIGPEDIKIAELLARLQDETIQEVILATDPNIEGEATAMYLSRLLKPT
FT                   GIKITRIAHGLPVGGDLEYADEVTLSKALEGRREL"
FT   gene            28346..28570
FT                   /locus_tag="GTNG_0019"
FT   CDS_pept        28346..28570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0019"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65406"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJA2"
FT                   /protein_id="ABO65406.1"
FT                   /translation="MLWRRKGKLKRQFDEKLIAELQKARTEWFEQKQLIEKSVDPSLEV
FT                   LSALQLAEAKYFFLLREAKHRRVTLKEVR"
FT   gene            28649..28912
FT                   /locus_tag="GTNG_0020"
FT   CDS_pept        28649..28912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0020"
FT                   /product="Inhibitor of the pro-sigma K processing
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65407"
FT                   /db_xref="GOA:A4IJA3"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJA3"
FT                   /protein_id="ABO65407.1"
FT                   /translation="MEPKVVISVLLALITVLLIVGARFKALRFFGYAAIRLIVGALALF
FT                   VINAIGGHFSIHIPINFITSLVCGFLGIPGAAALIVIDQYIL"
FT   gene            29329..30879
FT                   /locus_tag="GTNG_16s002"
FT   rRNA            29329..30879
FT                   /locus_tag="GTNG_16s002"
FT                   /product="16S ribosomal RNA"
FT   gene            31105..31178
FT                   /locus_tag="GTNG_t003"
FT   tRNA            31105..31178
FT                   /locus_tag="GTNG_t003"
FT                   /product="tRNA-Ile"
FT   gene            31190..31265
FT                   /locus_tag="GTNG_t004"
FT   tRNA            31190..31265
FT                   /locus_tag="GTNG_t004"
FT                   /product="tRNA-Ala"
FT   gene            31453..34381
FT                   /locus_tag="GTNG_23s002"
FT   rRNA            31453..34381
FT                   /locus_tag="GTNG_23s002"
FT                   /product="23S ribosomal RNA"
FT   gene            34570..34686
FT                   /locus_tag="GTNG_5s002"
FT   rRNA            34570..34686
FT                   /locus_tag="GTNG_5s002"
FT                   /product="5S ribosomal RNA"
FT   gene            34706..35059
FT                   /gene="csfB"
FT                   /locus_tag="GTNG_0021"
FT   CDS_pept        34706..35059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csfB"
FT                   /locus_tag="GTNG_0021"
FT                   /product="CsfB"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65408"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJA4"
FT                   /protein_id="ABO65408.1"
FT                   /translation="MFHARLAAFIFCHFFKFLLGKCSETRSIFPSTSIECYQYGKHRGW
FT                   EVENVRVSVIDKNKREKVCIVCEQEKAEGIFLFGHFLCVDCHQAIVQTNTDDPNYAFYV
FT                   QQLRKMMTSKIYS"
FT   gene            35262..36698
FT                   /locus_tag="GTNG_0022"
FT   CDS_pept        35262..36698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0022"
FT                   /product="lysine decarboxylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65409"
FT                   /db_xref="GOA:A4IJA5"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJA5"
FT                   /protein_id="ABO65409.1"
FT                   /translation="MNQAKTPLYDALTRHWARRPVSFHVPGHKYGAIFPKRAEDVFSSL
FT                   LALDVTEISGLDDLHHPESVIAEAQALAAELYGAEKTFFLVNGSTSGNLAMIAAVCDEK
FT                   KRKVIVQRNCHKSVMHALQLMGATPVLLSPEFDSDMRVASHVCMETVKEALALHRDAAA
FT                   LVLTNPNYYGMSIDLTEIVRLAHDHGIPVLVDEAHGAHFVVGPPFPKSALACGADMVVQ
FT                   SAHKTLPAMTMGAFLHVNSGRIDVERLKYFLQLFQSSSPSYPIMASLDLARSYVAKLIE
FT                   DGVEAIVEKIEEFKTALNDIAGVTVVSSRHPDVQIDPLKVTVQTRSSLTGYELQHRLER
FT                   EGVFAELADPLNVLLVCPLAANGQLIETVDKMKRAWCGLPTGQVPLFGSFPLLRSPLSV
FT                   LVPYDELRDVRKKVVALEEAEGYVAAETVIPYPPGVPLMWIGERIDRSHIEQIRQFLHH
FT                   QAHIQGGSRLRDGLLVVYEL"
FT   gene            36722..37399
FT                   /gene="tmk"
FT                   /locus_tag="GTNG_0023"
FT   CDS_pept        36722..37399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="GTNG_0023"
FT                   /product="Thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65410"
FT                   /db_xref="GOA:A4IJA6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJA6"
FT                   /protein_id="ABO65410.1"
FT                   /translation="MNGYFFSFEGPEGAGKTTMIGKLESFLRERGFDVMVTREPGGVRI
FT                   AEAIRALILNREYTEMDGRTEALLYAAARRQHLLEKIVPALEAGRVVLCDRFVDSSLAY
FT                   QGFARGLGVEEVWKINEFAIDGYMPSLTVYFDIDPQIGLERIRQNREREVNRLDLETLS
FT                   FHDKVREGYRKLAKRFAERIVVIDASRPLDDVFSETVATVLSRLEGSKRHFHESNRDDS
FT                   CWT"
FT   gene            37431..38423
FT                   /locus_tag="GTNG_0024"
FT   CDS_pept        37431..38423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0024"
FT                   /product="DNA polymerase III delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65411"
FT                   /db_xref="GOA:A4IJA7"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJA7"
FT                   /protein_id="ABO65411.1"
FT                   /translation="MAMQWEQLAKRQPVVAKMLQSGLEKGRISHAYLFEGQRGTGKKAA
FT                   SLLLAKSLFCLSPSGIAPCLECRNCRRIESGNHPDVRVISPDGGSIKKEQIEWLQQEFT
FT                   KTAVESDKKMYIVEHADQMTTSAANSLLKFLEEPHPGTVAVLLTEQYHRLLETVISRCQ
FT                   VLSFRPLPPAELADQLVKERVPLTLALLAAHLTNSYDEALALSQDRWFAEARTLVLQLY
FT                   EMLGKPELQLLFFIHDRLLSHFPEKHQLNLGLDLLLYIYRDLLHIQAGRKDSALYRDEL
FT                   DRLQRWALSCPQRRVLDGMEAILQAKARLNMTNMSTALLMEQLALQLKR"
FT   gene            38438..39265
FT                   /locus_tag="GTNG_0025"
FT   CDS_pept        38438..39265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0025"
FT                   /product="Signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65412"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJA8"
FT                   /protein_id="ABO65412.1"
FT                   /translation="MYTVVGVRFKKAGKIYYFDPGDFVIPAGEFVIVETARGIEYGKVV
FT                   IANKQVDENDIVLPLKKVIRVANEKDKWVVEENKKAAREAYDICLRKVEEHGLEMKLVD
FT                   VEYTFDRNKVIFYFTADGRVDFRELVKDLASIFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYESEEYETAKEQLPDL
FT                   GEYVETPYGFGKVVGLNILERVLQIELPEHGRVVEYTLDELMKDGTLSIRVAD"
FT   gene            39282..39644
FT                   /locus_tag="GTNG_0026"
FT   CDS_pept        39282..39644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0026"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65413"
FT                   /db_xref="GOA:A4IJA9"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJA9"
FT                   /protein_id="ABO65413.1"
FT                   /translation="MEKVDKKEVFQSVANMEEHLSHFYRELVQLKQRVSELLEENHQLQ
FT                   IENAHLRRRLEQLAEAWEEEKRKETKHGKKPVDIGEGYDNLARLYQEGFHICHVHYGSV
FT                   RTEGDCLFCLSFLNKK"
FT   gene            39705..40454
FT                   /locus_tag="GTNG_0027"
FT   CDS_pept        39705..40454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0027"
FT                   /product="Methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65414"
FT                   /db_xref="GOA:A4IJB0"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJB0"
FT                   /protein_id="ABO65414.1"
FT                   /translation="MVELYGDERLDYLFNEELRIIQSPSVFSFSLDAVLLAHFAYLPIQ
FT                   KGQIVDLCTGNGVIPLLLSQRTKGTIIGIEIQERLCDMARRSIQYNGLEEQIEIIHGDI
FT                   KEAPQQIGYSRYDVVTCNPPYFPTAGQDELSKNEHLAIARHEIYCTLEDAVRVSSQLLK
FT                   QGGKAAFVHRPGRLLDIVMLMRQYRLEPKRLRFVYPKAGKEANMILIEGMKDASPDLKV
FT                   LPPLVVYDENNEYTEEMKRILYGIISP"
FT   gene            40471..41376
FT                   /locus_tag="GTNG_0028"
FT   CDS_pept        40471..41376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0028"
FT                   /product="Corrin/porphyrin methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65415"
FT                   /db_xref="GOA:A4IJB1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJB1"
FT                   /protein_id="ABO65415.1"
FT                   /translation="MLWQQKSFVEQMGQGTLYIVPTPIGNLEDMTFRAVRTLREADVIA
FT                   AEDTRQTKKLLSHFDIHTPLVSYHEHNKYASGRQLVEWLKEGKNVALVSDAGMPGISDP
FT                   GYELIVAALAERCRVVPLPGANAALTALVASGLPTGRFLFVGFLERAKKEKREQLLSLK
FT                   TAAETLVFYEAPHRLKETLAAMYDVFGERRVALCRELTKRFEEFIRGDLSEAIAWAETT
FT                   DIRGEFCIVVEGAQNGSEPEREEETWWQSLSLVEHVDYYVSEHGLSVKEAVKQAAGDRK
FT                   MSKRDVYQQYHRQKEKKEFL"
FT   gene            complement(41398..41691)
FT                   /locus_tag="GTNG_0029"
FT   CDS_pept        complement(41398..41691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0029"
FT                   /product="Transition state regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65416"
FT                   /db_xref="GOA:A4IJB2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJB2"
FT                   /protein_id="ABO65416.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLDINEKDALEIYVDDDRIIL
FT                   KKYKPNMTCVVTGEVSDDNFKLAGGKIILSREGAEILLQEIRQHLQDSTDSE"
FT   gene            42085..44037
FT                   /locus_tag="GTNG_0030"
FT   CDS_pept        42085..44037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0030"
FT                   /product="Methionine-tRNA ligase/methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65417"
FT                   /db_xref="GOA:A4IJB3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJB3"
FT                   /protein_id="ABO65417.1"
FT                   /translation="MEKKTFYLTTPIYYPSDKLHIGHAYTTVAGDTLARYKRMRGYDVM
FT                   YLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKV
FT                   VEKIFARLVEQGDIYLGEYEGWYCTPCESFYTERQLVDGNCPDCGRPVEKVKEQSYFFR
FT                   MSKYVDRLLQYYEENPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKH
FT                   VIYVWIDALANYITALGYGTDNDEKFRKYWPADVHLVGKEIIRFHTIYWPIMLMALDLP
FT                   LPKKVFGHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPE
FT                   GFIERINYDLANDLGNLLNRTVAMIKKYFDGVIPPYRGPKTPFDEELVQTAREVVRQYE
FT                   EAMERMEFSVALASVWQLIGRTNKYIDETQPWVLAKDESKREELASVMTHLAESLRHTA
FT                   VLLQPFLTRTPERIFAQLGIADRSLKEWDSLYEFGLIPEGTNVQKGEPLFPRLDIEAEV
FT                   EYIKAHMQGGKPAVEPVKEEKQAAETAEISIDEFAKVDLRVAEVVHAERMKNANKLLNL
FT                   QLDLGGEKRQVISGIAEFYKPEELIGKKVICVANLKPAKLRGEWSEGMILAGGNGGEFS
FT                   LATVDQHVPNGTKIK"
FT   gene            44179..44949
FT                   /locus_tag="GTNG_0031"
FT   CDS_pept        44179..44949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0031"
FT                   /product="Deoxyribonuclease TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65418"
FT                   /db_xref="GOA:A4IJB4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJB4"
FT                   /protein_id="ABO65418.1"
FT                   /translation="MLFDTHAHLNAVQYEEDLEQVIERARAEGVSYIVVVGFDRLTIDR
FT                   AIELAERYPFIYAAVGWHPVDAIDMTDDDLQMIEQLASHPKVVALGEMGLDYHWDKSPK
FT                   DVQQDVFRRQIALAKKVKLPIIIHNREATADILKILQEENAAEVGGIMHCFSGSVEVAR
FT                   QCIEMNFLISLGGPVTFKNAKKPKEVAKEIPLSHLLIETDCPYLTPHPFRGKRNEPSYV
FT                   KYVAEAIAEIKNVSFDEVAKTTMENAKRLFAIDR"
FT   gene            45151..46383
FT                   /locus_tag="GTNG_0032"
FT   CDS_pept        45151..46383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0032"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65419"
FT                   /db_xref="GOA:A4IJB5"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJB5"
FT                   /protein_id="ABO65419.1"
FT                   /translation="MAPNGRKWLDLWRKNVTATASGFLAISATTGVAGYEMAKDDVTLT
FT                   ANGKKQEIRTHAENVKELLEEQGIRPRKEDYVYPSLNTPITDDLHIIWEASKEVTLTVN
FT                   GKAKKVWTTADTVEELLRSQHVAVGPYDKVTPTLSAKIKKGMDIGVEKAFPVRVNVGGK
FT                   QQQAWTTSTTVADFLKQQGIELGELDRIEPSLQEKVKEQMTIHITRVKKVTDVVEEPVD
FT                   FAVMTKQDSSLPKGERRVIEPGEKGKIEKTYEVTFENGKEVARKLIATKTVKESKARIV
FT                   AIGTKTVEPPKPSAIGTKTKRSDQPSSRGSNQAAKTFYVTATAYTAYCKGCSGVTRTGV
FT                   NLRQNPSTKVIAVDPSIIPLGSKVYVEGYGYAIAADTGSGIKGYEIDVFFPEESDAMRW
FT                   GRKRVKIRVLP"
FT   gene            46262..46642
FT                   /locus_tag="GTNG_0033"
FT   CDS_pept        46262..46642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65420"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJB6"
FT                   /protein_id="ABO65420.1"
FT                   /translation="MPLPLTPAQALKDTKLMYFSRKSQMRCVGEESASKYGYCHRNALE
FT                   EQSGGFFPSAFFRYNDIVPRQCALHHFCLIRRYNRKKVSTELKKIKGKWSNSGEGSSYY
FT                   LFYRKGGIAEIGKNSYSAIFLQ"
FT   gene            46671..47210
FT                   /locus_tag="GTNG_0034"
FT   CDS_pept        46671..47210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0034"
FT                   /product="Ribonuclease M5"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65421"
FT                   /db_xref="GOA:A4IJB7"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJB7"
FT                   /protein_id="ABO65421.1"
FT                   /translation="MEGKDDTAAIRRAVDADTIETNGAAVGMDVIERIKLAKERRGVII
FT                   FTDPDFPGEKIRRTIAEQVPGCKHAFLSREAAKAKNGKGVGVEHASPDEIRQALANVYE
FT                   EVADWQEEITFAELIEAGLVGGEMARRRRLRLGEELKIGYANGRQFHKRLKVFRISRDA
FT                   FYAALAQVMQEEAGDA"
FT   gene            47203..48084
FT                   /locus_tag="GTNG_0035"
FT   CDS_pept        47203..48084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0035"
FT                   /product="Dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65422"
FT                   /db_xref="GOA:A4IJB8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJB8"
FT                   /protein_id="ABO65422.1"
FT                   /translation="MHKDIATPGRTKEILARYGFSFKKSLGQNFLIDTNILRKIVDAAG
FT                   ISGDTGAIEIGPGIGALTEQLARRAKKVVAFEIDSRLLPILADTLSAYDNVRIIHQDVL
FT                   KADLHAVIAEEFAEVSDRMVVANLPYYVTTPIIMKLLTERLPIRGMVVMMQKEVADRLA
FT                   AKPGTKDYGSLTIAVQYYTEAEVVMTVPRTVFMPQPNVDSAVIRLTKRSHPPVAVEDEE
FT                   VFFQVVRASFAQRRKTLLNNLLNNLPDGKEKKEQIERALDAVGIDPRRRGETLDMAEFA
FT                   SLSNALMPLFRV"
FT   gene            48178..49077
FT                   /gene="yabG"
FT                   /locus_tag="GTNG_0036"
FT   CDS_pept        48178..49077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabG"
FT                   /locus_tag="GTNG_0036"
FT                   /product="Sporulation-specific protease YabG"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65423"
FT                   /db_xref="GOA:A4IJB9"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJB9"
FT                   /protein_id="ABO65423.1"
FT                   /translation="MDVKIGDIVARKSYQCDLLFRVIDIKERDGEREAILHGEDVRLVA
FT                   DAPCSDLVIIDEQERQERKKREIELIEQSYRLFRQDYQTIKQKVEYRATGGYRVEKDFF
FT                   QIPGRVLHLDGDPVYLRKCLDLYERIGVPVHGVYCEESEMPEKVGSLIEQFRPDILVIT
FT                   GHDSYSKSKGKVHDLKAYRHSRHFVQTVKEARKKVPHLDQLIVFAGACQSHFESLIRAG
FT                   ANFASSPARVNIHALDPVYIVSRLSFTPFTETADVWDVLRNTLTGEKGLGGVETKGVLR
FT                   TGMPFRLIEEERGGNRRN"
FT   gene            49260..49517
FT                   /locus_tag="GTNG_0037"
FT   CDS_pept        49260..49517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0037"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65424"
FT                   /db_xref="GOA:A4IJC0"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJC0"
FT                   /protein_id="ABO65424.1"
FT                   /translation="MPKTLSDIKKTLDSNIGRRLTLRANGGRRKMIERCGILAETYPSV
FT                   FVIELDQKENSFERVSFSYADVLTETVKLTFWDDEQAGGQ"
FT   gene            49871..50050
FT                   /locus_tag="GTNG_0038"
FT   CDS_pept        49871..50050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0038"
FT                   /product="Small acid-soluble spore protein,
FT                   minoralpha/beta-type SASP"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65425"
FT                   /db_xref="GOA:A4IJC1"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJC1"
FT                   /protein_id="ABO65425.1"
FT                   /translation="MGRRRGVMSQRLKEELAKELGFYDVVQREGWGAIRAKDAGNMVRL
FT                   AIERAERQLAGKTE"
FT   gene            50288..51160
FT                   /locus_tag="GTNG_0039"
FT   CDS_pept        50288..51160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0039"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65426"
FT                   /db_xref="GOA:A4IJC2"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJC2"
FT                   /protein_id="ABO65426.1"
FT                   /translation="MRLSVKAPAKINLSLDVLYKRPDGYHEVKMVMTTIDLADRIELIP
FT                   LPGEDAIRVVSQNRFVPDDSRNLAYQAAQLLKETFSIREGVAISITKHIPVAAGLAGGS
FT                   SDAAATLRGLNKLWKLGLSVHELAELGAQIGSDVAFCVYGGTAVATGRGEIITPISSPP
FT                   PCWVVLAKPPIGVSTAEVYRNLQLEHVNHPDVDAMVGAIEQQDYAAICRSVGNVLEEVT
FT                   LKKYPEVAHIKEQMRRFGADAVLMSGSGPTVFGLIEHDSRMQRVYNGLRGFCDQVFAVR
FT                   LLGERHSLD"
FT   gene            51215..52039
FT                   /locus_tag="GTNG_0040"
FT   CDS_pept        51215..52039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0040"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65427"
FT                   /db_xref="GOA:A4IJC3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJC3"
FT                   /protein_id="ABO65427.1"
FT                   /translation="MKLRRSGRLVDMTHYLLERPHHLIPLTFFAERYESAKSSISEDLT
FT                   IIKQTFEQQGIGTVRTLPGRSRRRAIHSENDRRGSRRKLSPICVNSCRGPDRLLPGGYL
FT                   YMTDILGDPRIMNKIGRLYASIFADRPVDVVMTIATNGIPLAYAIANFLHVPVVIVRHD
FT                   NKVTEGPMVSINYVSGSSRRIQTMVLSKRSLAEGSNVLIVDDFMKAGGTVNGMVSLLQE
FT                   FNGNVSGIGVLVESEEAKERLVDEYISLVKLSAVDIKEKRIAVKEGNYKAFV"
FT   gene            52092..52466
FT                   /locus_tag="GTNG_0041"
FT   CDS_pept        52092..52466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0041"
FT                   /product="Translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65428"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJC4"
FT                   /protein_id="ABO65428.1"
FT                   /translation="MRKVETKNAPQAIGPYSQGIIVNNMFYSSGQIPLTPEGELVKGDI
FT                   QAQTHQVFQNLKAVLEAAGASLETVVKTTVFIKNMDDFAAMNEVYSQYFPNHKPARSCV
FT                   EVARLPKDVLVEIEVVALVP"
FT   gene            52591..52881
FT                   /locus_tag="GTNG_0042"
FT   CDS_pept        52591..52881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0042"
FT                   /product="Stage V sporulation protein G"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65429"
FT                   /db_xref="GOA:A4IJC5"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJC5"
FT                   /protein_id="ABO65429.1"
FT                   /translation="MEVTDVRLRRVNTEGRMKAIASITLDNEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSATRGKIQEAILAEYHRLGKLEEELEEAGAS"
FT   gene            53014..54393
FT                   /locus_tag="GTNG_0043"
FT   CDS_pept        53014..54393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0043"
FT                   /product="Glucosamine-1-phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65430"
FT                   /db_xref="GOA:A4IJC6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJC6"
FT                   /protein_id="ABO65430.1"
FT                   /translation="MVKRYAVILAAGQGTRMKSKLYKVLHPVCGKPMVQHVVDQVSKLG
FT                   VEKTIAVVGFGAEQVKEQLGAQCEYALQEKQLGTAHAVMQAAPHLQNLEGITIVVCGDT
FT                   PLITAETMEALLEHHMTAGAKATVLTAIADDPTGYGRIVRNSDGHVEKIVEHKDANEQE
FT                   REIREINTGTYCFDNRMLFQALTKVTNNNAQGEYYLTDVIEIIKADGGIVSAYQAPSFD
FT                   ETIGINDRIALAEAERIMRDRICRQHMKNGVTIIDPACTYISAEATIGRDTVIYPGTVI
FT                   EGKTVIGEDCTIGPHSEIKNCHIGHRTSIRHSVAHDSEIGDDVTIGPFAHIRPLSKIDD
FT                   EVRIGNFVEVKKSTFGKGSKASHLSYIGDAEVGADVNLGCGSITVNYDGVHKYRTKIED
FT                   GAFIGCNANLIAPVTIGQGAYVAAGSTVTDDVPGRALAIGRARQVNKENYVDRLRGKKK
FT                   S"
FT   gene            54406..55353
FT                   /locus_tag="GTNG_0044"
FT   CDS_pept        54406..55353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0044"
FT                   /product="Phosphoribosyl diphosphate
FT                   synthetase/ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65431"
FT                   /db_xref="GOA:A4IJC7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJC7"
FT                   /protein_id="ABO65431.1"
FT                   /translation="MSECQHQLKLFALNSNMKLAKQIAETMGIELGKCSVSRFSDGEIQ
FT                   INIEESIRGDDVFVIQSTSVPVNEHLMELLIMIDALKRASARTINIVMPYYGYARQDRK
FT                   ARSREPITAKLVANLLETAGASRVITLDLHAPQIQGFFDIPIDHLMGVPILADYFKSKQ
FT                   LDDVVIVSPDHGGVTRARKLADRLKAPLAIIDKRRPRPNAVEVMNIIGQVKGKTAILID
FT                   DIIDTAGTITLGANALVENGAKEVYACCTHPVLSGPAIERIQNSKIKELVVTNSIALPE
FT                   EKKIDKIVELSVAPLIAEAITRVYEMQSVSVLFD"
FT   gene            55429..56061
FT                   /locus_tag="GTNG_0045"
FT   CDS_pept        55429..56061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0045"
FT                   /product="General stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65432"
FT                   /db_xref="GOA:A4IJC8"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJC8"
FT                   /protein_id="ABO65432.1"
FT                   /translation="MAIVLGAKERKDKKHSTLRRIRSQGGIPAVLYGKKVDNKMISISA
FT                   ADLEKALREGGRHSLVTLKVDGEDYSVLLREVQRDPLRGELLHADFQAVDMSAEVDVDV
FT                   EVRLVGEAPGVKDGGVLQQNLHELSIRVLPANIPPAIEVDISGLQVGDVITVGDVQTGG
FT                   TFEINHEPSEVIATILPPQQEEEIHSGEQQEPGQPEAEEGRETTPEG"
FT   gene            56122..56682
FT                   /locus_tag="GTNG_0046"
FT   CDS_pept        56122..56682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0046"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65433"
FT                   /db_xref="GOA:A4IJC9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJC9"
FT                   /protein_id="ABO65433.1"
FT                   /translation="MKLFVGLGNPGKEYEQTRHNIGFFVIDELAKRWNVSLKTAKFRGL
FT                   FGTASVFGEKVALCKPLTYMNLSGECVCPLIDFYDIAVDDVIIIYDDLDLPPGKIRLRL
FT                   KGGSGGHNGVKSIIHHLGTEQFKRIRIGIGRPTNGQPVADYVLSRFTEEEKPAVMEAVL
FT                   RAADACEQAVTTPFIQVMNDFNE"
FT   gene            56785..57015
FT                   /locus_tag="GTNG_0047"
FT   CDS_pept        56785..57015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0047"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65434"
FT                   /db_xref="GOA:A4IJD0"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJD0"
FT                   /protein_id="ABO65434.1"
FT                   /translation="MALHYYCRHCGAKVGTIDHVSIYSEKLGFHHLTEEERLDMISYEP
FT                   NGDIHVKTICEDCQEALVRNPEWHQYEKFIH"
FT   gene            57105..60638
FT                   /locus_tag="GTNG_0048"
FT   CDS_pept        57105..60638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0048"
FT                   /product="Transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65435"
FT                   /db_xref="GOA:A4IJD1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJD1"
FT                   /protein_id="ABO65435.1"
FT                   /translation="MLSLHRYLAENQDVRTIIEGIHVRLKEQLVAGLSGSARSVFISTL
FT                   YKETGRPMLVVAHNLFQAQKIYDDLVSLLGPDDVFLYSVNEVIAAEMAVASPELKAQRL
FT                   EIMNHWAQEGKGVVVCPVAGLRRLLPPLSLWKHYLFTFSVGQELDLERYKQLFVEMGYK
FT                   RVATVSAPGEFSIRGGIVDIYPLTAELPYRIELFDTEIESIRTFTPDDQRSHEQVDRVM
FT                   IGPADEIILNEEARQRGIERIEAGLAASLENIKDDAAKQRMYEHIHAELEQLREGQEIE
FT                   QQYKYMSLFYEKAASLLDYLPEDGVLLMDEMSRLQEAAERLDREEAEWYTSLLDGGKMI
FT                   HDVPISHSFSELLQKSRFQRVYLSLFLRHAPHTHPQNVVNITCKQMQNFHGQMALLQSE
FT                   IERWKKANYAVVFLAPDAERVKKLQSLLEDYEIDALPLPHEAALLHGKCQLLQGDLNTG
FT                   FELPLQKLAVITEEELFKKRAKRPVRRQKLSNAERIKSYAELQVGDYVVHVNHGIGKYL
FT                   GIETLEINGVHKDYIHIQYQGGDTLYVPVDQMDQVQKYVGSEGKEPKIYKLGGTEWKKV
FT                   KKKVESSVQDIAEDLIKLYAEREASKGYAFSQDTEMQREFEAAFPYQETEDQLRSIEEI
FT                   KRDMESEKPMDRLLCGDVGYGKTEVALRAAFKAIMDGKQVAFLVPTTILAQQHYETVRE
FT                   RFQGFPINVGVLNRFRTRKQQAETIKGLKDGTIDMVIGTHRLLSKDVKFKDLGLLIIDE
FT                   EQRFGVAHKEKIKQLKANIDVLTLTATPIPRTLHMSMIGVRDLSIIETPPENRFPVQTY
FT                   VMEYTPELVKEAIERELARDGQVFFLYNHIEDIDLRAEEIAQLVPEARVTFAHGRMSEA
FT                   ELESTILAFLEGQYDVLVTTTIIETGVDIPNVNTLIVYDADRMGLSQLYQLRGRVGRSN
FT                   RVAYAYFTYRKDKVLNETAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNILGAEQHGF
FT                   IDSVGFDLYSQMLKEAIEKRRGLKQEEERPDVVIDVEVDAYIPDTYISDGLQKIEMYKR
FT                   FKAVETLEDVEMLREEMADRFGDYPDEVAYLFQIAEIKALAKQLGVESIKQHKQQIDLL
FT                   FTEQASKTVEIQRLSGIGRQYGRLFGFGMDGAKLKIVLYIKQMKPHEWLMILYETLKQL
FT                   FGVENEKSVIA"
FT   gene            60861..61397
FT                   /locus_tag="GTNG_0049"
FT   CDS_pept        60861..61397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0049"
FT                   /product="Stage V sporulation protein T"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65436"
FT                   /db_xref="GOA:A4IJD2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJD2"
FT                   /protein_id="ABO65436.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYAEALFDSLGQPVLICDRDVFIAVAGVSKKEYMNKSVSPLVEK
FT                   AMEERTSVLHTEEGEVELVDGMTETLKSYTIGPIVANGDPIGAVIILSREKTLGEVEHK
FT                   AVETAASFLARQMEQ"
FT   gene            61626..63182
FT                   /locus_tag="GTNG_0050"
FT   CDS_pept        61626..63182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0050"
FT                   /product="stage V sporulation protein B-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65437"
FT                   /db_xref="GOA:A4IJD3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJD3"
FT                   /protein_id="ABO65437.1"
FT                   /translation="MGNVWKGAAVLTVAALLTKLLSALYRIPYQNMVGDVGFYIYQQVY
FT                   PIYGIVVAMSLAGYPVAISKLIAKRFVEGDAAGAAAVRRIALLLLSALGVMLFAGLYAG
FT                   AETVASWMGDGRLEPLLRLLSFSFLFFPLIAVLRGYFQGQHDMMPTAVSQVGEQFVRVT
FT                   AILGLSYWAMRRGADVYSCGMAAIAGTLGGMAAALLILLFYSAKRRRKKTAGRTPTASF
FT                   LHVGRHLLTVGTIVCLTNMALTLIPLVDSFLFVPLLHETGASLDEVKWLKGVYDRGQPL
FT                   IQLGTVVGTSLSLALVPFISSAQRSQGAIFTQGLLPFRFAAVIGVGASLGLICLIRPIN
FT                   TMLFENDRGSLVLAVLSASVFFTTMALTSSAMLQGMGKEWAAAAGVAVAVAGKMALMHW
FT                   LVPPFGVLGAALATTGAYALMACFLYVCLRRECQLTNIQKYAYPIVKAGVAMVVVLQLY
FT                   MWLMDAAAGGRLWATAEALGGVAVGAIVYIVCIVKGNVFSEEELSALPLANKFRLLSGS
FT                   R"
FT   gene            63189..64649
FT                   /locus_tag="GTNG_0051"
FT   CDS_pept        63189..64649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0051"
FT                   /product="Tetrapyrrole methylase family protein, MazG
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65438"
FT                   /db_xref="GOA:A4IJD4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJD4"
FT                   /protein_id="ABO65438.1"
FT                   /translation="MNTIYIFGLGAGDFEQLPVGVYRKLKRAHPLFLRTKEHPAVKGLE
FT                   EEGITFTSFDDVYEKHEQFADVYAEIVSILVEQVKHGDVFYAVPGHPLVAEQTVQLLLE
FT                   EERRGVCRVMIEGGQSFFDALFAALRIDPIEGFQLLDATSFQGDEWSPSLHTVFCQVYD
FT                   SFVASNVKLSLMEQLPDDYLVYIVTAAGTKAEQVKQVPLYELDRQTVLDNLTSVYVPPV
FT                   KDEPLLYHRFETLRRVIATLRGPNGCPWDRKQTHASLKRYLLEEAYELLEAIDENDDDH
FT                   MVEELGDVLLQVMLHAQIGADDGLFSIDDVIRTLTAKMIRRHPHVFGNVTADTAEQVVV
FT                   NWEKIKKEEKGDEQPESLLADIPKSLPGTMRAYELQKKAAKVGFDWNDVEPIWQKVEEE
FT                   MAEFRAETSSGRRAELVSEFGDVMFALINLARYYGIQPEEALQRANDKFTRRFAYIEEQ
FT                   VRKSGRPITSFSLAELDRFWEEAKENGR"
FT   gene            64661..64942
FT                   /locus_tag="GTNG_0052"
FT   CDS_pept        64661..64942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0052"
FT                   /product="Heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65439"
FT                   /db_xref="GOA:A4IJD5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJD5"
FT                   /protein_id="ABO65439.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRVWINGHVAKASSNVKIGD
FT                   ELTIQFGQKRVTVKVADLKETTKKEEATGLYELIREERIASASEQDGV"
FT   gene            65059..65370
FT                   /locus_tag="GTNG_0053"
FT   CDS_pept        65059..65370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0053"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65440"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJD6"
FT                   /protein_id="ABO65440.1"
FT                   /translation="MNMNRHDEFSGNMNKGPVQEHDVIMRGRRLLDITGVKQVESFDNE
FT                   EFLLETVMGFLAIRGQNLQMKNLDVDKGVVSIKGRIFDLVYLDDHQEKAKGFFSKLFK"
FT   gene            65367..65999
FT                   /locus_tag="GTNG_0054"
FT   CDS_pept        65367..65999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0054"
FT                   /product="Spore cortex biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65441"
FT                   /db_xref="GOA:A4IJD7"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJD7"
FT                   /protein_id="ABO65441.1"
FT                   /translation="MSITTQLLTMLTMIGMGGWLGMALDTYNRFLKRDERAHWLVFVND
FT                   VLFWAVQALLVFYVLLLVNDGELRFYLFLALLCGYAAYQSLLRSLYVRVLEWIIWLAVR
FT                   IGQAFAQLFRHMVIRPLVLLGQMTLALLLFACRLVMWTVQFLLLVVWKTVLFLLAPLRW
FT                   IGIAVWRRVPPHRRAWVENFFHRLKGFAGQIKNTKDKIGIWFAKWRK"
FT   gene            66015..66386
FT                   /locus_tag="GTNG_0055"
FT   CDS_pept        66015..66386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0055"
FT                   /product="Cell-division initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65442"
FT                   /db_xref="GOA:A4IJD8"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJD8"
FT                   /protein_id="ABO65442.1"
FT                   /translation="MNVPRKPNVTKLQSSYVSEQEEKKRKASRRRRVVAVRLAFWASLF
FT                   MVLASVLIYTLHLQVKAIDAKTAEKQELKDQLAELEQQEKQLKEEMKKLHDDDYIAELA
FT                   RKKYYLSKDGEIIFVLPEE"
FT   gene            66507..66905
FT                   /locus_tag="GTNG_0056"
FT   CDS_pept        66507..66905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0056"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65443"
FT                   /db_xref="GOA:A4IJD9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJD9"
FT                   /protein_id="ABO65443.1"
FT                   /translation="MSIEVGSKLQGKVTGITKFGAFVELPEGVTGLVHISEVADNYVKD
FT                   INDHLKVGDMVYVKVINVGQDGKIGLSIRKAKDTPSSQRPRHRAHDRSAADSLEQKISR
FT                   FLKESEDRLASLRRHTESKRGGRGARRG"
FT   gene            67084..67160
FT                   /locus_tag="GTNG_t005"
FT   tRNA            67084..67160
FT                   /locus_tag="GTNG_t005"
FT                   /product="tRNA-Met"
FT   gene            67172..67243
FT                   /locus_tag="GTNG_t006"
FT   tRNA            67172..67243
FT                   /locus_tag="GTNG_t006"
FT                   /product="tRNA-Glu"
FT   gene            67440..69917
FT                   /locus_tag="GTNG_0057"
FT   CDS_pept        67440..69917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0057"
FT                   /product="Serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65444"
FT                   /db_xref="GOA:A4IJE0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJE0"
FT                   /protein_id="ABO65444.1"
FT                   /translation="MERVERGTVRRISEVRINETQATLSRWMRHVKLRLGHLFVHQGFL
FT                   LLLVGFLLGRALILAKLTPFALPFFVSVYMLRRDKAAFALVSLLAGAVTLSFDTVLFVG
FT                   ASIFGFLFIYSWVRKVISESLKLVPFVVFAVSLATKWLISYYWLGERTAYGVAMAVVEA
FT                   GLSLVLTLIFMQSIPLLTVQKHKHALRAEEMISLIILLASMLTGMIGWSAYGLSLEHVM
FT                   SRYLVLLFAFVAGAATGSTVGVVTGLVLSLANVGNLSEMSLLAFAGLLGGLLKEGKKIG
FT                   VAFGLIVATLLMGLYGEGKAELMPTLLESSIAIMLFLCTAHSLTEKIAKHIPGTAEYIN
FT                   EQQQYVRKIRDVTAQRVSQFSNVFQALAESFSPGPLSDSDEYHEREVDYFLGDITEKTC
FT                   QTCFKKAQCWVANFSTTYAYMKQMMHEADEKTLAQNHQLLREWERYCVKAGKVVDTIEK
FT                   EMVIYQANRKLKRQVYESRKLVAEQLLGVSQVMDDFAKEIQKERENHYLQEEQIYHALQ
FT                   EFGIEIGHVDIYSLEKGNIDIEMSIPYCEGRGECEKLIAPMLSDILGETIVVKREECAA
FT                   YPNGYCRVAFGSTKAFVVETGVAFAAKGGGLISGDSYATIELGTGKYAVAISDGMGNGE
FT                   RAHYESHETLHLLQKILQTGMDESIAIKSINSILALRTTEDMYATLDLAIIDLQNAATK
FT                   FLKIGSMPSFIKRGDKVMKVEASNLPMGIIKEVEFDVVSEQLKSGDLLIMMSDGVFEGP
FT                   MNVENHDLWMKRKIQELKTTDPQEVADVIMEEVIRQCGGEIEDDMTVVVAKVRHNTPKW
FT                   ATIPAYMYMKKAQ"
FT   gene            69984..70724
FT                   /locus_tag="GTNG_0058"
FT   CDS_pept        69984..70724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0058"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65445"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJE1"
FT                   /protein_id="ABO65445.1"
FT                   /translation="MRKGTLRQILLITDGCSNHGEDPAAMAALAREQGITVNVIGVLDQ
FT                   DTIDENGQREIEAIAAAGGGMSQVVYARQLSQTVQMVTRQAMTQTLQGLVNRELKQIFG
FT                   SDVSLEDLPPDKRGQVMEVVDELGETAALDVLILIDTSGSMKTKLPTVKEALVDLSLSL
FT                   NARMGENRFSVFIFPGKRQHAEKMIDWTPRIEELSTIFPKLASGGLTPTGPALREAIAH
FT                   FDRKRSLRSWIGNGDEPYIEESSL"
FT   gene            70687..71664
FT                   /locus_tag="GTNG_0059"
FT   CDS_pept        70687..71664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0059"
FT                   /product="Serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65446"
FT                   /db_xref="GOA:A4IJE2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJE2"
FT                   /protein_id="ABO65446.1"
FT                   /translation="MAMSHTLKNRLCNLPPGTVVTGKWHGRSYRLLRRLGSGANGVVYL
FT                   AESGCNRVAVKLSDDYASLASEMNILRRFSKVQGGALGPSLLEADDWRSPLVQETIPFY
FT                   VMEYIEGENFTTFVRRRGKEWAPVLLVQLLSVLERLHEEGWVFGDLKPDNLIVTGPPPS
FT                   VRLLDVGGTTLQGRAVKEFTELYDRGYWGLGSRKAEPSYDLFSAAMVMIASCYSGHLEK
FT                   KGDGRSQLFRIIEADRFLAQYKHVLQKALDGRYAKAADMRRDLLAASSRRLAVKDETKI
FT                   VSSNRRSGRRAKKRRKVGAIAETVLIAVLLLGAYGFYIYWQLTM"
FT   gene            71720..73114
FT                   /gene="mesJ"
FT                   /locus_tag="GTNG_0060"
FT   CDS_pept        71720..73114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="GTNG_0060"
FT                   /product="Cell cycle protein MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65447"
FT                   /db_xref="GOA:A4IJE3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJE3"
FT                   /protein_id="ABO65447.1"
FT                   /translation="MVDKVRAFIDRHRLLTEGATVIVGVSGGPDSLALLHLLSSLRDEW
FT                   KLQLVAAHVDHMFRGRESEEEMEFVKHFCAEHRILCEAVQIDVPAFQRRTGLGAQEAAR
FT                   NCRYHFFAELVKKYQAQYVALGHHGDDQVETILMRLVRGSTSKGYAGIPVKRPFHGSYL
FT                   IRPFLAVSRAEIEDYCKKEGLTPRRDPSNEKDDYTRNRFRHHIVPLLKQENPRLHERFQ
FT                   QYSEMMAEDEQFLEELATDALNKVMEKQNSDVVLRIAPFLALPRPLQRRVLQLLLLRLY
FT                   GGIPPVLTSVHIGHILMLCERDHPSGMLDLPKGLKVIRSYDRCLFTFGLQHCAQSYWLE
FT                   LPVPALLPLPNGYVIISEIGEHYPRKQLGNDSFVVDPATVSLPLHVRTRRTGDRMVLKG
FT                   TGGTKKIKEIFIEAKIPRMERDCWPIVEDADGRILWVPGLKKSAFEAGEHRQTRYILLH
FT                   YQAMNS"
FT   gene            73126..73671
FT                   /locus_tag="GTNG_0061"
FT   CDS_pept        73126..73671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0061"
FT                   /product="Hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65448"
FT                   /db_xref="GOA:A4IJE4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJE4"
FT                   /protein_id="ABO65448.1"
FT                   /translation="MGMKDDIQKVLITEEEIQAKVKELGAILTKEYDGRFPLAVGVLKG
FT                   AMPFMADLLKHIDTYLEMDFMDVSSYGNATISSGEVKIIKDLNTSVEGRDILIIEDIID
FT                   SGLTLSYLVDLFRYRKANSIKIVTLLDKPSGRKADIQADYAGFTVPDEFVVGYGLDYAE
FT                   KYRNLPFIGVLKPEVYQK"
FT   gene            73766..75661
FT                   /locus_tag="GTNG_0062"
FT   CDS_pept        73766..75661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0062"
FT                   /product="Cell-division protein and general stress
FT                   protein(class III heat-shock)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65449"
FT                   /db_xref="GOA:A4IJE5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJE5"
FT                   /protein_id="ABO65449.1"
FT                   /translation="MNRIFRNTIFYLLIFLVVIGVVSFFNGTNQRTEPMTYDAFITHLE
FT                   NGEVKSFSIKPERGVYEIRGQLKTYNEGQYFSTYVINSDKVLDRIDAAAARARVEVMPA
FT                   DETSGWVTFFTSIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSRARLYTDDKRKVRFRD
FT                   VAGADEEKEELVEIVEFLKDPRKFAELGARIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFETAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDER
FT                   EQTLNQLLVEMDGFNGNEGIIIIAATNRPDILDPALLRPGRFDRQITVDRPDVKGREAV
FT                   LRVHARNKPLDESVDLKTIAMRTPGFSGADLENLLNEAALVAARRNKKKIDMDDIDEAT
FT                   DRVIAGPAKKSRVISEKERRIVAFHEAGHTVIGMVLADAEMVHKVTIVPRGQAGGYAVM
FT                   LPKEDRYFMTKEELMDKITGLLGGRVAEEIVFNEVSTGAHNDFQRATNIARRMVTEFGM
FT                   SEKLGPLQFGQPSGQVFLGRDLHNEQNYSDKIAYEIDLEIQRIIKECYDKAKQLLTQHR
FT                   DKLDLIATTLLEVETLDAEQIKHLFEHGTLPPDRNGRNDTGKGDDDVKVNIQKKE"
FT   gene            75893..76669
FT                   /gene="coaA"
FT                   /locus_tag="GTNG_0063"
FT   CDS_pept        75893..76669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="GTNG_0063"
FT                   /product="Pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65450"
FT                   /db_xref="GOA:A4IJE6"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJE6"
FT                   /protein_id="ABO65450.1"
FT                   /translation="MIFVLDVGNTNTVLGVYDGDELKYHWRIETSRAKTEDEYGMTIKA
FT                   LLNHVGLQFSDIRGMIISSVVPPIMFALERMCLKYFHIKPLIVGPGIKTGLDIKYENPR
FT                   EVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEHKQYMGGAIAPGIMISTEALFA
FT                   RAAKLPRIEIARPDDIVGKNTVSAMQAGILYGYVGQVEGIVSRMKAKSKVPPKVIATGG
FT                   LAPLIASESSVIDVVDPFLTLTGLKLLYEKNTEKKG"
FT   gene            76678..77568
FT                   /locus_tag="GTNG_0064"
FT   CDS_pept        76678..77568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0064"
FT                   /product="Putative 30 kDa replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65451"
FT                   /db_xref="GOA:A4IJE7"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJE7"
FT                   /protein_id="ABO65451.1"
FT                   /translation="MNMGDYLVKALAYDGQVRAYATRTTETVAEAQRRHQTWPTASAAL
FT                   GRALTAGVMMGAMLKGEETLTIKIDGGGPIGVILVDSNAKGEVRGYVTNPHVHFELNEH
FT                   GKLDVARAVGKNGMLTVVKDLGLRDFFTGQVPLISGELGDDFTYYFASSEQIPSSVGVG
FT                   VLVNPDYTIRAAGGFIIQIMPGTKEATIARIEERLKQIPPVSRMIENGLSPEQMLEQIL
FT                   GDGDVRVLETMPVTFVCRCSRERIADALVSLGPEEIQDIIDNEGQAEASCHFCNETYHF
FT                   AKEELEQLKQLAEKR"
FT   gene            77655..78581
FT                   /locus_tag="GTNG_0065"
FT   CDS_pept        77655..78581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0065"
FT                   /product="O-acetyl-L-serine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65452"
FT                   /db_xref="GOA:A4IJE8"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJE8"
FT                   /protein_id="ABO65452.1"
FT                   /translation="MARTVNSVTELIGDTPAVKLNRIVDEDSADVYVKLEFMNPGSSVK
FT                   DRIALAMIEAAEKAGRLKPGDTIVEPTSGNTGIGLAMVAAAKGYKAVLVMPDTMSLERR
FT                   NLLRAYGAELVLTPGAQGMRGAIQKAEELAREHGYFMPQQFKNEANPEIHRLTTGKEIV
FT                   EQMGDQLDAFVAGIGTGGTITGAGKVLREAYPNIKIYAVEPADSPVLSGGKPGPHKIQG
FT                   IGAGFVPDILDTSIYDGVITVTTEEAFAAARRAAREEGILGGISSGAAIHAALKVAKEL
FT                   GKGKKVLAVIPSNGERYLSTPLYQFEN"
FT   gene            78696..80117
FT                   /locus_tag="GTNG_0066"
FT   CDS_pept        78696..80117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0066"
FT                   /product="P-aminobenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65453"
FT                   /db_xref="GOA:A4IJE9"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJE9"
FT                   /protein_id="ABO65453.1"
FT                   /translation="MEQRRRRLKRTIDYSGRDWFRQYEQLAYGRPHHVLLESGQGGRYS
FT                   IIGLNPSGIIRATEQRLSIIYRGKETTLDGPPLELLQQWFSHFLMPDEDEPLPCQGGLI
FT                   GYISYDSVRYIERLPELAHDDLQLPFMYFWLFDDVAIYDHQEQQLHLIVHASDGEEQAA
FT                   FRRLDMYEQMWLEEQSESPRWSTAGSAAAPSVSMTKQQFIEAVQRVKQYIAQGDVFQVN
FT                   LSVRQSQPLLAHPFAVYKQLRTINPSPYMGYLHTPQFQVVSGSPELLVRKRGQRLETRP
FT                   IAGTRSRGRTKTEDEQIAQKLLASEKERAEHAMLVDLERNDLGRVCAYGTVHVDEWMTV
FT                   ERYSHVMHIVSHVSGTIAPEYDAFAVIRAMFPGGTITGAPKVRTMEIIEELEPVRRGLY
FT                   TGSIGWIDFQGNMELNIAIRTMVVKDGIAHVQAGAGIVIDSNPEHEYKECLKKAAALWR
FT                   AKELSEAETLFSSMR"
FT   gene            80120..80698
FT                   /locus_tag="GTNG_0067"
FT   CDS_pept        80120..80698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0067"
FT                   /product="Anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65454"
FT                   /db_xref="GOA:A4IJF0"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJF0"
FT                   /protein_id="ABO65454.1"
FT                   /translation="MMIVMIDNYDSFTYNLVQYLGVLGEELLVKRNDEITVSEIERLAP
FT                   DFIMISPGPCTPNEAGVSLEAITYFAGKIPIFGVCLGHQSIAQAFGGRVIRASRLMHGK
FT                   TSSVYHDGETIFQGVPSPFTATRYHSLIVDKETLPDCFTVSAWTDEDEVMAIRHKTLPI
FT                   EGVQFHPESIMTSHGMQLLKNFIDTYKKA"
FT   gene            80698..81582
FT                   /locus_tag="GTNG_0068"
FT   CDS_pept        80698..81582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0068"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65455"
FT                   /db_xref="GOA:A4IJF1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJF1"
FT                   /protein_id="ABO65455.1"
FT                   /translation="MDHMYVYVNGKIVPREEAQLSAFDHGFLYGLGLFETFRTYDGHPF
FT                   LLDDHLARLNCGLSELHIARQFGRAEAVDIIERLLRANGLRDAYVRFNVSAGVGDLGLS
FT                   TEQYLRPTIIVYMKPLPPAAPQEGKEGVVLTTTRNSPEGDQRLKSHHYLNNMIGKWELG
FT                   NRPHAEGIFLNREGAVAEGIVSNIFWIKGGVVYTPAPSVGILNGITRQFVIALLNELHI
FT                   PVEEGVYPLSDLYEADEVFITNSLQEIVPLHRIGHRVYLGQNGPVTCALQRHYRRFTDT
FT                   LWTRNELSERMNR"
FT   gene            81579..82433
FT                   /locus_tag="GTNG_0069"
FT   CDS_pept        81579..82433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0069"
FT                   /product="Dihydropteroate synthase,
FT                   dihydropteroatepyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65456"
FT                   /db_xref="GOA:A4IJF2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJF2"
FT                   /protein_id="ABO65456.1"
FT                   /translation="MMITMTRSRVLQCRGHELDLGKKTLIMGIVNVTPDSFSDGGRFYD
FT                   VEKAVEHAKRLVAEGADIIDIGGESTRPGAEQVPLDEELRRVIPAVRAIASEVNVPISI
FT                   DTYKAEVARQAIEAGAHIINDVWGAKADPDMAHVAASYGVPIILMHNRHDMAYRDLISD
FT                   MIVDLEESICIVKQAGVKDENIILDPGIGFAKTFEHNLEVMRRLDEFAALGYPLLLGTS
FT                   RKRFIGHVLDVPVEERVEGTGATVCLGIVKGANIVRVHDVLPIARMAKMMDAMLGKGES
FT                   GHR"
FT   gene            82396..82785
FT                   /locus_tag="GTNG_0070"
FT   CDS_pept        82396..82785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0070"
FT                   /product="Dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65457"
FT                   /db_xref="GOA:A4IJF3"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJF3"
FT                   /protein_id="ABO65457.1"
FT                   /translation="MRCLGKGRAAIDKIYVREMEFYGYHGVLPEENVLGQKFVIDVTME
FT                   LDLRPAGRSDCLEHTINYADVYERCRTIVEERTFALIEAVAEAIADDLLAAFPAIQRCT
FT                   VRVTKPNPPIRGHYKHVAVEIVRGR"
FT   gene            82786..83313
FT                   /locus_tag="GTNG_0071"
FT   CDS_pept        82786..83313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0071"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65458"
FT                   /db_xref="GOA:A4IJF4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJF4"
FT                   /protein_id="ABO65458.1"
FT                   /translation="MENIVYISLGSNLGDRVYYLRSAIEALDRYEGISVKSSSSIYETD
FT                   PVGYVHQDKFLNMVVEVATTLSPFSLLNVTQQIEQEFGRKRGIRWGPRTLDLDILLYNH
FT                   ENIETEQLVIPHPRMAERAFVLIPLLEINSHLTIPNIFEPLTDIVDRLPDKEGVRVWKQ
FT                   KDGEDVFALFES"
FT   gene            83265..83486
FT                   /locus_tag="GTNG_0072"
FT   CDS_pept        83265..83486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0072"
FT                   /product="Transcriptional regulator Xre family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65459"
FT                   /db_xref="GOA:A4IJF5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJF5"
FT                   /protein_id="ABO65459.1"
FT                   /translation="MEAERWGRRIRAFRKLKGYTQERLAKELGVSVSILGEIERGNRMP
FT                   SDSLVEQIAELLNISVEELTPPKIESNQ"
FT   gene            83502..84503
FT                   /locus_tag="GTNG_0073"
FT   CDS_pept        83502..84503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0073"
FT                   /product="Transcriptional regulator involved in nitrogen
FT                   regulation, NifR3/Smm1 family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65460"
FT                   /db_xref="GOA:A4IJF6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJF6"
FT                   /protein_id="ABO65460.1"
FT                   /translation="MFRIGDVEIKNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KGIVYNNEKTLNMLYIDEREKPLSLQIFGGEKETLVKAAKFVDKNTNADIIDINMGCPV
FT                   PKVTNCDAGAKWLLDPNKIYDVVASIVDAVEKPVTVKMRIGWDEHHIYAVENAQAVERA
FT                   GGKAVAVHGRTRVQMYEGKADWNIIKQVKEAVNIPVIGNGDVKTPQDAKRMLEETGVDG
FT                   VMIGRAALGNPWMIYRTVHYLETGELIPEPTPTEKIDVCLLHLDRLIALKGEYIAVKEM
FT                   RKHAAWYLKGIRGAAKIRNAINECETRDELAALLLKVAQDAENQAAANARAV"
FT   gene            84588..86072
FT                   /locus_tag="GTNG_0074"
FT   CDS_pept        84588..86072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0074"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65461"
FT                   /db_xref="GOA:A4IJF7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJF7"
FT                   /protein_id="ABO65461.1"
FT                   /translation="MSHEELNDQLRVRREKLKKIEELGVDPFGKRFERTHKAEELFKLY
FT                   GDLSKEELEEQQIEVAVAGRIMTKRGKGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELF
FT                   KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDVEQRYRQRYL
FT                   DLTMNPQSKQTFITRSLIIQSMRRYLDSQGYLEVETPMMHAIAGGAAARPFITHHNALD
FT                   MTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDI
FT                   MKLTENLIAHIATEVLGTTKIQYGEHTVDLTPEWRRLHMVDAIKEYVGVDFWRHMDDEE
FT                   ARALAKEHGVEIAPHMTFGHIVNEFFEQKVESQLIQPTFIYGHPVEISPLAKKNPDDPR
FT                   FTDRFELFIVGREHANAFTELNDPIDQRQRFEAQLKEREQGNDEAHEMDEDFLEALEYG
FT                   MPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK"
FT   gene            86332..86448
FT                   /locus_tag="GTNG_5s003"
FT   rRNA            86332..86448
FT                   /locus_tag="GTNG_5s003"
FT                   /product="5S ribosomal RNA"
FT   gene            86454..86529
FT                   /locus_tag="GTNG_t007"
FT   tRNA            86454..86529
FT                   /locus_tag="GTNG_t007"
FT                   /product="tRNA-Val"
FT   gene            86671..86746
FT                   /locus_tag="GTNG_t008"
FT   tRNA            86671..86746
FT                   /locus_tag="GTNG_t008"
FT                   /product="tRNA-Lys"
FT   gene            86757..86841
FT                   /locus_tag="GTNG_t009"
FT   tRNA            86757..86841
FT                   /locus_tag="GTNG_t009"
FT                   /product="tRNA-Leu"
FT   gene            86853..86927
FT                   /locus_tag="GTNG_t010"
FT   tRNA            86853..86927
FT                   /locus_tag="GTNG_t010"
FT                   /product="tRNA-Gly"
FT   gene            86943..87028
FT                   /locus_tag="GTNG_t011"
FT   tRNA            86943..87028
FT                   /locus_tag="GTNG_t011"
FT                   /product="tRNA-Leu"
FT   gene            87032..87105
FT                   /locus_tag="GTNG_t012"
FT   tRNA            87032..87105
FT                   /locus_tag="GTNG_t012"
FT                   /product="tRNA-Arg"
FT   gene            87110..87183
FT                   /locus_tag="GTNG_t013"
FT   tRNA            87110..87183
FT                   /locus_tag="GTNG_t013"
FT                   /product="tRNA-Pro"
FT   gene            87196..87268
FT                   /locus_tag="GTNG_t014"
FT   tRNA            87196..87268
FT                   /locus_tag="GTNG_t014"
FT                   /product="tRNA-Ala"
FT   gene            87327..88874
FT                   /locus_tag="GTNG_16s003"
FT   rRNA            87327..88874
FT                   /locus_tag="GTNG_16s003"
FT                   /product="16S ribosomal RNA"
FT   gene            89262..92191
FT                   /locus_tag="GTNG_23s003"
FT   rRNA            89262..92191
FT                   /locus_tag="GTNG_23s003"
FT                   /product="23S ribosomal RNA"
FT   gene            92384..92500
FT                   /locus_tag="GTNG_5s004"
FT   rRNA            92384..92500
FT                   /locus_tag="GTNG_5s004"
FT                   /product="5S ribosomal RNA"
FT   gene            92771..93244
FT                   /locus_tag="GTNG_0075"
FT   CDS_pept        92771..93244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0075"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65462"
FT                   /db_xref="GOA:A4IJF8"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJF8"
FT                   /protein_id="ABO65462.1"
FT                   /translation="MGGRVPNISDIIEQYLKQVLNMSDQDIVEIKRSEIANKFQCVPSQ
FT                   INYVINTRFTLERGYIVESKRGGGGYIRIMKVKTKSEAHLIDQLLELVGHRISQSNAED
FT                   VVKRLVEEKVISEREAKIMLSVMDRSVLYIGLPERDELRARMLKAMLTSLKYK"
FT   gene            93259..93807
FT                   /locus_tag="GTNG_0076"
FT   CDS_pept        93259..93807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0076"
FT                   /product="ClpC ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65463"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJF9"
FT                   /protein_id="ABO65463.1"
FT                   /translation="MICQECKQRPATMHFTKIVNGEKTEFHLCEQCSKEHGHMFMLYGN
FT                   DDFSLNNLLAGLLNFQAPMKEMTANAFPNPDLLQCETCKMTYHQFTQIGRFGCADCYRT
FT                   FARYLPPILKRLHSGNNAHSGKIPKRKGGVLHLRKQLAVLKQKLQELVAREEFERAAEV
FT                   RDQIRSLEDELRQRGEGDM"
FT   gene            93812..94903
FT                   /locus_tag="GTNG_0077"
FT   CDS_pept        93812..94903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0077"
FT                   /product="Arginine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65464"
FT                   /db_xref="GOA:A4IJG0"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJG0"
FT                   /protein_id="ABO65464.1"
FT                   /translation="MSFEKFFNTAVSAWMSQEGPDSDIVLSSRIRLARNIVDFRFPTLF
FT                   SSEEAMQIVALFERTFAYRSYGGAGRFELLKMSELQPIEKRVLVEKHLISPHLAEDSPF
FT                   GACLLSENEEISIMINEEDHIRIQCLFPGLQLAEALEAASELDDWIEGHVNYAFDERLG
FT                   YLTSCPTNVGTGLRASVMMHLPALVLTQQINRIIPAINQLGLVVRGTYGEGSEALGNIF
FT                   QISNQLTLGKSEEDIIADLHTIVQQLIAQERAARQALVKTLGIQLEDKVFRSYGILANC
FT                   RVIESKEAAQCLSDVRLGIDLGYIKNVSRNILNELMILTQPGFLQQYAGGALRPEERDV
FT                   RRAALIRERLKMEERRKMEGDER"
FT   gene            94900..97335
FT                   /locus_tag="GTNG_0078"
FT   CDS_pept        94900..97335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0078"
FT                   /product="Negative regulator of genetic competence
FT                   ClpC/MecB"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65465"
FT                   /db_xref="GOA:A4IJG1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJG1"
FT                   /protein_id="ABO65465.1"
FT                   /translation="MMFGRFTERAQKVLALAQEEAIRLGHNNIGTEHILLGLIREGEGI
FT                   AAKALMALGLGPDKIQKEVESLIGRGNEVSHTIHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNESVSGHGGGGASHVNTPT
FT                   LDSLARDLTAIAREGRLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGL
FT                   AQQIVNNEVPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDE
FT                   LHTLIGAGGAEGAIDASNILKPALARGELQCIGATTLDEYRKYIEKDAALERRFQPIHV
FT                   DEPTVEESIQILKGLRDRYEAHHRVSISDEAIVQAVKLSDRYITDRFLPDKAIDLIDEA
FT                   CSKVRLRSFTAPPKLKELEQKLEEVRKEKDAAVQSQEFEKAASLRDMEQRLREELEETK
FT                   RAWKEKQGQENSEVTVEDIAAVVSSWTGIPVSKLAETETERLLKLEEILHARVVGQDEA
FT                   VKAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAEAMFGDEDALIRIDMS
FT                   EYMEKHSTSRLIGSPPGYVGYEEGGQLTEKVRRKPYSVVLLDEMEKAHPDVFNILLQVL
FT                   EDGRLTDSKGRTVDFRNTIIIMTSNVGADALKRNKYVGFNIQDGNQQYKDMKGKVMDEL
FT                   KKAFRPEFLNRIDEIIVFHSLEKDHLKQIVRLMADTLVKRLKEQDIDLELTEAAIEKIA
FT                   AEGFDLEYGARPLRRALQKHIEDRLSEELLKGTIAKGQKVAVDVKDGEFVVLSKQAVV"
FT   gene            97410..98783
FT                   /locus_tag="GTNG_0079"
FT   CDS_pept        97410..98783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0079"
FT                   /product="DNA repair protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65466"
FT                   /db_xref="GOA:A4IJG2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJG2"
FT                   /protein_id="ABO65466.1"
FT                   /translation="MAKKKTKFVCQECGYESAKWLGRCPGCQTWNSFVEEIERTKPAVR
FT                   GAFLHSEPSGPAKPIPITAVTAAQEPRIETKSVELNRVLGGGIVKGSLVLIGGDPGIGK
FT                   STLLLQTSAQLAAAGHTVLYISGEESVKQVKLRAGRLHAESHQLYVLAEADLEYIVTAI
FT                   ETIQPACVIVDSIQTVYRTDITSAPGSVAQVRECTAELMKIAKTKGIAIFIVGHVTKEG
FT                   AIAGPRLLEHMVDTVLYFEGERHHTYRILRAVKNRFGSTNEIGIFEMRDIGLREVENPS
FT                   EVFLEERSRGAAGSTVVAAMEGTRPVLVEIQALVSPTSFGNPRRMATGLDHNRVSLLMA
FT                   VLEKRVGLLLQNQDAYLKVAGGVKLDEPAIDLAVAVSIASSFRDRPTNPADVIIGEVGL
FT                   TGEVRRVSRIEQRVQEAVKLGFSRVIVPKNNLTGWQPPAGVNVIGVSHVAEALEHTML"
FT   gene            98989..100083
FT                   /locus_tag="GTNG_0080"
FT   CDS_pept        98989..100083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0080"
FT                   /product="Hypothetical membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65467"
FT                   /db_xref="GOA:A4IJG3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJG3"
FT                   /protein_id="ABO65467.1"
FT                   /translation="MVKRIVQLFFLAVGGTLGAMFLPDLLELLNVSGVSLVNNSYTLAV
FT                   LGAVVFFLLTFWLVDYVVDMIRWAEETLVKAPVADVLFGSLGLIFGLIIAFLVVMPLQS
FT                   FHIQVLNTVLPIFLTVLLGYLGFRVGLKKRNELMNLFSLSNRMTKKKGGEVENEASKGG
FT                   AVKILDTSVIIDGRIADICQTGFLEGPLVIPRFVLEELQHIADSSDVLKRNRGRRGLDI
FT                   LNRIQKEMAMKVEIHEADFSDVQEVDSKLVKLAKQLQGVVVTNDFNLNKVCELQNVRVL
FT                   NINDLANAVKPVVLPGEELNVHVIKDGKEHNQGVAYLDDGTMIVVEDGKEYIGKRVDVL
FT                   VTSVLQIFAGRMIFAKLKLLQKAL"
FT   gene            100105..100791
FT                   /locus_tag="GTNG_0081"
FT   CDS_pept        100105..100791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0081"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65468"
FT                   /db_xref="GOA:A4IJG4"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJG4"
FT                   /protein_id="ABO65468.1"
FT                   /translation="MNYEAIVLAAGQGKRMNAGMNKQFIELGGEPLIVRTLKVFDGDER
FT                   CNGIVLVVNPTERGQFEQLFERYRIRKVVAFADGGQERQHSVYNGLQALRSGEIVLIHD
FT                   GARPFVRIRHLHELADAAVQYGAAIPAVRVKDTIKKVDGLFVEQTIDRSSLWAVQTPQA
FT                   FRLSLIMEAHEEAKKAGYLGTDDASLVERLGRPVKILEGDYRNIKLTTPEDLLFAEAIL
FT                   ASRIAE"
FT   gene            100806..101288
FT                   /locus_tag="GTNG_0082"
FT   CDS_pept        100806..101288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0082"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65469"
FT                   /db_xref="GOA:A4IJG5"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJG5"
FT                   /protein_id="ABO65469.1"
FT                   /translation="MFRIGQGFDVHQFVEGRPLIIGGVHIPYEKGLLGHSDADVLLHAV
FT                   ADACLGAIGAGDIGRHFPDTDPRYKDADSAELLAHVWSLVRQEGYVLVNADCTIIAQKP
FT                   KMAPYIEEMKKVIARLLEAERSQVNVKATTTEKLGFTGREEGVAAQVVVLLQKSEA"
FT   gene            101498..102967
FT                   /locus_tag="GTNG_0083"
FT   CDS_pept        101498..102967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0083"
FT                   /product="Transfer RNA-Gln synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65470"
FT                   /db_xref="GOA:A4IJG6"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJG6"
FT                   /protein_id="ABO65470.1"
FT                   /translation="MAKNVRVRYAPSPTGHLHIGGARTALFNYLFARHYGGKMVVRIED
FT                   TDIERNVEGGEESQLENLKWLGIDYDESIDKDGGYGPYRQTERLDIYRKYVNELLEQGH
FT                   AYKCFCTPEELEREREEQRAAGIAAPQYSGKCRHLTPEQVAELEAQGKPYTIRLKVPEG
FT                   KTYEVDDLVRGKVTFESKDIGDWVIVKANGIPTYNFAVVIDDHLMEISHVFRGEEHLSN
FT                   TPKQLMVYEYFGWEPPQFAHMTLIVNEQRKKLSKRDESIIQFVSQYKELGYLPEAMFNF
FT                   FALLGWSPEGEEEIFTKDELIRIFDVARLSKSPSMFDTKKLTWMNNQYIKKLDLDRLVE
FT                   LALPHLVKAGRLPADMSDEQRQWARDLIALYQEQMSYGAEIVSLSELFFKEEVEYEDEA
FT                   RQVLAEEQVPDVLSAFLANVRELEPFTADEIKAAIKAVQKSTGQKGKKLFMPIRAAVTG
FT                   QTHGPELPFAIQLLGKQKVIERLERALHEKF"
FT   gene            103341..104015
FT                   /locus_tag="GTNG_0084"
FT   CDS_pept        103341..104015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0084"
FT                   /product="Serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65471"
FT                   /db_xref="GOA:A4IJG7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJG7"
FT                   /protein_id="ABO65471.1"
FT                   /translation="MFKTLKEDIEVIFDQDPAARSYLEVILTYSGLHAIWAHRIAHALY
FT                   KRKFFFLARLISQISRFFTGIEIHPGAKIGRRFFIDHGMGVVIGETCEIGDNVTVYQGV
FT                   TLGGTGKEKGKRHPTIKDNCLIAAGAKVLGSITIGENSKIGAGSVVLKDVPPNSTVVGI
FT                   PGRVVVRDGVKVKKDLNHTDLPDPIADRFRELEAEIARLQSELEALKQHERKSEYEQYP
FT                   TL"
FT   gene            103993..105396
FT                   /locus_tag="GTNG_0085"
FT   CDS_pept        103993..105396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0085"
FT                   /product="Cysteine-tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65472"
FT                   /db_xref="GOA:A4IJG8"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJG8"
FT                   /protein_id="ABO65472.1"
FT                   /translation="MSSIRLYNTLTRKKETFEPLEPNKVKMYVCGPTVYNYIHIGNARA
FT                   AIVFDTIRRYLEFRGYDVTYVSNFTDVDDKLIRAARELGESVPAIAERFIEAYFEDIEA
FT                   LGCKKADIHPRVTENIETIIEFIQALIDKGYAYEVDGDVYYRTRKFDGYGKLSHQSIDE
FT                   LQAGARIEVGEKKDDPLDFALWKAAKEGEISWDSPWGKGRPGWHIECSAMARKYLGDTI
FT                   DIHAGGQDLTFPHHENEIAQSEALTGKPFAKYWLHNGYLNINNEKMSKSLGNFVLVHDI
FT                   IRQIDPQVLRFFMLSVHYRHPINYSEELLESARRGLERLRTAYGNLQHRLGASTNLTDN
FT                   DGEWLSRLADIRASFIREMDDDFNTANGIAVLFELAKQANLYLQEKTTSENVIHAFLRE
FT                   FEQLMDVLGLTLKQEELLDEEIEALIRQRNEARKNRDFALADRIRDELKAKNIILEDTP
FT                   QGTRWKRGS"
FT   gene            105427..105822
FT                   /locus_tag="GTNG_0086"
FT   CDS_pept        105427..105822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0086"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65473"
FT                   /db_xref="GOA:A4IJG9"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJG9"
FT                   /protein_id="ABO65473.1"
FT                   /translation="MKQLNGLALAYIGDAVYEVYVRRHLLATGNVRPHELHRRAIRYVS
FT                   ARAQAKVILALLDEDALTDEEKAIVRRGRNAKSGTTPKNTDVQTYRHSTAFEALIGYHF
FT                   LRNDEKRVDELIGRSFAIIEREERALE"
FT   gene            105819..106559
FT                   /locus_tag="GTNG_0087"
FT   CDS_pept        105819..106559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0087"
FT                   /product="23S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65474"
FT                   /db_xref="GOA:A4IJH0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJH0"
FT                   /protein_id="ABO65474.1"
FT                   /translation="MMEYIIGRNPVIEALKSGRDINKIWIAEGAHRHAVEPVLDWAKRR
FT                   GVIVQYVPKRKLDQMAEGAHQGVIAQVAAYRYYEVDDLFARAAERGEAPFFLVLDELED
FT                   PHNLGAIMRTADAVGAHGVIIPKRRSVGLTPTVAKASTGAIEHIPVARVTNLARTIDEL
FT                   KERGVWVAGTDAAAKDDYRSLDGTMPLALVIGSEGKGISRLVLEKCDFLFRLPMRGHVT
FT                   SLNASVAASLLMYEVYRKRYPLGE"
FT   gene            106563..107075
FT                   /locus_tag="GTNG_0088"
FT   CDS_pept        106563..107075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0088"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65475"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJH1"
FT                   /protein_id="ABO65475.1"
FT                   /translation="MNILIVDGYNIIGAWPVLRQLKEEGDLAAARDLLIDKMADYKGFT
FT                   GDHVMIVFDAHLVPGNEKKYKNYDVDVIFTKENETADERIERLAKTLMNARTKVYVATS
FT                   DYTEQWTVFSQGALRKSARELLYEIEAVERDISKKLKEIKQHTPISKMPLNDRVAEIFE
FT                   KWRRGQK"
FT   gene            107145..107795
FT                   /locus_tag="GTNG_0089"
FT   CDS_pept        107145..107795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0089"
FT                   /product="RNA polymerase sigma-30 factor"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65476"
FT                   /db_xref="GOA:A4IJH2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJH2"
FT                   /protein_id="ABO65476.1"
FT                   /translation="MGECFRVDNVRDYQKLDDEQLVALVHQGDGEALDFLIHKYQNFVR
FT                   AKARSYFLVGADREDIVQEGMIGLYKAVRDFKGDKLSSFKAFAELCITRQMITAIKTAT
FT                   RQKHIPLNSYVSLDKPIYDDESDRTLMDVLSGTQATDPEELIVNREEVDDIELKMAELL
FT                   SDLERKVLALYLDGRSYQEISEELNRHVKSIDNALQRVKRKLEKYLEYREISL"
FT   gene            107902..108051
FT                   /gene="rpmG"
FT                   /locus_tag="GTNG_0090"
FT   CDS_pept        107902..108051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="GTNG_0090"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65477"
FT                   /db_xref="GOA:A4IJH3"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJH3"
FT                   /protein_id="ABO65477.1"
FT                   /translation="MRQKVTLACEQCGSRNYTTTKQMGRLGERLTANKFCSVCNKHTVH
FT                   RETK"
FT   gene            108092..108274
FT                   /locus_tag="GTNG_0091"
FT   CDS_pept        108092..108274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0091"
FT                   /product="Preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65478"
FT                   /db_xref="GOA:A4IJH4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="PDB:5EUL"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJH4"
FT                   /protein_id="ABO65478.1"
FT                   /translation="MQRVTNFFKEVVRELKKVSWPNRKELVNYTAVVLATVAFFTVFFA
FT                   VIDLGISQLIRLVFE"
FT   gene            108382..108915
FT                   /locus_tag="GTNG_0092"
FT   CDS_pept        108382..108915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0092"
FT                   /product="Transcription antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65479"
FT                   /db_xref="GOA:A4IJH5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJH5"
FT                   /protein_id="ABO65479.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEETE
FT                   TDIKNGKRKTTKKKVFPGYVLVEMVMTDDSWYVVRNTPGVTGFVGSSGAGSKPTPLMEE
FT                   EIKLILKRMGMPLAEVDVDYEVNETVRIKEGPFANFTGKVEAIDPDKQKVKLLVDMFGR
FT                   ETRVELEFSQIEKI"
FT   gene            109156..109581
FT                   /locus_tag="GTNG_0093"
FT   CDS_pept        109156..109581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0093"
FT                   /product="Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65480"
FT                   /db_xref="GOA:A4IJH6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJH6"
FT                   /protein_id="ABO65480.1"
FT                   /translation="MAKKVIKIVKLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNAR
FT                   TADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDK
FT                   VREIAELKMPDLNAASIEAAMRMVEGTARSMGIVIED"
FT   gene            109784..110485
FT                   /locus_tag="GTNG_0094"
FT   CDS_pept        109784..110485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0094"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65481"
FT                   /db_xref="GOA:A4IJH7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJH7"
FT                   /protein_id="ABO65481.1"
FT                   /translation="MPKRGKKYLEALKLVDRFKAYPVAEAIELVKKTNVAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVARVLVFAKGEKAKEAEAAGADYVGDTEYINKI
FT                   QQGWFDFDVVVATPDMMGEVGKLGRILGPKGLMPNPKTGTVTFDVTKAVQEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFDNEKLAENFATIYEAILKAKPAAAKGTYVKNVTITSTMGPGI
FT                   KVDPTTVAVAQ"
FT   gene            110736..111236
FT                   /locus_tag="GTNG_0095"
FT   CDS_pept        110736..111236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0095"
FT                   /product="Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65482"
FT                   /db_xref="GOA:A4IJH8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJH8"
FT                   /protein_id="ABO65482.1"
FT                   /translation="MSSAIELKKQVVAEIADKFRASKATVIVDYRGLNVAEMTELRKQL
FT                   REAGIEFKVYKNTMTRRALAEIGLEGLDEVFTGPNAIAFSNEDVVAPAKILSEFAKTHE
FT                   ALEIKGGVIEGSVASKEEIDALAKLPSREGLLSMLLSVLQAPIRNFALAVKAVADKQEE
FT                   QGA"
FT   gene            111284..111655
FT                   /locus_tag="GTNG_0096"
FT   CDS_pept        111284..111655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0096"
FT                   /product="LSU ribosomal protein L12P (L7/L12)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65483"
FT                   /db_xref="GOA:A4IJH9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJH9"
FT                   /protein_id="ABO65483.1"
FT                   /translation="MMTKEQIIEAVKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAA
FT                   AGGEAAAEKTEFDVILADAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPLKEAVSKE
FT                   EAEEIKAKLEEVGAKVEVK"
FT   gene            111761..112363
FT                   /locus_tag="GTNG_0097"
FT   CDS_pept        111761..112363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0097"
FT                   /product="16S rRNA m(2)G 1207 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65484"
FT                   /db_xref="GOA:A4IJI0"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJI0"
FT                   /protein_id="ABO65484.1"
FT                   /translation="MSEHYYSANPTSERNPQTWTFTLRGHEFRFTTDSGVFSKREVDFG
FT                   TRLLIETFQEPDVAGDLLDVGCGYGPIGLALAKSFPDRRVQMIDVNERALELAEENKQA
FT                   NGIHNAIIYKSDLFSEVGEQRFAAVITNPPIRAGKRVVHAIFEQSRAHLVDNGELWVVI
FT                   QKKQGAPSALQKLKEWFVAVEVVAKKKGYYIIKAKKC"
FT   gene            112769..116341
FT                   /locus_tag="GTNG_0098"
FT   CDS_pept        112769..116341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0098"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65485"
FT                   /db_xref="GOA:A4IJI1"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJI1"
FT                   /protein_id="ABO65485.1"
FT                   /translation="MTGRLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFKEISPIEDFSGNLSLEFIDYSLGEPKYSVEEAKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQDVFMGDFPLMTETGTFIINGAERVIVSQLVRSPSVYYSDKVDKNGKRGYSATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFSSDQEIIDLLGDNEYLRNTLE
FT                   KDNTDSTEKALIEIYERLRPGEPPTLENAKSLLASRFFDPKRYDLASVGRYKINKKLHI
FT                   KNRLFNQRLAETIADPETGEIIAEAGTMIDRRTLNRLLPYLEKGAGLQTYRPTEGVADG
FT                   QISVQTVKIYAPNDPDNEKVINIIGNGFIAEDVKHITPADIIASISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDANTITPQQLINIRPVIAAI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSTYAKVNKFGFIETPYRRVDPETGKVTDQIDYLTADEEDNYVVAQ
FT                   ANVPLAEDGTFLEENVIARFRGENIVVKRDRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLLQPEAPIVGTGMEYVSAKDSGAAIICKHRGIVERVEAKEIWVRR
FT                   LIEVDGKEVKGDLDKYRLLKFVRSNQGTCYNQRPIVKKGDIVEKGEILADGPSMDKGEL
FT                   ALGRNVLVAFMTWDGYNYEDAIIMSERLVKEDVYTSIHIEEYEAESRDTKLGPEEITRD
FT                   IPNVGEDALKNLDERGIVRIGAEVKDGDLLVGKVTPKGMTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIVLDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISRILPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVFELHLGMAAKKLGLHIAS
FT                   PVFDGATEEDVWNILEEAGMARDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGENIPEPGVPESFKVLIKELQSLGMDVTILTSDEQEINMENFDDDDDHAPD
FT                   AIMVDVKPVESEEADEEKNAVTKE"
FT   gene            116399..120052
FT                   /locus_tag="GTNG_0099"
FT   CDS_pept        116399..120052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0099"
FT                   /product="RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65486"
FT                   /db_xref="GOA:A4IJI2"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJI2"
FT                   /protein_id="ABO65486.1"
FT                   /translation="MTNKPRSKTDGSKREVYPLLDVNKFEYMKIGLASPEKIRSWSYGE
FT                   VKKPETINYRTLKPEKDGLFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRSK
FT                   VRRERMGHIELAAPVSHIWYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPGDTPLE
FT                   KKQLLSEKEYRAYREKYGQSFQASMGAEAIKKLLQDIDLDKEVATLKEELKTAQGQRRA
FT                   RIIKRLEVLESFRSSGNDPAWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVIN
FT                   RNNRLKRLLDLGAPNIIVQNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKG
FT                   KQGRFRQNLLGKRVDYSGRSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVERGLAH
FT                   NIKSAKRKIERVHPEVWDVLEDVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHP
FT                   LVCTAYNADFDGDQMAVHVPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGN
FT                   YYLTMEREGAIGEGMVFKDTDEALLAYHNGYVHLHSRIAIHAGSLKNETFTPEQNNKLL
FT                   LTTVGKLIFNEILPKSFPYINEPTTENIEGRTPDKYFLDKGVDVREEIRKRELVPPFKK
FT                   KVLGQIIAEVFKRFKITETSKMLDRMKDLGFQYSTKAGITIGVSDIVVLPEKQEILDEA
FT                   QAKVDTVLKQFRRGLITDEERYERVISVWSAAKDKIQDRLMKSLDKRNPIFMMSDSGAR
FT                   GNASNFTQLAGMRGLMANPAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKT
FT                   ADSGYLTRRLVDVAQDVIVREEDCGTDRGILARALTDGTEVVVKLEERLVGRYAHKTVH
FT                   HPETGEVIVRKDEMITEDIANEIIKAGITEVWIRSVFACNTRHGVCKKCYGRNMATGMD
FT                   VEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDITQGLPRVQELFEARNPKGQAVI
FT                   SEIDGTVVAINETRDNQYEIVVQSEVETRSYVAPYNARLKVEEGQHVERGQELTEGSVD
FT                   PKQLLRVRDITSVQEYLLREVQKVYRMQGVEISDKHIEVMVRQMLRKVRVIDAGDTDVL
FT                   PGTLLDVHQFTDVNAQAIREGKRPATARPVLLGITKASLETDSFLSAASFQETTRVLTD
FT                   AAIKGKRDELLGLKENVIIGKLVPAGTGMARYRNVKPAVKKETASDTVPSN"
FT   gene            120189..120437
FT                   /locus_tag="GTNG_0100"
FT   CDS_pept        120189..120437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0100"
FT                   /product="LSU ribosomal protein L7AE"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65487"
FT                   /db_xref="GOA:A4IJI3"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJI3"
FT                   /protein_id="ABO65487.1"
FT                   /translation="MSYEKVLQAGKIVIGTKQTIRALKEGKAAEVIVAEDADLPIIEKV
FT                   MAAANEANVPITKVDSMKKLGKACKIQVGAAAVAILR"
FT   gene            120528..120950
FT                   /locus_tag="GTNG_0101"
FT   CDS_pept        120528..120950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0101"
FT                   /product="Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65488"
FT                   /db_xref="GOA:A4IJI4"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJI4"
FT                   /protein_id="ABO65488.1"
FT                   /translation="MPTINQLVRKGRQKKVFKSKSPALNKGYNSFKKEQTNVSSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVANRMQGRSKYGAKKPKAAKK"
FT   gene            120990..121460
FT                   /locus_tag="GTNG_0102"
FT   CDS_pept        120990..121460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0102"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65489"
FT                   /db_xref="GOA:A4IJI5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJI5"
FT                   /protein_id="ABO65489.1"
FT                   /translation="MPRRGPVAKRDVLPDPIYNSKLVTRLINKIMIDGKKSKAQKILYT
FT                   AFDIIRERTGKDPMEVFEQALKNVMPVLEVRARRVGGANYQVPVEVRPDRRVSLGLRWL
FT                   VQYSRLRGEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
FT   gene            121651..123729
FT                   /locus_tag="GTNG_0103"
FT   CDS_pept        121651..123729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0103"
FT                   /product="Translation elongation factor G, EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65490"
FT                   /db_xref="GOA:A4IJI6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJI6"
FT                   /protein_id="ABO65490.1"
FT                   /translation="MAREFSLENTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGETHE
FT                   GSATMDWMEQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAIT
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYAVKTLHDRLQANAYPVQ
FT                   LPIGAEDQFTGIIDLVEMCAYHYHDDLGKNIERIEIPEDYRDLAEEYHGKLIEAVAELD
FT                   EELMMKYLEGEEITKEELKAAIRKATINVEFYPVFCGSAFKNKGVQLLLDGVVDYLPSP
FT                   LDIPAIRGIIPDTEEEVAREARDDAPFSALAFKIMTDPYVGKLTFFRVYSGTLDSGSYV
FT                   MNSTKRKRERIGRLLQMHANHRQEISTVYAGDIAAAVGLKETTTGDTLCDEKNLVILES
FT                   MQFPEPVISVAIEPKSKADQDKMGQALQKLQEEDPTFRAHTDPETGQTIISGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRQSAQVEGKFIRQSGGRGQYGHVWIEFTPNER
FT                   GKGFEFENAIVGGVVPKEYVPAVQAGLEEAMQNGVLAGYPVVDIKAKLFDGSYHDVDSS
FT                   EMAFKIAASMALKNAAAKCEPVLLEPIMKVEVVIPEEYLGDIMGDITSRRGRVEGMEAR
FT                   GNAQVVRAMVPMAEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKNIADEIIKKNKGE"
FT   gene            123852..125039
FT                   /locus_tag="GTNG_0104"
FT   CDS_pept        123852..125039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0104"
FT                   /product="EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65491"
FT                   /db_xref="GOA:A4IJI7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJI7"
FT                   /protein_id="ABO65491.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAR
FT                   AYDQIDAAPEERERGITISTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDF
FT                   PGDEVPVIKGSALKALEGDAQWEEKIVELMNAVDEYIPTPQREVDKPFMMPVEDVFSIT
FT                   GRGTVATGRVERGTLKVGDPVEIIGLSDEPKSTTVTGVEMFRKLLDQAEAGDNIGALLR
FT                   GVSRDEVERGQVLAKPGSITPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVT
FT                   GIITLPEGVEMVMPGDNVEMTVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE"
FT   gene            125467..125775
FT                   /locus_tag="GTNG_0105"
FT   CDS_pept        125467..125775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0105"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65492"
FT                   /db_xref="GOA:A4IJI8"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJI8"
FT                   /protein_id="ABO65492.1"
FT                   /translation="MAKEKIRIRLKAYDHRILDQSAEKIVETAKRSGAKVSGPIPLPTE
FT                   RTVYTILRAVHKYKDSREQFEMRTHKRLIDIINPTPQTVDSLMRLDLPSGVDIEIKL"
FT   gene            125801..126436
FT                   /locus_tag="GTNG_0106"
FT   CDS_pept        125801..126436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0106"
FT                   /product="Ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65493"
FT                   /db_xref="GOA:A4IJI9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJI9"
FT                   /protein_id="ABO65493.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGDLIPVTVIEATPNVVLQKKTIENDG
FT                   YEAIQLGFEDLSTKRANKPQIGHAAKANTAPKRFIREIRGANVNEYEVGQEVKVDIFSE
FT                   GDIVDVTGISKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGAIAPNRVFKTKNLPGR
FT                   MGGERVTIQNLKIVKVDPERNLLLIKGNVPGPRKGLVIVKSAVKAKAK"
FT   gene            126466..127089
FT                   /locus_tag="GTNG_0107"
FT   CDS_pept        126466..127089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0107"
FT                   /product="Ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65494"
FT                   /db_xref="GOA:A4IJJ0"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJJ0"
FT                   /protein_id="ABO65494.1"
FT                   /translation="MPKVALYNQNGQTIGEIELNDAVFGIEPNKHVLFEAVIMQRASMR
FT                   QGTHKTKNRAEVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPVPRSYSYKLPKK
FT                   VRRLAIKSALSSKVLENDIVVLDQLSLEAPKTKEMVKILNNLAVDRKALIVTDELNENV
FT                   YLSARNIPGVKVVAANGINVLDVLSHDKLVITKAAVEKVEEVLA"
FT   gene            127089..127376
FT                   /locus_tag="GTNG_0108"
FT   CDS_pept        127089..127376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0108"
FT                   /product="Ribosomal protrein L23"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65495"
FT                   /db_xref="GOA:A4IJJ1"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJJ1"
FT                   /protein_id="ABO65495.1"
FT                   /translation="MKDPRDIIKRPIITENTMNLVGQRKYTFEVDVKANKTEVKDAVEK
FT                   IFGVKVEKVNIMNYKGKFKRVGRYSGYTNRRRKAIVTLTPDSKEIELFEV"
FT   gene            127404..128234
FT                   /locus_tag="GTNG_0109"
FT   CDS_pept        127404..128234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0109"
FT                   /product="Ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65496"
FT                   /db_xref="GOA:A4IJJ2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJJ2"
FT                   /protein_id="ABO65496.1"
FT                   /translation="MAIKKYKPTSNGRRGMTVLDFSEITTDQPEKSLLAPLKKKAGRNN
FT                   QGKITVRHQGGGHKRQYRIIDFKRDKDGIPGRVATIEYDPNRSANIALINYADGEKRYI
FT                   LAPKNLKVGMEIMSGPNADIKVGNALPLENIPVGTLVHNIELKPGRGGQLVRAAGTSAQ
FT                   VLGKEGKYVIIRLASGEVRMILGKCRATVGEVGNEQHELVNIGKAGRARWLGIRPTVRG
FT                   SVMNPVDHPHGGGEGKAPIGRKSPMTPWGKPTLGYKTRKKKNKSDKFIIRRRKK"
FT   gene            128268..128546
FT                   /locus_tag="GTNG_0110"
FT   CDS_pept        128268..128546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0110"
FT                   /product="Ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65497"
FT                   /db_xref="GOA:A4IJJ3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJJ3"
FT                   /protein_id="ABO65497.1"
FT                   /translation="MGRSLKKGPFCDEHLMKKIEKLNETGQKQVIKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVYITEDMVGHKLGEFAPTRTFRGHAGDDKKTKR"
FT   gene            128565..128906
FT                   /locus_tag="GTNG_0111"
FT   CDS_pept        128565..128906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0111"
FT                   /product="Ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65498"
FT                   /db_xref="GOA:A4IJJ4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJJ4"
FT                   /protein_id="ABO65498.1"
FT                   /translation="MQAKAVARTVRIAPRKARLVIDLIRGKKVGEAFAILRHTPKAASP
FT                   IIEKVLKSAVANAEHNYDMDINNLVVSQAYVNEGPTLKRFRPRARGQASAINKRTSHIT
FT                   IVVSEKKEG"
FT   gene            128910..129566
FT                   /locus_tag="GTNG_0112"
FT   CDS_pept        128910..129566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0112"
FT                   /product="Ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65499"
FT                   /db_xref="GOA:A4IJJ5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJJ5"
FT                   /protein_id="ABO65499.1"
FT                   /translation="MGQKVNPIGLRIGIIRDWESRWYAEKDYADLLHEDLKVREYINKR
FT                   LQDAAVSRVEIERAANRVNVTIHTAKPGMVIGKGGSEVEALRKALAQLTGKRVHINIVE
FT                   IKKPDLDAKLVAENIARQLENRVSFRRAQKQAIQRAMRAGAKGIKTMVSGRLGGADIAR
FT                   SEHYSEGTVPLHTLRADIDYATAEADTTYGKIGVKVWIYRGEVLPTKKKAEEGGK"
FT   gene            129569..129994
FT                   /locus_tag="GTNG_0113"
FT   CDS_pept        129569..129994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0113"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65500"
FT                   /db_xref="GOA:A4IJJ6"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJJ6"
FT                   /protein_id="ABO65500.1"
FT                   /translation="MLMPKRVKYRREHRGRMKGRAKGGTEVHFGEFGLQALESAWITNR
FT                   QIEAARRAMTRYMKRGGKVWIRIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMF
FT                   EVAGVSEEVAREALRLASHKLPIKCKFVKREETGGEA"
FT   gene            129994..130194
FT                   /locus_tag="GTNG_0114"
FT   CDS_pept        129994..130194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0114"
FT                   /product="Ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65501"
FT                   /db_xref="GOA:A4IJJ7"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJJ7"
FT                   /protein_id="ABO65501.1"
FT                   /translation="MKAKEIRDLTTAEIEQKIKSLKEELFNLRFQLATGQLENTARIRQ
FT                   VRKDIARMKTIIRERELAANK"
FT   gene            130217..130480
FT                   /locus_tag="GTNG_0115"
FT   CDS_pept        130217..130480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0115"
FT                   /product="Ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65502"
FT                   /db_xref="GOA:A4IJJ8"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJJ8"
FT                   /protein_id="ABO65502.1"
FT                   /translation="MSERNQRKVYVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKK
FT                   YKAHDEHNIAKVGDIVKIMETRPLSATKRFRLVEVVEKAVIL"
FT   gene            130530..130898
FT                   /locus_tag="GTNG_0116"
FT   CDS_pept        130530..130898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0116"
FT                   /product="Ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65503"
FT                   /db_xref="GOA:A4IJJ9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJJ9"
FT                   /protein_id="ABO65503.1"
FT                   /translation="MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKD
FT                   ATPGGVVKKGQVVKAVVVRTKRGVRRSDGSYIRFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRDKDFMKIISLAPEVI"
FT   gene            131274..131813
FT                   /locus_tag="GTNG_0117"
FT   CDS_pept        131274..131813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0117"
FT                   /product="Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65504"
FT                   /db_xref="GOA:A4IJK0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJK0"
FT                   /protein_id="ABO65504.1"
FT                   /translation="MNRLKEKYTKEVVPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQ
FT                   NPKALDSAVEELTLIAGQRPVVTRAKKSIAGFRLRQGMPIGAKVTLRGERMYEFLDKLI
FT                   SVSLPRVRDFRGVSKKAFDGRGNYTLGIKEQLIFPEIDYDKVNKVRGMDIVIVTTANTD
FT                   EEARELLTLLGMPFQK"
FT   gene            131843..132028
FT                   /locus_tag="GTNG_0118"
FT   CDS_pept        131843..132028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0118"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65505"
FT                   /db_xref="GOA:A4IJK1"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJK1"
FT                   /protein_id="ABO65505.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVRAYTRCERCGRPHSVYRKFKLCRICFR
FT                   ELAYKGQLPGIKKASW"
FT   gene            132062..132460
FT                   /locus_tag="GTNG_0119"
FT   CDS_pept        132062..132460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0119"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65506"
FT                   /db_xref="GOA:A4IJK2"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJK2"
FT                   /protein_id="ABO65506.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEVPASKIKREIAEILKREGF
FT                   IRDVEYIEDNKQGILRIFLKYGPNNERVITGLKRISKPGLRVYVKAHEVPRVLNGLGIA
FT                   ILSTSQGILTDKEARQKGTGGEVIAYVW"
FT   gene            132493..133029
FT                   /locus_tag="GTNG_0120"
FT   CDS_pept        132493..133029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0120"
FT                   /product="Ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65507"
FT                   /db_xref="GOA:A4IJK3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJK3"
FT                   /protein_id="ABO65507.1"
FT                   /translation="MSRVGKKPIEIPAGVTVTVNGNTVTVKGPKGELTRTFHPDITINV
FT                   EDNVITVTRPSDEKQHRALHGTTRSLLANMVEGVSKGYEKALELVGVGYRASKQGKKLV
FT                   LSVGYSHPVEIEPEEGLEIEVPAQTKVIVKGADKQRVGELAANIRAVRPPEPYKGKGIR
FT                   YEGEVVRLKEGKTGK"
FT   gene            133063..133425
FT                   /locus_tag="GTNG_0121"
FT   CDS_pept        133063..133425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0121"
FT                   /product="Ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65508"
FT                   /db_xref="GOA:A4IJK4"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJK4"
FT                   /protein_id="ABO65508.1"
FT                   /translation="MITKVDRNAVRKKRHARIRKKIFGTAERPRLSVFRSNKHIYAQII
FT                   DDVKSATIVSASTLDKEFSLDSTNNIDAAKKVGELVAKRALEKGIKQVVFDRGGYLYHG
FT                   RVKALADAAREAGLEF"
FT   gene            133443..133943
FT                   /locus_tag="GTNG_0122"
FT   CDS_pept        133443..133943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0122"
FT                   /product="Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65509"
FT                   /db_xref="GOA:A4IJK5"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJK5"
FT                   /protein_id="ABO65509.1"
FT                   /translation="MRRIDPNKLELEERVVAINRVAKVVKGGRRLRFSALVVVGDKNGH
FT                   VGFGTGKAQEVPEAIRKAIEDAKKNLMEVPIVGTTIPHEVIGHFGAGEIILKPASEGTG
FT                   VIAGGPARAVLELAGISDILSKSIGSNTPINMVRATFDGLKQLKRAEDVAKLRGKTVEE
FT                   LLG"
FT   gene            133957..134145
FT                   /locus_tag="GTNG_0123"
FT   CDS_pept        133957..134145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0123"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65510"
FT                   /db_xref="GOA:A4IJK6"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJK6"
FT                   /protein_id="ABO65510.1"
FT                   /translation="MAKKLAITLTRSVIGRPEDQRITVKTLGLRKMHQTVVHNDNPAIR
FT                   GMINKVAHLVTVKEIEE"
FT   gene            134171..134611
FT                   /locus_tag="GTNG_0124"
FT   CDS_pept        134171..134611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0124"
FT                   /product="Ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65511"
FT                   /db_xref="GOA:A4IJK7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJK7"
FT                   /protein_id="ABO65511.1"
FT                   /translation="MKLHELQPAPGSRKKAVRVGRGIGSGNGKTAGRGHKGQKARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINRKEYAVVNLDRLNIFEDGTEVTPELLLEKGVISK
FT                   LKSGVKILGKGQIEKKLTVKAHKFSASAKEAIEAAGGKTEVI"
FT   gene            134611..135903
FT                   /gene="secY"
FT                   /locus_tag="GTNG_0125"
FT   CDS_pept        134611..135903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="GTNG_0125"
FT                   /product="SecY"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65512"
FT                   /db_xref="GOA:A4IJK8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="PDB:5EUL"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJK8"
FT                   /protein_id="ABO65512.1"
FT                   /translation="MFRTISNFMRVSDIRNKIIFTLLMLIVFRIGTFIPVPSVNTDVLK
FT                   LQDQLNAFGVLNIFGGGALQNFSIFAMGVMPYITASIIVQLLQMDVVPKFAEWSKQGEM
FT                   GRRKLAQFTRYFTIVLGFIQALGMSYGFNNLAGGMLIQNPGIGTYLLIAVVLTAGTAFL
FT                   MWLGEQITAKGVGNGISIIIFAGIVSGIPTILNQIYAQQFENVGEDLFLRIVRLLLVAL
FT                   AVVAVIVGVIYIQQAFRKIPIQYAKRLEGRNPVGGHSTHLPLKVNPAGVIPVIFAVSFL
FT                   IAPPTIASFFGTNDVTLWIRRTFDYTHPVGMTIYVVLIIAFTYFYAFVQVNPEQMADNL
FT                   KKQGGYIPGIRPGKNTQEYVTRILYRLTLVGSLFLAFIAVLPVFFVNFANLPPSAQIGG
FT                   TSLLIVVGVALETMKQLESQLVKRHYRGFIK"
FT   gene            135947..136600
FT                   /gene="adk"
FT                   /locus_tag="GTNG_0126"
FT   CDS_pept        135947..136600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="GTNG_0126"
FT                   /product="Adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65513"
FT                   /db_xref="GOA:A4IJK9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJK9"
FT                   /protein_id="ABO65513.1"
FT                   /translation="MNLVLMGLPGAGKGTQAEKIVETYGIPHISTGDMFRAAMKEGTPL
FT                   GLQAKEYIDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTVAQAEALEAMLAEIG
FT                   RKLDYVIHIDVRQDVLMERLTGRRICRNCGATYHLVFHPPAQPGVCDKCGGELYQRPDD
FT                   NEATVANRLEVNTKQMKPLLDFYEQKGYLRHINGEQEMEKVFSDIRELLGGLTR"
FT   gene            136597..137337
FT                   /locus_tag="GTNG_0127"
FT   CDS_pept        136597..137337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0127"
FT                   /product="Methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65514"
FT                   /db_xref="GOA:A4IJL0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJL0"
FT                   /protein_id="ABO65514.1"
FT                   /translation="MIIYKTEHEIALMREAGKIVSLTLEELKKHIRPGITTKELDAIAE
FT                   EVIRSHGAIPSFKGYQGFPGSICASVNEELVHGIPGNRMLREGDIITVDVGAQYEGYHA
FT                   DSAWTYPVGEIDAETKRLLDVTEQSLYVGLAEAKPGARLTNISHAIQTYVEAHHFSVVR
FT                   EYVGHGIGQHLHEDPQVPHYGPPNRGPILRPGMTLCIEPMVNAGSRHVKTLADDWTVVT
FT                   VDGKRCAHFEHTIVITEQGYEILT"
FT   gene            137546..137764
FT                   /locus_tag="GTNG_0128"
FT   CDS_pept        137546..137764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0128"
FT                   /product="Initiation factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65515"
FT                   /db_xref="GOA:A4IJL1"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJL1"
FT                   /protein_id="ABO65515.1"
FT                   /translation="MAKDDVIEVEGTVIETLPNAMFRVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
FT   gene            137933..138298
FT                   /locus_tag="GTNG_0129"
FT   CDS_pept        137933..138298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0129"
FT                   /product="Ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65516"
FT                   /db_xref="GOA:A4IJL2"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJL2"
FT                   /protein_id="ABO65516.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYIYGIGKPTAQKILKEAGVSEDTRV
FT                   RDLTEEELGRIREIVGRLKVEGDLRREVSLNIKRLMEIGCYRGLRHRRGLPVRGQNTKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            138324..138713
FT                   /locus_tag="GTNG_0130"
FT   CDS_pept        138324..138713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0130"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65517"
FT                   /db_xref="GOA:A4IJL3"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJL3"
FT                   /protein_id="ABO65517.1"
FT                   /translation="MARRTNTRKRRVRKNIDTGIAHIRSTFNNTIVTITDVHGNAIAWS
FT                   SAGALGFKGSRKSTPFAAQMAAEAAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAG
FT                   LEITAIKDVTPIPHNGCRPPKRRRV"
FT   gene            138885..139829
FT                   /locus_tag="GTNG_0131"
FT   CDS_pept        138885..139829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0131"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65518"
FT                   /db_xref="GOA:A4IJL4"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJL4"
FT                   /protein_id="ABO65518.1"
FT                   /translation="MIEIEKPKIETVELSEDAKYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSVQIDGVLHEFSTIEGVVEDVTAIILNVKKLALKIYSDEEKTLEIDVQGE
FT                   GVVTAADITHDSDVEILNPDLHIATLAEGGRLRMRMTARRGRGYVPAEANKREDQPIGV
FT                   IPIDSIYTPVSRVSYQVENTRVGQVTDYDKLTIDVWTDGSIGPKEAISLGAKILTEHLN
FT                   IFVGLTDEAQNAEIMVEKEDDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELTQKT
FT                   EEDMMKVRNLGRKSLEEVKAKLAELGLSLRKDD"
FT   gene            139945..140307
FT                   /locus_tag="GTNG_0132"
FT   CDS_pept        139945..140307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0132"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65519"
FT                   /db_xref="GOA:A4IJL5"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJL5"
FT                   /protein_id="ABO65519.1"
FT                   /translation="MSYRKLGRTTSQRKALLRDLATDLIINERIETTEARAKELRSVIE
FT                   KMITLGKRGDLHARRQAAAFIRNEVANSETGQDALQKLFSDIAPRYQDRQGGYTRIMKL
FT                   GPRRGDGAPMVIIELV"
FT   gene            140428..141267
FT                   /locus_tag="GTNG_0133"
FT   CDS_pept        140428..141267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0133"
FT                   /product="Cobalt transport ATP-binding protein CbiO-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65520"
FT                   /db_xref="GOA:A4IJL6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJL6"
FT                   /protein_id="ABO65520.1"
FT                   /translation="MAEPILSIEGVYFRYPNQSEYAVQNVSFQAERGEWLAIVGHNGSG
FT                   KSTIARLLIGLLRPERGVIRLFGRPLDETTVWDVRRRVGMVFQNPDNQFVGTTVEDDIA
FT                   FALENNGIPRDEMVERIHEAVRQVHMESFLEHEPHRLSGGQKQRVAIAGILALRPDMII
FT                   LDEATSMLDPRGREEVLDTVRRLNRQRRITVVSITHDLEEAARADRIVVMNKGEVMAEG
FT                   TPEHVFRLGGKLERIGLDLPFAVKMGSRLREKGIPLRVGYFTTEELVEELWTLYSKK"
FT   gene            141243..142118
FT                   /locus_tag="GTNG_0134"
FT   CDS_pept        141243..142118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0134"
FT                   /product="Cobalt transport ATP-binding protein CbiO-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65521"
FT                   /db_xref="GOA:A4IJL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJL7"
FT                   /protein_id="ABO65521.1"
FT                   /translation="MDIVFEKVEHVYNARSPFARRALYDVNVTIADGTYVAIVGHTGSG
FT                   KSTLLQHLNGLLQPTSGTVKIGEETITGSKRPKQLKPLRKKVGIVFQFPEHQLFEETVE
FT                   KDICFGPLNFGVPEEEAKRKAKELVKLVGLNEDVLAKSPFDLSGGQMRRVAIAGVLALE
FT                   PEMIVLDEPTAGLDPRGRKEIMEMFYRLHREKQLTTVLVTHSMEDAAQYADEIIVMHEG
FT                   TVWGQGTPEEIFRDPERLAAIGLSVPETVKLKQELERRFGVTIPSPCLTIEQTADAIKQ
FT                   LFSKVSVHDQ"
FT   gene            142108..142905
FT                   /locus_tag="GTNG_0135"
FT   CDS_pept        142108..142905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0135"
FT                   /product="Cobalt transport protein CbiQ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65522"
FT                   /db_xref="GOA:A4IJL8"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJL8"
FT                   /protein_id="ABO65522.1"
FT                   /translation="MTNNLIIGQYVPGHSLIHRLDPRAKLLIVFAYVLIVFLANNVVTY
FT                   TVLSLFTFVFAALSRIPLSFIMRGLKPILWVVLFTMLLHLFMTKEGDVVYRLGTFSIYE
FT                   GGIRQGIFISLRFLLLVLMTTMLTLTTTPIEVTDGVESLLGPLKKMRVPVHELALMMAI
FT                   SLRFIPTLMEETEKIMKAQAARGVDFSGGRFSERVKAIVSLLVPLFISSFKRADELATA
FT                   MEARGYRGGEGRTKFRQLVWKPLDTSFLVATALLAALLFLLRS"
FT   gene            142918..143679
FT                   /locus_tag="GTNG_0136"
FT   CDS_pept        142918..143679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0136"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65523"
FT                   /db_xref="GOA:A4IJL9"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJL9"
FT                   /protein_id="ABO65523.1"
FT                   /translation="MTRRIKCVVAYDGTYFSGYQVQPGKRTVQGEFEGVLKRMHKGDDV
FT                   RITASGRTDAGVHAYGQVIHFDTPLALSPEQWKKALNAQLPDDIAVRSVDEADSTFHAR
FT                   FSAKAKEYRYNVWTAAERDVFRRHYCAWHPYPLRVDAMSEALGLLKGTHDFTSFCSAKT
FT                   VIEDRVRTIYQAEMEVDGPMLQFRFVGSGFLYNMVRIIVGTVLEVGQGKRPPDDIEALL
FT                   AAKDRRLAGPTAPAEGLYLWRVYYDGESFGH"
FT   gene            144003..144440
FT                   /locus_tag="GTNG_0137"
FT   CDS_pept        144003..144440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0137"
FT                   /product="Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65524"
FT                   /db_xref="GOA:A4IJM0"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJM0"
FT                   /protein_id="ABO65524.1"
FT                   /translation="MRTTYMAKPNEVERKWYVVDAAGKTLGRLASEVAALLRGKHKPTF
FT                   TPHVDCGDHVIVINADKVELTGKKLTKKLYYRHSLHPGGLKVRTALEMRTNYPEQMIER
FT                   AVRGMLPKGSLGRQMFKKLHVYRGSEHPHQAQKPEVYELRG"
FT   gene            144463..144855
FT                   /locus_tag="GTNG_0138"
FT   CDS_pept        144463..144855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0138"
FT                   /product="Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65525"
FT                   /db_xref="GOA:A4IJM1"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJM1"
FT                   /protein_id="ABO65525.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGDGRIIVNKHDIREYIPSEALI
FT                   EMVKQPLVLTETLGSYDVLVNVHGGGFAGQAGAIRHGIARALLEVDPEFRAVLKRAGLL
FT                   TRDARVKERKKYGLKGARRAPQFSKR"
FT   gene            144978..145418
FT                   /locus_tag="GTNG_0139"
FT   CDS_pept        144978..145418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0139"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65526"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJM2"
FT                   /protein_id="ABO65526.1"
FT                   /translation="MAVITSLTEKRQEKQLRYERKMLRELSLEKLRAKVLEHFVPFYQT
FT                   YRIFPSVVEEGCIDLAIEAYLLGAHYSRFGYYGEPTDSVRQRCVREEKYLVDTLFDFLC
FT                   FWGNVEDDIRGESLYYACEQYISNWWTEGFERGKKRYRLKLH"
FT   gene            145485..146201
FT                   /locus_tag="GTNG_0140"
FT   CDS_pept        145485..146201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0140"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65527"
FT                   /db_xref="GOA:A4IJM3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJM3"
FT                   /protein_id="ABO65527.1"
FT                   /translation="MKKKWKWLVAVAAITILGVLLFPSLFSDLTSTKPWNLPLSGRIIV
FT                   LDPGHGGPDGGAVGGEVVEKEIALNVAKKLRDYLQQQGALVLMTRETDRDLASPSTRGY
FT                   SRRKTEDLRERTTFINKSDADLFISIHLNAIPSPRWRGAQTFYYGSLIENERLAKFIQA
FT                   ELRRNLENTHRVAKMIDTVYLLKHAKKPGALVEIGFLSNPDERELLASDHYQTQLAASI
FT                   YKGVLRYFSNEPTLRE"
FT   gene            146382..147398
FT                   /gene="mrp"
FT                   /locus_tag="GTNG_0141"
FT   CDS_pept        146382..147398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="GTNG_0141"
FT                   /product="Mrp protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65528"
FT                   /db_xref="GOA:A4IJM4"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJM4"
FT                   /protein_id="ABO65528.1"
FT                   /translation="MLTENDVRAILENMKDPFLNKTFKETNAIQEIKIKEEKNHVSVKI
FT                   ALAKIGTPDQLRVQTAIVQQLKDAGAASVGLRFAELPREVVEEYSENKQRTTYIAIASG
FT                   KGGVGKSTVSVNLAVALARLGKKVGLIDADIYGFSVPDMMGITERPTVRGDKIIPVERF
FT                   GVKVISMAFFVEDNAPVIWRGPMLGKMLNNFFKEVEWGDLDYLLLDLPPGTGDVALDVH
FT                   TLLPSCKEIIVTTPHPTAAFVAARAGAMALRTEHEIIGVIENMSYYESRKTGEREYVFG
FT                   KGGGAKLAKELQTELLGQLPLQQPDWNDDDFAPSVYAEDHPIGKIYMDIARKIAAKY"
FT   gene            complement(147493..148122)
FT                   /gene="gerD"
FT                   /locus_tag="GTNG_0142"
FT   CDS_pept        complement(147493..148122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="GTNG_0142"
FT                   /product="Spore germination protein GerD"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65529"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJM5"
FT                   /protein_id="ABO65529.1"
FT                   /translation="MNKCIPLLLLSFLVLSSCAPQETSPAPPDYEQTKRMVVDILKTDE
FT                   GKKAIQDIMLEDQMKQQLVMDQTAVKEILQQVLTSDQGKKFWENALKDTKFAESFAKGL
FT                   QKEHEKMMKALMKDPEYQAMMIDILKNPEMEKAMIDVLKSKEFRQHLQTVIMETLNSPI
FT                   YQAKIQDMLTKAAETLQQSGGKQGEEDAEGGEGEEGGGGSQQGEGG"
FT   gene            148277..148876
FT                   /gene="kbaA"
FT                   /locus_tag="GTNG_0143"
FT   CDS_pept        148277..148876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="GTNG_0143"
FT                   /product="KinB signaling pathway activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65530"
FT                   /db_xref="GOA:A4IJM6"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJM6"
FT                   /protein_id="ABO65530.1"
FT                   /translation="MNSRKWVRLFFTTLLVGGITTAAVGMVLNWKEFGQLLLSVEIVEF
FT                   MAVLLWHIGVGFIFSVISQAGFFAYLTVHRFGLGMFRSLWNAVQLVLIMFVLFDLVYFR
FT                   YTAFAANGESIIPYILIALFVLVVGLAVAYAKSAQTNKGAFVPALFFMVVVTIVEWFPV
FT                   LRINDQDWLYLMLIPLLVCNAYQLLILHKLTGGAKQ"
FT   gene            complement(149104..149859)
FT                   /locus_tag="GTNG_0144"
FT   CDS_pept        complement(149104..149859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0144"
FT                   /product="Polysaccharide deacetylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65531"
FT                   /db_xref="GOA:A4IJM7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJM7"
FT                   /protein_id="ABO65531.1"
FT                   /translation="MFYALNGRTLKKALIVICSAFFTAVILYAYEMNRPVFSLPSGPKA
FT                   VYKVDNNRDEVALTFNISWGDENADKILDVLKQQGIKNATFFLSASWAERHPTVVKRIK
FT                   EEGHEIGSMGYNFVNYTELENAKIRQDLMMAKKVFDTLGVKNVELLRPPGGNFNKNVLK
FT                   IAQSLGYTVVHWSINSKDWLNPGTEQIVANVTNDLDPGDIVLLHASDSAKQTAKALPKI
FT                   IEVMKENGYKNASLSELLANGKAESKGID"
FT   gene            150331..151880
FT                   /locus_tag="GTNG_16s004"
FT   rRNA            150331..151880
FT                   /locus_tag="GTNG_16s004"
FT                   /product="16S ribosomal RNA"
FT   gene            152129..155057
FT                   /locus_tag="GTNG_23s004"
FT   rRNA            152129..155057
FT                   /locus_tag="GTNG_23s004"
FT                   /product="23S ribosomal RNA"
FT   gene            155207..155323
FT                   /locus_tag="GTNG_5s005"
FT   rRNA            155207..155323
FT                   /locus_tag="GTNG_5s005"
FT                   /product="5S ribosomal RNA"
FT   gene            155333..155407
FT                   /locus_tag="GTNG_t015"
FT   tRNA            155333..155407
FT                   /locus_tag="GTNG_t015"
FT                   /product="tRNA-Asn"
FT   gene            155415..155490
FT                   /locus_tag="GTNG_t016"
FT   tRNA            155415..155490
FT                   /locus_tag="GTNG_t016"
FT                   /product="tRNA-Thr"
FT   gene            155501..155572
FT                   /locus_tag="GTNG_t017"
FT   tRNA            155501..155572
FT                   /locus_tag="GTNG_t017"
FT                   /product="tRNA-Glu"
FT   gene            155676..155750
FT                   /locus_tag="GTNG_t018"
FT   tRNA            155676..155750
FT                   /locus_tag="GTNG_t018"
FT                   /product="tRNA-Gln"
FT   gene            155882..155957
FT                   /locus_tag="GTNG_t019"
FT   tRNA            155882..155957
FT                   /locus_tag="GTNG_t019"
FT                   /product="tRNA-Lys"
FT   gene            155962..156033
FT                   /locus_tag="GTNG_t020"
FT   tRNA            155962..156033
FT                   /locus_tag="GTNG_t020"
FT                   /product="tRNA-Gly"
FT   gene            156040..156115
FT                   /locus_tag="GTNG_t021"
FT   tRNA            156040..156115
FT                   /locus_tag="GTNG_t021"
FT                   /product="tRNA-Ala"
FT   gene            156300..157199
FT                   /locus_tag="GTNG_0145"
FT   CDS_pept        156300..157199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0145"
FT                   /product="Arginase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65532"
FT                   /db_xref="GOA:A4IJM8"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJM8"
FT                   /protein_id="ABO65532.1"
FT                   /translation="MKPISIIGVPMDLGQTRRGVDMGPSAIRYAGVIERLERLHYDIED
FT                   LGDIPIGKVERLHEQGASQLRNLKAVAEANEKLATAVDEVVKRGRFPLVLGGDHSIAIG
FT                   TLAGVAKHYERLGVIWYDAHGDVNTEETSPSGNIHGMPLAASLGFGHPALTGIGGYSPK
FT                   VKPEHVVLIGVRSLDDGEKKFIREKGIKIYTMHEVDRLGMTKVMEETIAYLKERTDGVH
FT                   LSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNK
FT                   TASVAVALMGSLFGEKLV"
FT   gene            157534..158709
FT                   /locus_tag="GTNG_0146"
FT   CDS_pept        157534..158709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0146"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65533"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJM9"
FT                   /protein_id="ABO65533.1"
FT                   /translation="MYSQFIKELIDLPDVLIEKERKEGERWIFELSLPEQCPLCPVCLQ
FT                   RTTKMTRKKKQWMHGYAQRIGVFWIELPVERRRCCTCGMTFSTSYPGISPRSVATDVFQ
FT                   QWVAQSCIGTSIQAVARMLKLPYTTVERWFYTHAPSFLSNTIQPKAVCVDEFAFRKGHD
FT                   YGVAVMDAETGEVYSIEAGKNEAAIRSALTCVSSSVQCVVSDLAPAMKKAIQGACPEAV
FT                   HVVDYFHVIQLFTEALDRCRKYLAKGGKKHGNVRYVCCLLSQCPEKLTEEERQTVREWC
FT                   KESDYLQVVYQSLQHFRYVSKSQGERQAKRRLEAWIHRYLFCTCSVVRAIAKALAKRTE
FT                   EIISCILSPYSNGKMEGTNNKIKLIKRRGYGYRNIQRFALRVRLETATTLQ"
FT   gene            158804..159292
FT                   /locus_tag="GTNG_0147"
FT   CDS_pept        158804..159292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0147"
FT                   /product="RNA polymerase ECF(extracytoplasmic
FT                   function)-typesigma factor (sigma-W)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65534"
FT                   /db_xref="GOA:A4IJN0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJN0"
FT                   /protein_id="ABO65534.1"
FT                   /translation="MYKDKIYRLCYRMLGNRHEAEDAAQEAFIRAYVHIDTYNPNMKFS
FT                   TWLYRIATNLTIDKLRKRKPDVYLDEELNGTDGLTMQAQLPSREASPEEAVESLELQET
FT                   VQRAIEQLPEKYRSVIVLKYIEDLSLQEISEILGLPVGTVKTRLHRGREALRRQLGHL"
FT   gene            159307..159918
FT                   /locus_tag="GTNG_0148"
FT   CDS_pept        159307..159918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0148"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65535"
FT                   /db_xref="GOA:A4IJN1"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJN1"
FT                   /protein_id="ABO65535.1"
FT                   /translation="MECPKEIVSLMHSYLDGDLQPDEELRLKEHLRSCAACAAHFHELK
FT                   KTVAFLQYASHVTAPSSFTATVMGAMPKERKTVRLRRWLHGHPLLTAASLFLLLTVGSV
FT                   ASSWGGKGSFSVSADEPVIIRDHTVIVPKGETVKGDIVVRNGSIRIEGTVDGNVTVIRG
FT                   EKYMASAGQVTGEVEEINQVFEWIWYNIKEKASRALQSLE"
FT   gene            159991..160812
FT                   /locus_tag="GTNG_0149"
FT   CDS_pept        159991..160812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0149"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65536"
FT                   /db_xref="GOA:A4IJN2"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJN2"
FT                   /protein_id="ABO65536.1"
FT                   /translation="MSFEELPIVSYLLKVVDILVVWYVIYKLIMMIRGTKAIQLLKGIF
FT                   LIILVRFVSNYLGLTTLQWLMDQAIIWGFLAIIIIFQPELRRALEQLGRGRLFTRSTVN
FT                   EDEERLRMVEAIVKATEYMAKRRIGALISIERETGMGDYVETGIMLNAHVSSELLINIF
FT                   IPNTPLHDGAVIIQKNQIAAAACYLPLSESPFISKELGTRHRAALGISEVTDSVTVIVS
FT                   EETGAVSVAKNGELYRDLTIDEFRELLTGELAPAVKTATSSRWQWRGKKHG"
FT   gene            160805..162085
FT                   /locus_tag="GTNG_0150"
FT   CDS_pept        160805..162085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0150"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65537"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJN3"
FT                   /protein_id="ABO65537.1"
FT                   /translation="MDKLMDHPWFIRVVSLLLAIMLYMSANVGAKTGEQTRNTFGQEDT
FT                   ETLIDVPVVAYYDEENLIVSGVPQYVNVTLQGPASIVKPTALQRNFEVYVDLTDLPLGT
FT                   YTVPIKYKDVSEKLKVNIQPASVKVTIREKVSKRFPVSVEFFNRNKMPDGYSVGEPTVE
FT                   PGTVTITGSKELIDDISFVKAIVDLEGATETLAKKVRVRVYDRQGNEIDVEPQPSVVEV
FT                   TVPVKSASKTVPLQVQTTGELPDGVRLVSIHPEPEQVTIYGSKGALDRIKQLDGLTVDL
FT                   DNVKDDTTVELDVPLPDGVKRIDPSKIKVHINVEKVEKAENEENKVEKDEVRTWENIPI
FT                   NVVGLSDSYQADFLEPVGGKINVRLIGPPDIVRGLTKDDVRLYVDVSGLDAGEHRVTIR
FT                   WDKPEQVRWEPSAETAMVNISEKAAAQ"
FT   gene            162113..163459
FT                   /locus_tag="GTNG_0151"
FT   CDS_pept        162113..163459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0151"
FT                   /product="Phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65538"
FT                   /db_xref="GOA:A4IJN4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJN4"
FT                   /protein_id="ABO65538.1"
FT                   /translation="MGKYFGTDGVRGVANRELTPELAFKIGRCGGYVLTKSAERPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGIMISASHNPV
FT                   QDNGIKFFGPDGFKLSDEQEQEIETLIDSPEDMLPRPIGSSLGQVNDYFEGGQKYLQYL
FT                   KQTIDEDFSGMKIALDCAHGATSSLATYLFADLEADVITMGASPNGLNINEGVGSTHPE
FT                   ALAAFVKEKGADVGLAFDGDGDRLIAVDERGNIVDGDQIMYICAKYLKETGRLKQQTVV
FT                   STVMSNLGFYKALEAQGISSVQTAVGDRYVVEEMKKNGYNLGGEQSGHIIFLDYNTTGD
FT                   GMLTALQLVNIMKIKGKPLSELAGEMKKYPQLLVNVRVTDKEKAMEHEQVKKVIAEVEA
FT                   EMNGNGRVLVRPSGTEPLVRVMAEAPTEEACRTYVERIADVIRREMGVE"
FT   gene            163985..165787
FT                   /locus_tag="GTNG_0152"
FT   CDS_pept        163985..165787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0152"
FT                   /product="Glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65539"
FT                   /db_xref="GOA:A4IJN5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJN5"
FT                   /protein_id="ABO65539.1"
FT                   /translation="MCGIVGYIGYQDVKEILLRGLEKLEYRGYDSAGIAVLNENGVHVF
FT                   KEKGRIADLRRIVDSDVKATIGIGHTRWATHGAPSRVNAHPHQSASGRFTLVHNGVIEN
FT                   YEMLKRDYLAGVTFQSDTDTEVIVQLIEKFVQEGLTTEEAFRKALSLLKGSYAIAMIDA
FT                   ENEETLYAAKNKSPLLAGLGDGFNVVASDAMAMLQVTNQFVELMDGEMLIVTSESVSIQ
FT                   TLNGEKVERKPYTAELDASDIEKGTYPHYMLKEIDEQPFVIRRIIQKYQDDNGELAIDQ
FT                   AIVNEVLNADRLYIVACGTSYHAGLVGKQLIESWAKIPVEVHIASEFSYNMPLLSEKPL
FT                   FIFISQSGETADSRAVLVQTRKLGHKAITITNVPGSTLSREADYTLLLHAGPEIAVAST
FT                   KAYTAQIAVLAILAASAAKAKGLELDFNLMKELAIVANVMEMLCDAKEEMEKIASDYLT
FT                   LTRNCFFIGRAVDYYVCLEGALKLKEISYIQAEGFAGGELKHGTIALIEDGTPVIALAT
FT                   QEHVNLSIRGNVKEVVARGANPCVISMRGLEGEGDRFIIPAVHPALTPLVSVVPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
FT   gene            166114..166593
FT                   /locus_tag="GTNG_0153"
FT   CDS_pept        166114..166593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0153"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65540"
FT                   /db_xref="GOA:A4IJN6"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJN6"
FT                   /protein_id="ABO65540.1"
FT                   /translation="MDAKAKKTALRGITYGLYIVGTKDENGTANAFAGNWLTQTSFNPP
FT                   LVAVAVKVGTRSQEQIAKSGVFSVNILETGQKDMVTAFFKSLEPEGNKLAGYEFYTEET
FT                   GCPIFKDALSFFECKVVEKVEKGDHYIYVGEVINAGVHREGDPLTLKETGFYYGG"
FT   gene            166941..167831
FT                   /locus_tag="GTNG_0154"
FT   CDS_pept        166941..167831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0154"
FT                   /product="Putative truncated transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65541"
FT                   /db_xref="GOA:A4IJN7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJN7"
FT                   /protein_id="ABO65541.1"
FT                   /translation="MISNWNSEHAWTYEIDPILEALFRYIDSLSLPETPYVTGRPPVSK
FT                   KSLLKCFFLKTYFSIDSLRKLVRILQRFRCFQRACGLGEVPHLSTFSRAAKWFREQGFP
FT                   VFHAQLLKDLEVRYPQIVLIDSTALRSSLYDSQAKWGVSTRYHWFKGYKLHLCTTAEGI
FT                   ILSHVLTTANRNDAAVAPELLVSLKQWDIEFVLGDAAYDSEKVRQTAEQSGILFISPIN
FT                   RRNSEERKDAYGRVLPVFLKTRFGQWLFGLRREIERVFNELKSDGLEQPRWYGFHRYVL
FT                   HVLCCILMHNFEFLL"
FT   gene            168410..168916
FT                   /locus_tag="GTNG_0155"
FT   CDS_pept        168410..168916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0155"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65542"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJN8"
FT                   /protein_id="ABO65542.1"
FT                   /translation="MPVGLTLLLLLVLVGCAKPKVEQTVKLGGAVKTIGDLVVLNGNSN
FT                   LPKGTVVQIVMKEIEGDTQVLEEKVKVEEDGSYSWSAKRPEQAKEYELNVMFLPELQPK
FT                   QVKEKYGEKGELIKRGSPGRVEYQTDGQTYVGIKMYDRILKIGDGIARQQTMLVKTLPS
FT                   LGPSY"
FT   gene            169181..169861
FT                   /locus_tag="GTNG_0156"
FT   CDS_pept        169181..169861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0156"
FT                   /product="oligopeptide transport system permease protein
FT                   OppB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65543"
FT                   /db_xref="GOA:A4IJN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJN9"
FT                   /protein_id="ABO65543.1"
FT                   /translation="MAQCSPTLNDDGAVCLFPYYFMGGAGCFLPYSCYAYICFLLPRPL
FT                   QKMVKGIAFFLESIPDVIFIFSTQLFVIWVFKKTDLLMVNPVAGFDNVYVLPIVMISIL
FT                   PSIMLFQMTFLAFTEEKDKPYAEYALAKGLSKTAVLWRHMFRNALLTVFSSVQYLFWFM
FT                   LSNLLVTKYLFNMHGFFRFLYEQRHTPEIVAIGLAMLFLPFYLIDVAGKRVIAYLTGIE
FT                   RGVA"
FT   gene            169858..170877
FT                   /pseudo
FT                   /locus_tag="GTNG_0157"
FT                   /note="nonfunctional Oligopeptide transport system permease
FT                   protein OppC due to internal stop codons"
FT   gene            171689..173776
FT                   /locus_tag="GTNG_0160"
FT   CDS_pept        171689..173776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0160"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65544"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJP0"
FT                   /protein_id="ABO65544.1"
FT                   /translation="MKAVETNLLKFMQGTKQFIIPIYQRKYSWTIKQCRQLWNDIVRVA
FT                   EDEKIRGHFVGSIVYIEQGLYQVSSVPQLLVIDGQQRLTTLTLLLLALGKAIEESGQTL
FT                   DITKKKIMNYYLVNSEEEGELYHKLILTESDKDTLINLVLGKELPEEYSPRIYENYHFF
FT                   VESIKNSGIDLNKLYQGISKLIVVDISLDRDHDNPQLIFESLNSTGLDLSQADLIRNFV
FT                   LMKLEPKEQAELYKEYWYPMEKSFGNLTNSSLFDRFMRDYLTVKTGRIPNIREVYSSFK
FT                   SYVFEQSEQDVQQIVADIYRYSQYFVKLAFQKEKDKEINEVLTDINTLKVDVSYPFLLE
FT                   VYDDYERQIISKSDFIEILRLVEAYVFRRAVCGIPTNSLNKTFATLSKEIDKANYLESL
FT                   QAAFLLKDSYKRFPTDEEFKRELVIKDVYNFRNRNYLLRKLENFNRKEIIDIESYTIEH
FT                   IMPQNPNLSYEWRRDLGPNWEEVHKTYLHTLGNLTLTRYNSELSDRPFKEKRDMEGGFA
FT                   DSPLRLNRGLARLETWNEEEICKRAQFLADLALKVWKYPQLSDDILAKYRKKSSKSESV
FT                   TYTIADYPKLQGDMLVLFNELSKRICNLDSSVRMEFKKRYIAFKTSTNFVDIVPQESRL
FT                   RLSLNMPFDEIQDLKGICRDVTNIGRLGNGDVEFHVSSVSEIEYAMFLIKQSYEKHRED
FT                   E"
FT   gene            174532..175011
FT                   /locus_tag="GTNG_0161"
FT   CDS_pept        174532..175011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0161"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65545"
FT                   /db_xref="GOA:A4IJP1"
FT                   /db_xref="InterPro:IPR021354"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJP1"
FT                   /protein_id="ABO65545.1"
FT                   /translation="MKRETIFLKVAVVLIGLPVLALCIFLVPVLGDVAVKLLPKFPWIK
FT                   YFVYLVFDTSALPFYFALYQAFQLLTYIDQNSAFSERSVKALKAIKYCAVVICGLHMLA
FT                   LPLFYLFAEKDDAPGVIFVGLLVPFASLVIAVFAAVLQKLLQQAIEIKQENELTI"
FT   gene            175022..175246
FT                   /locus_tag="GTNG_0162"
FT   CDS_pept        175022..175246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0162"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65546"
FT                   /db_xref="GOA:A4IJP2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJP2"
FT                   /protein_id="ABO65546.1"
FT                   /translation="MPIIVNLDVMLAKRKMSVTELSEKVGITMANLSILKNGKAKAIRF
FT                   STLEAICKALDCQPGDILEYRSEEGESNP"
FT   gene            175263..176171
FT                   /locus_tag="GTNG_0163"
FT   CDS_pept        175263..176171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0163"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65547"
FT                   /db_xref="GOA:A4IJP3"
FT                   /db_xref="InterPro:IPR008535"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJP3"
FT                   /protein_id="ABO65547.1"
FT                   /translation="MKGEKHEVAVNECPPFCLMIVRVRQFCRKSWLIKAFVQLIRFGWA
FT                   QALSCVFPVVIFASLALTKLAPLPLLPRYDWLLIICLLMQWWMVRSGLETRDELKVITV
FT                   FHLIGLSLELFKVRMGSWAYPEEGYTKLFGVPLYSGFMYASVASYLCQAWRRMKVELVR
FT                   WPPFWLVVPLAAAIYLNFFTHHYWVDVRWWLAGLVILVFWRSWVVYEVGGICYRMPIVL
FT                   SFLLIGFFIWIAENIATFFGAWQYPNQAKAWSLVHIGKVSSWVLLVIVSFLIVATLKQV
FT                   KGRASAGTVVNDEQKALQTGQ"
FT   gene            complement(176405..176593)
FT                   /locus_tag="GTNG_0164"
FT   CDS_pept        complement(176405..176593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65548"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJP4"
FT                   /protein_id="ABO65548.1"
FT                   /translation="MKIKVRSEGIGSGQAKQSIQISFVSKQRTERVIGENVCYRERDKK
FT                   EQLLLEMDGPWPFAGSF"
FT   gene            177017..177388
FT                   /locus_tag="GTNG_0165"
FT   CDS_pept        177017..177388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0165"
FT                   /product="Putative reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65549"
FT                   /db_xref="GOA:A4IJP5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJP5"
FT                   /protein_id="ABO65549.1"
FT                   /translation="MAKANRHSSPVYSLGYRPSHSLRWETSVGNYVKNALDWAHEAWNN
FT                   KAAGIVSDGSTGVAHAAEHLRGICGELKIVDVRTHPTLSLFTDFENGTVFKPQAFQVEQ
FT                   VNVMLDELLLWSVKNCKIK"
FT   gene            177402..177809
FT                   /locus_tag="GTNG_0166"
FT   CDS_pept        177402..177809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0166"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65550"
FT                   /db_xref="GOA:A4IJP6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJP6"
FT                   /protein_id="ABO65550.1"
FT                   /translation="MVQKYKWALLILRVALGLTFFIHGVAKFQMGLGNVAGWFESIGVA
FT                   GFLGYVVAFIELTGGVALIVGLGTRVISALLAFVMSGATFTVKLPAGFMGNSQTAGYEL
FT                   DVVLLSVAIALCLSGSQLFALDNKWFGSSKN"
FT   gene            complement(177937..179310)
FT                   /locus_tag="GTNG_0167"
FT   CDS_pept        complement(177937..179310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0167"
FT                   /product="Transcriptional regulator (NtrC/NifA family)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65551"
FT                   /db_xref="GOA:A4IJP7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJP7"
FT                   /protein_id="ABO65551.1"
FT                   /translation="MNREMETLLSMYEQILEMIDLGVHAVDQQGKTVIYNRKMRDIEGM
FT                   DVEDVLDKNILDVFRFHPEQPSTLLEALRTGESILNKQQTYFNNKGQAVTTINQTHPLW
FT                   KDGCIIGAVEIAKDVTKFRKLIAEQHQRGELSRSLAGIIVQSEAMQAAIRLARHAARSE
FT                   APVLLMGEKGTGKDLLASCIHYESERRLKPFLAQTCLSLPDDWMETMLFGSEENGEIQP
FT                   GLFEQADGGTVLLDDVDSLSLPLQQKLVHFLQEKQFTRVHGHKPVRADVRLITSTSGDP
FT                   IDAVQTGELLKSLYYQLAVHCIVLPPLRERREDILPLADHFIRQGNERYGLNVEGLADD
FT                   VQEAFLAYDWPGNVRELETVIDETLEMMDEGETITFDHLPASFRMKLAPDAPKTDFLFN
FT                   TEDILPLEKYMEEVEIYYIRKALQHHGFNITKTAKALGLSRQNLQYRIRKYRIDKEWG"
FT   gene            179560..180975
FT                   /locus_tag="GTNG_0168"
FT   CDS_pept        179560..180975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0168"
FT                   /product="Amino acid permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65552"
FT                   /db_xref="GOA:A4IJP8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJP8"
FT                   /protein_id="ABO65552.1"
FT                   /translation="MPPAQELKRELKSRHLFMIALGGVIGTGLFLGSGYTIHEAGPGGA
FT                   IAAYLFGGFVMYLTMLSLGELAVRIPDAGSYQTYATKFISPAAGFCIGWLSWLNWSVTV
FT                   GIELLTVSILMKRWFPDVPTWVFCAVFALLLFLVNALSVKGFAEVEFWFSSVKVLTVIA
FT                   FIVLGLAAMFGIVHMKSGQPAPFFSNFTDHGGLFPNGFWAIFTTMILVNFSFQGTELVG
FT                   VAAGESREPEKTVPIALRNTVWRILIFFVLAIFVLAGLFPWEKAGVVESPFVVVFDNIG
FT                   IPYAADIMNFVIITAVLSVANSGLYATSRVLWSMSRQGMVTPFFSKLSKRGVPINALIA
FT                   SIAIGCLSLLCSAYAEDTVYVWLTAIAGFGAVTVWASIALSSYLGRKAFLREGGDVRDL
FT                   KYRTPLYPFVPLAAFILNMAIIVGLAFIPDQRIALYCGIPFLLVCYAYYHLVAKKRIHL
FT                   QRTEEEVELKAAK"
FT   gene            181076..182623
FT                   /locus_tag="GTNG_0169"
FT   CDS_pept        181076..182623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0169"
FT                   /product="Delta-1-pyrroline-5-carboxylate dehydrogenase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65553"
FT                   /db_xref="GOA:A4IJP9"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJP9"
FT                   /protein_id="ABO65553.1"
FT                   /translation="MVQPYKHEPFTDFTVDANRQAFLAALEKVEAELGREYPLIIGGER
FT                   VMTEDKITSVNPANKAEVIGRVAKANKELAERAMKTADEAFRTWSRTSPEARADILFRA
FT                   AAIVRRRKHEFSAWLVKEAGKPWREADADTAEAIDFMEYYGRQMLKLKDGIPVESRPGE
FT                   TNRFFYIPLGVGVVISPWNFPFAIMAGTTVAALVTGNTVLLKPASATPVVAYKFAEVLE
FT                   EAGLPAGVLNYIPGSGAEVGDYLVEHPRTRFISFTGSRDVGIRIYERAAKVQPGQIWLK
FT                   RVIAEMGGKDAIVVDKEADLELAAQSIVASAFGFSGQKCSACSRAIIVEDVYDQVLNRV
FT                   VELTKQLNVGDPAEQATFMGPVIDQGAYNKIMEYIEIGKQEGRLMTGGEGDDSKGFFIQ
FT                   PTVFADVDPNARIMQEEIFGPVVAFAKARDFDHALEIANNTQYGLTGAVISRNRANLEK
FT                   ARHEFHVGNLYFNRGCTGAIVGYQPFGGFNMSGTDSKAGGPDYLILHMQAKTVSEMF"
FT   gene            182683..183900
FT                   /locus_tag="GTNG_0170"
FT   CDS_pept        182683..183900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0170"
FT                   /product="Ornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65554"
FT                   /db_xref="GOA:A4IJQ0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJQ0"
FT                   /protein_id="ABO65554.1"
FT                   /translation="MATKSEQLIEQTERYGAHNYHPLPIVVSEAEGVWVKDPEGNRYMD
FT                   MLSAYSAVNQGHRHPKIIEALKKQADRVTLTSRAFHNDQLGPWYEKVCRLTGKEMVLPM
FT                   NTGAEAVETALKAARRWAYDVKGVADNQAEIIVCEGNFHGRTLAAVSLSSEAAYKRGFG
FT                   PLLPGIKIIPYGDIEALKAAITPNTAAFLVEPIQGEAGIRIPPQGFLKAAYDVCKANNV
FT                   LFIADEIQTGLGRTGKLFACDWEAVVPDMYILGKALGGGVFPISCVVANRDILSVFEPG
FT                   SHGSTFGGNPLACAVSIAALDVIEEENLPARSLELGEYFLAKLQQIQNKDIKEIRGRGL
FT                   FIGVELHGPARPYCEMLKEQGLLCKETHETVIRFAPPLIITKEELDWALERIEKVLSQP
FT                   AASQKQ"
FT   gene            184190..184798
FT                   /locus_tag="GTNG_0171"
FT   CDS_pept        184190..184798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0171"
FT                   /product="alkaline phosphatase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65555"
FT                   /db_xref="GOA:A4IJQ1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJQ1"
FT                   /protein_id="ABO65555.1"
FT                   /translation="MQAWITEFMEQFGYIGIFFMIALENIFPPIPSEVILPFGGFMTTY
FT                   TTLTIPGVIAAATAGSVVGAIVLYGIGRLLSVERLERIVDRWGGWLRVKPEDIAKANRT
FT                   FQRYGVWAVFLGRMIPLVRSLISIPAGMSKMNIGLFVWLSVLGTLIWNTLLISIGAALG
FT                   QSWEKVSEVIGMYAEVVYVIIAIIILVAAVRFWKRRRAS"
FT   gene            complement(185093..186082)
FT                   /locus_tag="GTNG_0172"
FT   CDS_pept        complement(185093..186082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0172"
FT                   /product="Iron compound ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65556"
FT                   /db_xref="GOA:A4IJQ2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJQ2"
FT                   /protein_id="ABO65556.1"
FT                   /translation="MRMRITIVLVLLFLLITATVAIALGTGEAPLSYGRIIPTLFGYGS
FT                   MQEEFILFSLRLPRIVITLLAGMALALSGAMLQGITRNELADPGILGINAGAGAGVALF
FT                   FLFFPIEAGTFLYALPLVALVGALLTAAAIYAVSYNKTTGLQPVSFVLTGVGFSMALSG
FT                   LMIVLISAADRTKVDFIARWLSGNIWGDDWPFIFAMLPWLVIGAFIGLYRSKRLNLLHL
FT                   GDPVAIGVGVHVRRERLVLMATAVAVAAAAVAVTGGISFIGLMAPHIAKMIVGPRHERS
FT                   IPTSMLIGGWLLLTADTIGRNALAEPLPAGVVVSLIGAPYFIYLLLKR"
FT   gene            complement(186079..187086)
FT                   /gene="fhuB"
FT                   /locus_tag="GTNG_0173"
FT   CDS_pept        complement(186079..187086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="GTNG_0173"
FT                   /product="Ferrichrome transport system permease protein
FT                   FhuB"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65557"
FT                   /db_xref="GOA:A4IJQ3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJQ3"
FT                   /protein_id="ABO65557.1"
FT                   /translation="MEANRRLWPFRYTFLFSLVLLMAIWFGSMAIGVADTTWSDVWRAL
FT                   FSDEQGKQLDLIRELRLPRETAAAIVGAGLAVAGAIMQGMTRNPLADPGLLGLTAGANT
FT                   ALAMTMAFFPSAHYLIITVACLLGAAAGAGMVFGIGAARKGGFSPLRIVLAGSAVSALL
FT                   FAAAEGISLYFHISKDVSMWTSGGVAGTSWKQLSIIIPLIVIGLTIAVLYSRQLTILSL
FT                   SEDVAVGVGQKTTAVKVWLFVAVFFLTGASVAIAGNITFIGLMIPHLVRRIAGADYRFV
FT                   IPLSATVGAIAMVLADTAARTIHAPFETPVAAIVAVIGLPFFLFVVRKKGRGFE"
FT   gene            complement(187158..188084)
FT                   /gene="fhuD"
FT                   /locus_tag="GTNG_0174"
FT   CDS_pept        complement(187158..188084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="GTNG_0174"
FT                   /product="Iron compound ABC transporter iron
FT                   compound-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65558"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJQ4"
FT                   /protein_id="ABO65558.1"
FT                   /translation="MRKAWLSLLLLFTLLLSACGNAADDNKKNNASPEEKKPETITYQS
FT                   ENGEVEVPADPKRVVVLSTFAGHVLALDVPIVGVDSWSKMNPLFEEKLKDADVVTDEDI
FT                   EKIMALKPDLIIGLSNTKNVDKLSKIAPTVTFTYGKVDYLTQFLEIGKLLNKEKEAKAW
FT                   IDDFKQRAQQAGEEIRAKIGENATVTVAENFDKQLYVFGNNWARGTEILYQEMKLKMPK
FT                   AVEEQALKPGYYAVSLEALPQFVGDYLILSKNGDNDTSFMETNTFKNIPAVKNGHMFVA
FT                   DAKAFYFNDPITLDYQLDFFKKHFLGQ"
FT   gene            complement(188081..188881)
FT                   /gene="fhuC"
FT                   /locus_tag="GTNG_0175"
FT   CDS_pept        complement(188081..188881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="GTNG_0175"
FT                   /product="Ferrichrome ABC transporter ATP-binding protein
FT                   FhuC"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65559"
FT                   /db_xref="GOA:A4IJQ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJQ5"
FT                   /protein_id="ABO65559.1"
FT                   /translation="MVRLYAEELTVRYDDRTIFEHLSVRIPDRQITAIIGPNGCGKSTL
FT                   LKTLTRIISPQSGTIILDGKHISQQHTKELAKKMAILPQTPEAISGLTVAELVSYGRFP
FT                   YQRGFGRLTKKDYEAIDWALHVTKTADLRHRPVDALSGGQRQRVWIAMALAQETDIIFL
FT                   DEPTTYLDIAHQLEVLELLERLNKEEGRTIVMVLHDINQAARFADYVIAMKSGTIVKAG
FT                   PSEDVICRDVLRDVFGIDADIGLDPRTNKPVCFTYHLLKGVYSS"
FT   gene            complement(188999..189379)
FT                   /locus_tag="GTNG_0176"
FT   CDS_pept        complement(188999..189379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65560"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJQ6"
FT                   /protein_id="ABO65560.1"
FT                   /translation="MPKQFVMNIQKRQTSTIHLTRCFVAKQQQLVAKIQQTGKACCDSS
FT                   IPLRSSVAFSQQSVVDGLPCISAVPADRCSRGSQKAFCTSYSIGKDGKICSSSNGSLLS
FT                   PSVSLYAYVNSPFFKRRKPLFL"
FT   gene            189415..191484
FT                   /locus_tag="GTNG_0177"
FT   CDS_pept        189415..191484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0177"
FT                   /product="Sigma-54-dependent transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65561"
FT                   /db_xref="GOA:A4IJQ7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJQ7"
FT                   /protein_id="ABO65561.1"
FT                   /translation="MAMRVKDIMTRTTTVIFENDFLEQTARMLAERRIEGTVVFRCEGE
FT                   ISGVLTDNDVLFGLIQGKTTVREVMHPSLPPLSIHDCIENIKFGDGSLRPVVDENGRLV
FT                   GVLTKGQYLEAYAKAVQLRLKHMDAIFNAAHNGIISIDAEGRITSINPPAEKMARTTKE
FT                   EAIGRFLTDVVIPSGLLDVVRTGEGHTEKYRVGKRIYITNRSPIIDEGQVVGAVGVFQD
FT                   ISEIEFISHELETVKQIVNELQTVMDAASDGIAIIDRHGGIVRQNEKWAALFPSMEHQR
FT                   VPAPLERVVRQAFDSCQSCSMLHQGAETGNTLIVSAVPIIEKEGQAERLVLYVKDMTEM
FT                   EQLRVELEETKRLLHTLSQKEDGLIYRAPAMAHMVNIAKQAAAVDVTVLLTGESGTGKE
FT                   ELANFIWRQSARSNRPFVKVNCGAIPETLMESELFGYEAGAFTGAVKKGKKGYFEQADG
FT                   GTIFLDEISEIPLRLQVKLLRVLQSMEIVRLGAEAPKQIDVRVIAATNKPLEELVTAGR
FT                   FRADLFYRLNVMPIVIPPLRDRKEDIPLLVDHYRKRFAEKYQKPLVFTDRALEAMMDYH
FT                   WPGNVRELVNAVERMFVTATSSIVDEDQVAKWLHLEPSPTISPVAIGEIIPLKQAVAEV
FT                   ERQLMIKALNKARTYRQAAKLLGVDASTLVRKAQKYKIKSLGGEDDGVYVTSRD"
FT   gene            191456..192616
FT                   /locus_tag="GTNG_0178"
FT   CDS_pept        191456..192616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0178"
FT                   /product="Acyl-coA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65562"
FT                   /db_xref="GOA:A4IJQ8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJQ8"
FT                   /protein_id="ABO65562.1"
FT                   /translation="MEFTLPAEIEFLKENVRKFVREVVEPVAMDIEENDHIPEDIIEKS
FT                   KEMGLFGLSIPEEYGGLGLSMVGKCAIYEELGKTHNGYTTLIGAHTGIGTVGIVELGTE
FT                   EQKQRYLPKMATGEWIGAFALTEPSAGSNAAALKTTAVRKGDRYIINGSKHYITNAVDA
FT                   HVFTVMAVTDPSKGPKGITSFIVEKDFPGFTIGNVERKMGLRGSHSAELFFDNLEVPVE
FT                   NVLGKEGEGYINALKILANGRAGLAARNLGSCIRLLEYCMEYAEQREQFGKPIIEQQAI
FT                   QHMLAEMSMLIEVLRSTVYRVAWMVDQKMRVVKEAAIAKLFGSEVYNKIADMAVQIHGG
FT                   LGYMKDYPIERYFRDARITKIYEGTSEIQRNIIANELRKEYGKVRV"
FT   gene            complement(193054..193458)
FT                   /locus_tag="GTNG_0179"
FT   CDS_pept        complement(193054..193458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0179"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65563"
FT                   /db_xref="GOA:A4IJQ9"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJQ9"
FT                   /protein_id="ABO65563.1"
FT                   /translation="MSRLHELGVFLLRIVTGFIFFVHGWMKWHQGLEETAASFLAMGLP
FT                   AALAYIVTIVELAGGWAMMLGLGTRLMAAAFAVIMIGAIITVKADAGLLGNGQETGYEF
FT                   NLALLAMSIHLWLSGSRLWSLDTLVRHLRE"
FT   gene            193613..194320
FT                   /gene="frnE"
FT                   /locus_tag="GTNG_0180"
FT   CDS_pept        193613..194320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frnE"
FT                   /locus_tag="GTNG_0180"
FT                   /product="FrnE protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65564"
FT                   /db_xref="GOA:A4IJR0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJR0"
FT                   /protein_id="ABO65564.1"
FT                   /translation="MNIEIWSDFVCPFCYIGKRRLEQALEQFPHRKDVTVVFRSFELDP
FT                   NAPKETPLTIHEIIAQKYGITVEEAKRANADIGRQAEAVGLTFRFETMKPTNTFDAHRL
FT                   AQYAKEKGKLQDVVEQLFFAYFTESKHISDRDVLLDIAEAAGLDRSETEAVLDGDRYTE
FT                   QVREDEAEAAQLGVRGVPFFVLNRKYAISGAQPIEVFRQALEKVWEEEQQASSLQPLAD
FT                   EGGACTDGNCSID"
FT   gene            complement(194395..194859)
FT                   /locus_tag="GTNG_0181"
FT   CDS_pept        complement(194395..194859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0181"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65565"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJR1"
FT                   /protein_id="ABO65565.1"
FT                   /translation="MPRAQQWVQYFLSHRHVTMELINKIDEAHYDFKPTPTSMTAKQLA
FT                   THMVFSFYNFANVAKHGDPALFQPKMEDPETNLAKLAETYTEKTKQLLESMSDEEFNRT
FT                   IDLTAIFGVQMSAKQLLQMAMDHEIHHKGQLFVYVREMGHTDLPLFVKRG"
FT   gene            complement(194924..196255)
FT                   /locus_tag="GTNG_0182"
FT   CDS_pept        complement(194924..196255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0182"
FT                   /product="Sensory transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65566"
FT                   /db_xref="GOA:A4IJR2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJR2"
FT                   /protein_id="ABO65566.1"
FT                   /translation="MSIRRKLFFTMAVFIIGMGIMFSLITKVVVINILDVMLKVDRSHE
FT                   TNELATAFAHYYETHHRSWNGIQHIRLNTDIMKKHEQAGVVLLSPEGKQLYTTGEVPVS
FT                   WMIGLGISTKVQADGKTVAFLHYYDHEVGNMAKVRKGITSSVATLSLLSAAALVLISLF
FT                   VAHWLSKRFTAPLELLLPAIDRLGKGEFGIQAPVITKDEYGKVAQTFNEMSKQLQQAEE
FT                   VRRRLMADVAHELRTPLTILRGKLDWFQQQRRPIEPEKLLPLQDELIRLTRLVEDLHQL
FT                   SLAEAGKLPLERKPTDMESLLQQLIERVAPSAEEKNIRIHLTCSTNYTTISVDPHRITQ
FT                   VFLNLLVNAIRYTPEGGTVNVVIDEEPSMLQIAVTDTGIGIAPEHLPFLFHRFYRTDEA
FT                   RTRNRGGTGLGLAIANEFVSAHGGTIDVHSTPGQGTTFLVKLPR"
FT   gene            complement(196252..196938)
FT                   /locus_tag="GTNG_0183"
FT   CDS_pept        complement(196252..196938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0183"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65567"
FT                   /db_xref="GOA:A4IJR3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJR3"
FT                   /protein_id="ABO65567.1"
FT                   /translation="MPHTLLLVDDEERVLEFMEPFLRQEGFEIVTAKTGKEALQKAKET
FT                   NPSLVVLDWMLPEMSGIDVCRELRKTSHVGIIMVTAKTEETDKIIGLEVGADDYITKPF
FT                   SLRELAARIRSVLRRIEGQDNQEELMKRGDLTISEAQCRVWKRGSEISLTPTEFKLLLT
FT                   LAAKPGVVYSRLQLLQSIFEDDLFNDERTVDAHISRLRKKIEDDPSRPVYIQTVYGFGY
FT                   RFGEQI"
FT   gene            197140..197370
FT                   /locus_tag="GTNG_0184"
FT   CDS_pept        197140..197370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65568"
FT                   /db_xref="GOA:A4IJR4"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJR4"
FT                   /protein_id="ABO65568.1"
FT                   /translation="MNMKNPFDEERRMNMKQILLNLLVLLGGLVGGLIVSIVVIDVSYQ
FT                   WFGVSFGSLILLLPVVCAVIALTMFRRKWKE"
FT   gene            197389..197799
FT                   /locus_tag="GTNG_0185"
FT   CDS_pept        197389..197799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65569"
FT                   /db_xref="GOA:A4IJR5"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJR5"
FT                   /protein_id="ABO65569.1"
FT                   /translation="MSKERHRNKMMYLSRWMFAILAWGLVVSVVVQTFWAGMAIFNNPI
FT                   YWKNHIVFVHFFEMVPILMLIVAFAGRLPKKLCWQSAGLIGLIFIQYFTANLKIVGMLH
FT                   PVIALGLFFMSWNVARQSGTWHLSTEQGGKEK"
FT   gene            197796..198017
FT                   /locus_tag="GTNG_0186"
FT   CDS_pept        197796..198017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65570"
FT                   /db_xref="GOA:A4IJR6"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJR6"
FT                   /protein_id="ABO65570.1"
FT                   /translation="MKKLLLALFTALFAGLLGGIVLSEMIAVATWFFLGPSPWLKWLKY
FT                   MPIYLAVFVAVTTWIVLHYKSNRRSDNI"
FT   gene            198393..199124
FT                   /locus_tag="GTNG_0187"
FT   CDS_pept        198393..199124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0187"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65571"
FT                   /db_xref="GOA:A4IJR7"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJR7"
FT                   /protein_id="ABO65571.1"
FT                   /translation="MPKIFLDPGHGGNDTGAVGNGLREKDITLSIALEISRILQNEYEG
FT                   VSVQLSRTKDETVSLAERTRRANSWGADLYVSIHVNAGGGTGFEDYIYHGLSESSQTAR
FT                   IRDVLHEEIVRATQFRDRGKKKANFHVLRETKMSAVLTENGFIDHKEDAKQLTDPNFLR
FT                   MIARGHVNGLERALGLKKKASNPNNPPRDPDKGMPSTGRLTRVIVDGKQVGAFVEPDNV
FT                   LRQVEHYLGRAKRIVLEQVEE"
FT   gene            199249..200577
FT                   /locus_tag="GTNG_0188"
FT   CDS_pept        199249..200577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0188"
FT                   /product="Intracellular alkaline serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65572"
FT                   /db_xref="GOA:A4IJR8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJR8"
FT                   /protein_id="ABO65572.1"
FT                   /translation="MFGYSIVQLARRHAGRLDHPLRHTLVNMYKPMTRMPCIFHRWIER
FT                   WLRKWRTVSVLIEVDDDEGIEALTEAERNHFRMKTHHHFRHVPIWSATVTPAALEQLLE
FT                   NPKVKKVYLNRTIKAVLNNAVPSANAKHVTVNETELSGKGVTIAIVDTGIDPHPDLEGR
FT                   ITAFVDLVNGKTAPYDDNGHGTHCAGDAAGNGRMSDGLYAGPAYEANLVGVKVLNRSGM
FT                   GTLETIMRGIEWCIDYNKKNPANPIHIISLSLGGEPQPFPAENDDPLVQVAERAWENGI
FT                   VVCAAAGNEGPNYGTIASPGISDRIITVGALDDRDTASTRTDDAVAPFSSRGPTRYGVT
FT                   KPDLVVPGVNIISLRAPRSFLDKMNKQSRVGDYYMSMSGTSMATPICAGIVALMLQAKP
FT                   DATPDEIKQALRDSADLWKDRDPNVYGAGYVNAKRAIEQLLKR"
FT   gene            complement(200595..202574)
FT                   /locus_tag="GTNG_0189"
FT   CDS_pept        complement(200595..202574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0189"
FT                   /product="Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65573"
FT                   /db_xref="GOA:A4IJR9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJR9"
FT                   /protein_id="ABO65573.1"
FT                   /translation="MKTIGEKLLNKYRSLPNQGIGFFIFAVLLFWLKTYVTYLAEFNLG
FT                   ISNSMQEFLLFINPLSSAVFFLGLAFLAKETRFYRWLIIINFILSFILYANIVYYRFFS
FT                   DFITLPTLTQTKNFGDLGGSILELLRWYDVFYFLDTAILAVIIFSKRFSLPQVRAGRLK
FT                   KGVIFSSAILMFSVNLALAEADRPQLLTRTFDRNYIVKYLGVYNYLIYDAIQSMKSSTQ
FT                   RAFANKSDITTVLNHVQATYAEPNPKYFGVAKGKNVIYIHLESLQNFVINYKLHGEEVT
FT                   PFLNSLTRDPNTFYFDNFFHQTGQGKTSDAEFMLENSLYGLPQGAVFTTKGQNTYHAAP
FT                   AILRQYGYTSAVFHGNYKSFWNRDEIYKSFGFDHFFDASYYSMKDEDVLNYGLKDKPFF
FT                   RESIPLLETLKEPFYAKFITLSNHFPYPIGEEEATIAPATTGDGSVDRYFQTARYLDES
FT                   LKEFFDYLKESGLYDRSVIILYGDHYGISENHNKAMSQILGKEITPYEHAQLQRVPLFI
FT                   HVPGVKGGTIHEFGGQIDLLPTLLHLLGIDTKNYVHFGTDLLSPDHQEMVPFRNGDFVT
FT                   PTVTSVNGKYYDTKTGEPLEETPEIQRLEQIARTKLDLSDKVVYGDLLRFYTPKGFEPV
FT                   DPSKYDYNNRGGYNNRESKEGSAQ"
FT   gene            203104..203877
FT                   /locus_tag="GTNG_0190"
FT   CDS_pept        203104..203877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0190"
FT                   /product="Membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65574"
FT                   /db_xref="GOA:A4IJS0"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR014205"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJS0"
FT                   /protein_id="ABO65574.1"
FT                   /translation="MTQCAALITKMCREDKKYFPGNRCMSNGEKVPFLSRKAYSAAGGI
FT                   KMWLWISMILLAFSVSIDSLSVGMSYGMRKVRFPLPSLTLIACMSVVMILISMNIGRLL
FT                   AIFLPWGVERGLASFILIILGGWAIYNVYKTRQKEAVATEWEDIGQGNAAHSALQVLTK
FT                   PEFGDLDRSGSISRKEAVWLGLALSMDALGAGISASLLNFPSLPFALLVGLFNPLFIRL
FT                   GLMLGCMMAETKMMKKATILPGIMLIVLGLIKLFR"
FT   gene            203944..204939
FT                   /gene="spo0M"
FT                   /locus_tag="GTNG_0191"
FT   CDS_pept        203944..204939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spo0M"
FT                   /locus_tag="GTNG_0191"
FT                   /product="Sporulation-control protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65575"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJS1"
FT                   /protein_id="ABO65575.1"
FT                   /translation="MWKKLLSKFGIGAAKVDLVLHHSHVRLGKILEGEFWLEGGTVAQQ
FT                   IRKLEVALELEVHVQGKSYRRTVAIIPVASSFTIQPGERKALPFSYELPLHLPISRSMV
FT                   RYTFVTRLDIAGGADAYDRDTIEILPPTVLEQIFAAFAELGFREKPTSGRITPYGQEFS
FT                   FFPTGEFHGLVQEVEFFALVEEEGVRLHMEVDVRHGFGKEREMKRELFIPIEQLRDSSA
FT                   AARLIRETVEETVQAAGAFSTFGGQPLATPSSPMYRHSSSHYPSAHHSHHGRHGWTGAV
FT                   GGFAAGMLAGMIAEELLDDVVEDVMDDVADGLDVGDWFDGGDGFDGGDWL"
FT   gene            205470..206399
FT                   /locus_tag="GTNG_0192"
FT   CDS_pept        205470..206399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0192"
FT                   /product="Probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65576"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJS2"
FT                   /protein_id="ABO65576.1"
FT                   /translation="MRYYIVFDIGGTYVKHAVMNEHGDFLQKGRYRSERHDFHQFRDDL
FT                   LHIVRQARANYELSGIAISSAGSVDSDSGIIGGSSALPCIHGPNFKEVFGGATGLPVEL
FT                   ENDANCAALGELWKGAGRGCRDIAFVIVGTGIGGAIVKDGHIHKGVHLHGGEFGYMLMD
FT                   VRYKNGTVECKTWSELAATSALIRMTAEEKGIPQSELDGEKVFALAESGDEAAQSAIDR
FT                   FYFSLAHGIFNLQYAYDPEKIILGGAISNRPDFVDEINKRLSVLLSLVPIAKVQPVVAT
FT                   CQFKNDANLLGALYHYLERRGELGEASG"
FT   gene            206612..207433
FT                   /locus_tag="GTNG_0193"
FT   CDS_pept        206612..207433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0193"
FT                   /product="Bacitracin resistance protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65577"
FT                   /db_xref="GOA:A4IJS3"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJS3"
FT                   /protein_id="ABO65577.1"
FT                   /translation="MDWMELLKAVILGMVEGLTEFAPVSSTGHMIIVDDLWLKSTEFLG
FT                   KYAANTFKVVIQLGSILAAVVVFKDRFLELLGIRGRHPGGKPRLTLLHVIIGLLPAGVL
FT                   GVLFEDYIDEHLFSTKTVLIGLVLGALLMIVADRFAKKAARAQTVDQITYKQAFLVGLV
FT                   QCLSLWPGFSRSGSTIAGGVLVGMSHRAAADFTFIMAVPIMAGASGLSLLKNWQYVTVA
FT                   DIPFFIAGFLSAFVFALLAIRFFLHLINRIRLVPFAVYRIALAFIIYFLYF"
FT   gene            complement(207604..208674)
FT                   /locus_tag="GTNG_0194"
FT   CDS_pept        complement(207604..208674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0194"
FT                   /product="UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide)pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65578"
FT                   /db_xref="GOA:A4IJS4"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJS4"
FT                   /protein_id="ABO65578.1"
FT                   /translation="MRKKIVLTGGGTAGHVMVNVALIPKLKEQGWDIVYIGSHEGIERE
FT                   IIGRIDGVPYYSVSTGKLRRYFDWKNFKDPFNVLKGVWQAYRLIQKEKPDIVFSKGGFV
FT                   SVPVILGAWLNGVPSVIHESDLTPGLANKIAMPFATKICLTFPETKQHVNTDKAVYVGA
FT                   VVREELKHGSAEQGRKLCQFDGQKPVLLAMGGSLGSKKINDALRASLPVLLSEFDIVHI
FT                   CGKGNVDTSLVGQKGYKQFEYVNEELPDLLALSDIVVSRAGANAIFELLALRKPMLLIP
FT                   LSKAASRGDQILNARSFEKAGYAEVLMEEEVTNESLPAAIHRLYENKDRYKKNMEKSGS
FT                   SDPLQTLLALIQNTAR"
FT   gene            209071..209799
FT                   /locus_tag="GTNG_0195"
FT   CDS_pept        209071..209799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0195"
FT                   /product="Chitooligosaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65579"
FT                   /db_xref="GOA:A4IJS5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJS5"
FT                   /protein_id="ABO65579.1"
FT                   /translation="MLAWLVGGLMVGIIGYGVVPTIVIRKKRLRLFCEGTAPDCLALTF
FT                   DDGPDPYYTPKLLDLLKKYGVKATFFVVGRKVERHPEIVRRMVEEGHEVGIHNYRHISN
FT                   WLLPPLWLDWGVRRAAAAIEQATGQRPMYYRPPWGHFNAWTPVVQKRYTTVLWSHILGD
FT                   WNEKIGAMELFRRLRAAVRGGAVIVLHDNGDALGASKRAPEQMLSALELLLKDEVAKKM
FT                   RWVTITELRNAQTNKQISSM"
FT   gene            209810..210406
FT                   /locus_tag="GTNG_0196"
FT   CDS_pept        209810..210406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0196"
FT                   /product="Alkaline phosphatase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65580"
FT                   /db_xref="GOA:A4IJS6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJS6"
FT                   /protein_id="ABO65580.1"
FT                   /translation="MDTGAWLPYVQSYGYVMLLLFLFCGIVGIPAPEESLLFFVGVVIA
FT                   KNQLLLWPTLVSCWGGTMAGMVAAYGAGRRWGSPLVQKYGKYVGITDERWERSRDWFCR
FT                   YGKWGILFGCYVPGVRQICPYMAGVSRFPFRTFLLLAMLGTAGWVVPLTLVGLLLGQHI
FT                   HIPLISFPLAGLGLFLLFLLATWIGQRRRKKSVES"
FT   gene            210418..211563
FT                   /locus_tag="GTNG_0197"
FT   CDS_pept        210418..211563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0197"
FT                   /product="Alkaline phosphatase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65581"
FT                   /db_xref="GOA:A4IJS7"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJS7"
FT                   /protein_id="ABO65581.1"
FT                   /translation="MMKVLFLPLFQMNTGHHKVADTLIDFLHRQFPWVESKKIDFLSYC
FT                   NELMEKMVSGAYLRWIRSHPASYHRVYKTFMYEESLRLEFVSFEPWLPYFEGKMKKMLE
FT                   QERPDLIVCTHSFPSRILQQLKRKKVLAIPVVNVYTDFFMNSIWGKRFIDYHFVPHQEA
FT                   KRELIVKHGIDERRIVVTGIPVHDTFMKMPEVRRRRQPTHVLVAGGNQGLGNMTAFLRA
FT                   ARTSTLFRYSVLCGANKQLYHEIASWQLPHIRPLPYINSPEEMNQLYDEADAVITKPGG
FT                   VTISELLHKRIPIFTIDCLPGQERINWQYLRRNGLIYHLAEPGNGERKMIRLLTDDVEK
FT                   NRFFRRVSDYFAGVEKTGQEALAEVVTAMPQQRMAWRVLRP"
FT   gene            211720..212814
FT                   /locus_tag="GTNG_0198"
FT   CDS_pept        211720..212814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0198"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65582"
FT                   /db_xref="GOA:A4IJS8"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJS8"
FT                   /protein_id="ABO65582.1"
FT                   /translation="MKTRVGVLYGGKSPEHQVSLSTARAVMNAIDPHKFDVIPIYITPE
FT                   GQWIKGKRLTGTVEEVKQLQFTSTATAMIPVSLNQVPASGSATESDEETIDVIFPLLHG
FT                   PNGEDGTVQGLLEMLNLPYVGNGVLASAVGMDKVVMKNLFAQAGLRQAKYVSVTKYEWK
FT                   KGGEAVYDRIEQELGYPCFVKPANAGSSVGISKCKQRDDLKTAFAEAFKYDRKIIIEES
FT                   IVGREIEIGVIGNDEPICSVAGEIVPKKEFYDYEAKYEDGQTELIIPANVTEEQYETIK
FT                   SMAIAAFKALDLSGLARVDFFLAEDGTVYINEVNTMPGFTPYSMFPLLWQHSGVPYSEL
FT                   IERLIALALERHQEKQMITYTFEK"
FT   gene            212831..214213
FT                   /locus_tag="GTNG_0199"
FT   CDS_pept        212831..214213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0199"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate-D-alanyl-D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65583"
FT                   /db_xref="GOA:A4IJS9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJS9"
FT                   /protein_id="ABO65583.1"
FT                   /translation="MMKRTVQQIAEMTGGRYANPEWGNIAVSGVSTDTRTIQAGNLYVP
FT                   LLGETFNGHAFVEEAAQKGAAAVLWAEAEGTPPESVPAIVVDDTLSALQRLATRYREQL
FT                   GLKVVGVTGSNGKTTTKDMIAALLSSQYRVQKTEGNLNNHIGVPLTLLALEEGTDIAVV
FT                   EMGMSGFGEIEQLTTIARPNAAVITNIGEAHLQELGSREGIAKAKLEILSGLQGDGLFV
FT                   YHGDEPLLAELVPSLPLPQHVVTFGEGEDNDYYPTTVRIEAAGTSFVINELPRQTLFIP
FT                   VLGKHHVYNALAAIAVARFFGVSWENIAAALSRLQVTRMRTEVVKTKRGFTVINDAYNA
FT                   SPTSMRAALMLLTELDGYRKKIAVLGDMLELGDKEVEFHQAIGEMLRPEMVDYVFTYGP
FT                   LARHIATAATPFFDQGQVKAFDDKAALAEAVLSVATPDDIVLLKASRGMRLEELLGYWG
FT                   EN"
FT   gene            214281..214979
FT                   /locus_tag="GTNG_0200"
FT   CDS_pept        214281..214979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0200"
FT                   /product="Esterase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65584"
FT                   /db_xref="GOA:A4IJT0"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJT0"
FT                   /protein_id="ABO65584.1"
FT                   /translation="MIGCLCIHGFTGSPEEVAPLANYLRERTSWIVETPTLPGHGDKLQ
FT                   LKGVTYNQWITASEQAFQALAQRCNTVYVIGFSMGGVIAVYLAEKYPVARLVLLSAAFY
FT                   YVNPRQLWRDIREMFANGWRGAQEHPLFLRYRNKMMATPFSAVREFRKLVRHVRPLLPC
FT                   VQAPVLIVQGEKDGIVPLKSAYYLYEKIGSAEKTLLLLPDSYHHVCHSANRHVLFAETE
FT                   KFLCASYHCK"
FT   gene            215058..216461
FT                   /locus_tag="GTNG_0201"
FT   CDS_pept        215058..216461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0201"
FT                   /product="ATP-dependent RNA helicase, DEAD/DEAH box family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65585"
FT                   /db_xref="GOA:A4IJT1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJT1"
FT                   /protein_id="ABO65585.1"
FT                   /translation="MTTFQELGLSKEVMKAIERMGFEETTPIQAKTIPLSLQNKDVIGQ
FT                   AQTGTGKTAAFGIPIVEKVDVKNGVIQALVVAPTRELAIQVSEELYKIGAVKRVRVLPI
FT                   YGGQDIERQIRALKKHPHVIVGTPGRIIDHINRGTLRLEHVRTVVLDEADEMLNMGFIE
FT                   DIEAILRHVPTERQTLLFSATMPDPIRRIAERFMNDPELVKVKAKEMTVPNIQQYYLEV
FT                   HEKKKFDILTRLLDIQAPELAIVFGRTKRRVDELAEALNLRGYAAEGIHGDLSQAKRLS
FT                   VLRKFKEGSIEILVATDVAARGLDISGVTHVYNFDIPQDPESYVHRIGRTGRAGKTGVA
FT                   MTFVTPREIGQLHHIERTTKRKMERMKPPTLNEALEGQQRIAIEKLLNVAEAENLSFYK
FT                   RAAEELLEEHDSVTIVAACLKMLTREPDTTPVKLTEEPPLAVKREKKRGSRPDSSARGR
FT                   TKKRRITAH"
FT   gene            complement(216473..217090)
FT                   /locus_tag="GTNG_0202"
FT   CDS_pept        complement(216473..217090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0202"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65586"
FT                   /db_xref="GOA:A4IJT2"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJT2"
FT                   /protein_id="ABO65586.1"
FT                   /translation="MFHDAGDVRSLVRLYPVVSIVLSAHIILWILFVLPLTALEPVWQY
FT                   IIGTNGAIRNGEYWRLISPLVLHYDFNHMAANSLSLWLFGPWLERALGKGKFLLLYIGG
FT                   GVGANIATVLLLPPMYTHVGASGAIFALFGMYSYLALFRRDLIAPKHTQLLLVIVVIHL
FT                   LLSLMEPDGNLMAHLFGFATGGLLAPFLAIRPQLPMFHVIRS"
FT   gene            217231..217620
FT                   /locus_tag="GTNG_0203"
FT   CDS_pept        217231..217620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0203"
FT                   /product="Holo-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65587"
FT                   /db_xref="GOA:A4IJT3"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJT3"
FT                   /protein_id="ABO65587.1"
FT                   /translation="MIVGIGIDIVELERIQSLLERNRKFLDRILTPREREQFDQLAPAR
FT                   QVEFLAGRFAAKEAYAKALGTGIGRHVSFQDIEIVSDEYGKPSIAARRDGEVIHLSISH
FT                   SRDYAIAQVIIERFGPAKPSDACHG"
FT   gene            217700..218713
FT                   /locus_tag="GTNG_0204"
FT   CDS_pept        217700..218713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0204"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65588"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJT4"
FT                   /protein_id="ABO65588.1"
FT                   /translation="MGRKVLWALVGIIFLFALAGCGSKSQEEVLRALNEKMDEMTGYQA
FT                   EAKMTFRTGEKPQVYHVEVWHKQPSYYRVSLKNADKGQSQMILRNDEGVFVFTPALNKS
FT                   FKFVSDWPKNSSQAYLYESLLKDISSDSKAKFKATKKHYVFETKTNYPNSEIVPIQEIT
FT                   LRKKDLAPVSVKVMDTDRKALLTVEFSNVEFNKKFDDDAFDTSKNMTGARLEVPAMAEG
FT                   KEQVMEVMYPSQLPEGVQALEEKEVKSADGTRVIMTFGGKKSFTLVQEKAEVLPATSMP
FT                   VPVNGDPVDLGFTVGALTGQTLTWSYNGVEFTLASDDLTPEEMVMVASSVQEKAAK"
FT   gene            219008..220162
FT                   /locus_tag="GTNG_0205"
FT   CDS_pept        219008..220162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0205"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65589"
FT                   /db_xref="GOA:A4IJT5"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJT5"
FT                   /protein_id="ABO65589.1"
FT                   /translation="MDNFHRDTWAEIDLDAIYDNVANLRRFLPDGTQVMAVVKANAYGH
FT                   GDAQVATTALEAGASYLAVAILDEALALRQKGINAPILVLGASRPADVELAARHRITLT
FT                   VFRADWLEEAASIYNGSTPVHLHLKMDTGMGRLGVKDEEETKRITTLIDRHPSFILEGV
FT                   YTHFATADEVNTDYLSYQYRRFLHMLEWLPSRPPIVHCANSATVLRFPERAFNMARFGI
FT                   SMYGLAPSPSIKPLLPYELKEAFSLHSRLVHVKRLQPGEKVSYGATYTAQEEEWIGTLP
FT                   IGYADGWLRRLQHFHVLVNGQKAPIVGRICMDQCMIRLPEPLPVGTKVTLIGRQGDEFI
FT                   SVDDVARYLETINYEVPCTISYRVPRIFFRNKRIMEVRNAVCHG"
FT   gene            220290..220571
FT                   /locus_tag="GTNG_0206"
FT   CDS_pept        220290..220571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0206"
FT                   /product="Hypothetical Cytosolic Protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65590"
FT                   /db_xref="GOA:A4IJT6"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJT6"
FT                   /protein_id="ABO65590.1"
FT                   /translation="MSESGATTEIVVRLPQSLLTELDGLVKQENGNRNELIYQATKMYI
FT                   RERKKRQIREAMRRGYMEMAKINLSIASEAFHAEYEADHTVERLVSGG"
FT   gene            220576..220926
FT                   /locus_tag="GTNG_0207"
FT   CDS_pept        220576..220926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0207"
FT                   /product="Transcriptional regulator PemK family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65591"
FT                   /db_xref="GOA:A4IJT7"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJT7"
FT                   /protein_id="ABO65591.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVA
FT                   AITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVD
FT                   EALQISLGLIDF"
FT   gene            220985..221263
FT                   /locus_tag="GTNG_0208"
FT   CDS_pept        220985..221263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65592"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJT8"
FT                   /protein_id="ABO65592.1"
FT                   /translation="MFAKSERADRRSGVERATLDFIMAFLHQWQRRADRLSQRSVLSFL
FT                   FRSVKETPSFKRTKGGAQRLAGEECRLMLGQTHSSRDVCAVLCGRDI"
FT   gene            221587..223752
FT                   /locus_tag="GTNG_0209"
FT   CDS_pept        221587..223752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0209"
FT                   /product="S1 RNA binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65593"
FT                   /db_xref="GOA:A4IJT9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJT9"
FT                   /protein_id="ABO65593.1"
FT                   /translation="MTNEQRLISIIATEQQLTVKQVKNVISLHQEGNTIPFIARYRKEM
FT                   TGALDEVQIRDVLERWEYLQHLERRKEEVIRLVEEQGKLTEELKNAIISATKLQQVEDL
FT                   YRPYRQKRRTKATIAKEKGLEPLADWLLSCPTAPSPNEQAKAFIDDEKGVATVDEALQG
FT                   AKDIIAERVADDATLRQWVREQTWRKGTIASTAKAPEKDEKNVYEMYYDYEEPIAKIVP
FT                   HRVLALNRGEKEEVLRVSVKAPVEDIVRYLQRKTVTNELSPAATLVAEAVEDGYKRLME
FT                   PAIEREIRNELTEKAEERAIHIFAENLRKLLLQPPLKGKTVLGIDPAYRTGCKLAVVDE
FT                   TGKLLRIDVIYPHPPQERKEEARAKLLRLLDDYHVDMIAIGNGTASRETEQFVADTLKQ
FT                   VERDIFYVIVNEAGASVYSASDLARAEFPDLQVEERSAVSIARRVQDPLAELVKIDPKS
FT                   VGVGQYQHDVSQKKLAESLRFVVETVVNQVGVNVNTASVSLLQYVSGLTKTVSENIVKR
FT                   REEQGKFRSRDELKTIPRLGAKTYEQCIGFLRILDGEEPLDRTPIHPERYAEVKRLLQT
FT                   LGFTTDAIGSDELRQALQALDIEATAAELGIGELTLRDIIDALCRPERDPRDELPKPLL
FT                   RKDVLKMEDLKPGMELEGTVRNVVDFGAFVDIGVKQDGLVHISKLSKQYVRHPLDIVSV
FT                   GDVVKVWVEHVDVAKGRISLSMVSPEE"
FT   gene            223973..224461
FT                   /locus_tag="GTNG_0210"
FT   CDS_pept        223973..224461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0210"
FT                   /product="Zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65594"
FT                   /db_xref="GOA:A4IJU0"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJU0"
FT                   /protein_id="ABO65594.1"
FT                   /translation="MDQKRLQALVEQISISIFGKPFRHTASFNPRLRTVGGRYVLQTHN
FT                   IELNKKYYDMFGEEELIAIIKHELCHYHLHLEGKGYRHRDRDFRELLKKVGAPRYCRPL
FT                   KQETKATKAIHTYICTSCGLVYNRKRRINTDRYVCGRCHGRLKLAEDETKQNILQKRG"
FT   gene            224699..224773
FT                   /locus_tag="GTNG_t022"
FT   tRNA            224699..224773
FT                   /locus_tag="GTNG_t022"
FT                   /product="tRNA-Asn"
FT   gene            224780..224872
FT                   /locus_tag="GTNG_t023"
FT   tRNA            224780..224872
FT                   /locus_tag="GTNG_t023"
FT                   /product="tRNA-Ser"
FT   gene            224889..224960
FT                   /locus_tag="GTNG_t024"
FT   tRNA            224889..224960
FT                   /locus_tag="GTNG_t024"
FT                   /product="tRNA-Glu"
FT   gene            224991..225066
FT                   /locus_tag="GTNG_t025"
FT   tRNA            224991..225066
FT                   /locus_tag="GTNG_t025"
FT                   /product="tRNA-Asp"
FT   gene            225080..225154
FT                   /locus_tag="GTNG_t026"
FT   tRNA            225080..225154
FT                   /locus_tag="GTNG_t026"
FT                   /product="tRNA-Gln"
FT   gene            225317..225392
FT                   /locus_tag="GTNG_t027"
FT   tRNA            225317..225392
FT                   /locus_tag="GTNG_t027"
FT                   /product="tRNA-Lys"
FT   gene            225398..225479
FT                   /locus_tag="GTNG_t028"
FT   tRNA            225398..225479
FT                   /locus_tag="GTNG_t028"
FT                   /product="tRNA-Leu"
FT   gene            225491..225573
FT                   /locus_tag="GTNG_t029"
FT   tRNA            225491..225573
FT                   /locus_tag="GTNG_t029"
FT                   /product="tRNA-Leu"
FT   gene            225647..225723
FT                   /locus_tag="GTNG_t030"
FT   tRNA            225647..225723
FT                   /locus_tag="GTNG_t030"
FT                   /product="tRNA-Arg"
FT   gene            225728..225801
FT                   /locus_tag="GTNG_t031"
FT   tRNA            225728..225801
FT                   /locus_tag="GTNG_t031"
FT                   /product="tRNA-Pro"
FT   gene            225817..225890
FT                   /locus_tag="GTNG_t032"
FT   tRNA            225817..225890
FT                   /locus_tag="GTNG_t032"
FT                   /product="tRNA-Gly"
FT   gene            225975..227522
FT                   /locus_tag="GTNG_16s005"
FT   rRNA            225975..227522
FT                   /locus_tag="GTNG_16s005"
FT                   /product="16S ribosomal RNA"
FT   gene            227912..230841
FT                   /locus_tag="GTNG_23s005"
FT   rRNA            227912..230841
FT                   /locus_tag="GTNG_23s005"
FT                   /product="23S ribosomal RNA"
FT   gene            231093..231209
FT                   /locus_tag="GTNG_5s006"
FT   rRNA            231093..231209
FT                   /locus_tag="GTNG_5s006"
FT                   /product="5S ribosomal RNA"
FT   gene            231482..231940
FT                   /locus_tag="GTNG_0211"
FT   CDS_pept        231482..231940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0211"
FT                   /product="ATP/GTP hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65595"
FT                   /db_xref="GOA:A4IJU1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJU1"
FT                   /protein_id="ABO65595.1"
FT                   /translation="MEQLELIVHSPKETKEIARRLAEQLEPGMVIALEGDLGAGKTTFT
FT                   KGIAEGLGITQNVNSPTFTIIKQYEGRLPLYHMDVYRLEDEWEDLGFDEYFAGDGVTVV
FT                   EWAHLIAGQLPNERLTVHLYHHGDSERKLVFEPLGQRYEQLCKEIFAS"
FT   gene            231937..232677
FT                   /locus_tag="GTNG_0212"
FT   CDS_pept        231937..232677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0212"
FT                   /product="Glycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65596"
FT                   /db_xref="GOA:A4IJU2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJU2"
FT                   /protein_id="ABO65596.1"
FT                   /translation="MKILGIDTSNMPLGIALMDGNVIKGEIITNVKKDHSARAMPAIES
FT                   LLRQCGITPDELDLIVVAKGPGSYTGVRIGVTIAKTLAWSLGIPIAGVSSLEVLAANGR
FT                   YFPGVIVPLFDARRGQIYTGLYRYEGGVLRCLEEDRIVAADEWAHQLSQQGEDVLLVGV
FT                   DAPLYSELFRNHLGERVHVAPPSLALPRPSELVMLGKEKERENAHAFVPNYIRLAEAEA
FT                   KWLAKQKGEGTDGDRCTISSNDHP"
FT   gene            232637..233089
FT                   /locus_tag="GTNG_0213"
FT   CDS_pept        232637..233089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0213"
FT                   /product="Ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65597"
FT                   /db_xref="GOA:A4IJU3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJU3"
FT                   /protein_id="ABO65597.1"
FT                   /translation="MGIDVQFRPMTIHDIDEVVQVERASFTAPWSRESFYNELMYNRYA
FT                   KYIVMVHRGRIIGYGGMWLVIDEAHVTNVAVLPQFRGQKLGEALMRRLMDLAKQHGAVT
FT                   MTLEVRVSNHVAQSLYRKLGFRNGGIRKRYYPDNFEDALVMWVKLI"
FT   gene            233086..234099
FT                   /locus_tag="GTNG_0214"
FT   CDS_pept        233086..234099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0214"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65598"
FT                   /db_xref="GOA:A4IJU4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJU4"
FT                   /protein_id="ABO65598.1"
FT                   /translation="MNEDVYVLGIETSCDETAAAVVKNGKEIVSNVVASQMESHRRFGG
FT                   VVPEIASRHHVEQITLVIEEAMQRAGVSFSNLDAVAVTAGPGLVGALLVGVNAAKALAF
FT                   AHGLPLVGVHHIAGHIYANQLVAEMKFPLLALVVSGGHTELIYMEEHGKFTVIGETRDD
FT                   AAGEAYDKVARALGLPYPGGPHIDRLAHEGEPVIDLPRAWLEEGSYDFSFSGLKSAVLN
FT                   TLHNAKQRGEEIDPKHMAASFQESVVDVLVTKTVQAAKQYRVRQVLLAGGVAANRGLRS
FT                   ALQDKMKELPGVELVIPPLSLCTDNAAMIAAAGTVLYWQGKRSDLALNANPGLPLV"
FT   gene            complement(234441..236372)
FT                   /gene="uup"
FT                   /locus_tag="GTNG_0215"
FT   CDS_pept        complement(234441..236372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uup"
FT                   /locus_tag="GTNG_0215"
FT                   /product="ABC transporter ATP-binding protein Uup"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65599"
FT                   /db_xref="GOA:A4IJU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJU5"
FT                   /protein_id="ABO65599.1"
FT                   /translation="MIILQVHQLTKYFGADLILSNIKLEVQSRDRIALVGRNGAGKSTL
FT                   LKIIAGELSYDSGEIIKPSHIKIGYLAQNSGLDSSRSIWDEMLEVFAPLLAIEKQLAAL
FT                   GSQLGDPDVLADPARYEKILKAYDELQEQYKEQGGYQYEADIRSVLHGLQFSSYDYKTT
FT                   LISSLSGGQRTRLALGKLLLSKPDLLILDEPTNHLDLETLSWLEQYLQAYPGAVLLVSH
FT                   DRYFLDKVVTEVYELSNTKLKRYTGNYSRYLEQRAEQYEQELKRYEKQQEEIARLQDFI
FT                   QRNIARASTTKRAQSRRKQLEKMERLERPTGDGKSASFSFTIERPSGHEVLTAEELAVG
FT                   YGEGTPVIRQISFRITRGESVALVGPNGIGKSTLLKAVAQRLPVQAGKLRYGSNVQIGY
FT                   YDQNQAELSSNKRVLDELWDDYPDKTEKEIRTVLGNFLFSGDDVLKPVSALSGGEKARL
FT                   ALAKLMLQKANVLILDEPTNHLDLDSKQVLEQALIDYPGTILFVSHDRYFINRIATKLF
FT                   ELSSDGLTEYLGDYDYYIAKKAEMCELERLDARPDKTQDSNESSKSAYKQEKEEKKRQR
FT                   QRQRRLDEIEAEIETLEAQIAEVEQQLCDPSIYGDYETVQRLSQENEERKRQVEKLLAE
FT                   WEQLYSSL"
FT   gene            236471..236959
FT                   /gene="moaC"
FT                   /locus_tag="GTNG_0216"
FT   CDS_pept        236471..236959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="GTNG_0216"
FT                   /product="Molybdenum cofactor biosynthesis protein MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65600"
FT                   /db_xref="GOA:A4IJU6"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJU6"
FT                   /protein_id="ABO65600.1"
FT                   /translation="MSSFTHFNEQGRAKMVDITNKEDTVRVAVAKTSVTVSEEIYEKMT
FT                   NNAIEKGDVLAVAQVAGVMAAKKTADLIPMCHPLMLKGVDIAFSWENEADAYKLVITAT
FT                   VKTKGSTGVEMEALTAASVCALTVYDMCKALDKGMIIGPTYLVEKTGGKSGHYRRKTD"
FT   gene            236975..237616
FT                   /locus_tag="GTNG_0217"
FT   CDS_pept        236975..237616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0217"
FT                   /product="AT-rich DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65601"
FT                   /db_xref="GOA:A4IJU7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJU7"
FT                   /protein_id="ABO65601.1"
FT                   /translation="MSNEQPKIPQATAKRLPLYYRFLKNLHASGKQRVSSAELSEAVKV
FT                   DPATIRRDFSYFGALGKKGYGYNVNYLLSFFRRTLEEDEVTEVALFGVGNLGTAFLNYN
FT                   FSKNNNTKIVMAFDVDEQKVGTTVGGVPVYHLDELEERLCGNIPVAILTVPAVAAQALT
FT                   DRLVTQGIKGILNFTPARLNVPKHIRVHHIDLAIELQSLVYFLRNYPLPS"
FT   gene            237632..237784
FT                   /locus_tag="GTNG_0218"
FT   CDS_pept        237632..237784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0218"
FT                   /product="Component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65602"
FT                   /db_xref="GOA:A4IJU8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJU8"
FT                   /protein_id="ABO65602.1"
FT                   /translation="MKYILIVLVILLLFGTKKLPELGRSVGQSLREFKDATKGLTDDEE
FT                   NKTDR"
FT   gene            237805..238548
FT                   /locus_tag="GTNG_0219"
FT   CDS_pept        237805..238548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0219"
FT                   /product="Component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65603"
FT                   /db_xref="GOA:A4IJU9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJU9"
FT                   /protein_id="ABO65603.1"
FT                   /translation="MNNKEMSVYEHLGELRKRLIIVLLFFVTALVASFFFADDVIVYLQ
FT                   QTAEAKQLTMNAFRLTDPIKVYFQFAFVIAAVLSAPVLLYQIWAFVSPGLYEKERKVTL
FT                   SYIPASIFLFLVGVGFAYFVLFPFVVRFMNELADRLDIQQMIGINEYFQFLLHLVLPFG
FT                   IVFQLPIVVLFFTRLGLITPQLLVRIRKCAYLALLILAAAITPPDVLSQVIVMIPLTLL
FT                   YEGSIWIAKIGYRKAQLAAEQESSE"
FT   gene            complement(238611..238790)
FT                   /locus_tag="GTNG_0220"
FT   CDS_pept        complement(238611..238790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0220"
FT                   /product="Lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65604"
FT                   /db_xref="GOA:A4IJV0"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJV0"
FT                   /protein_id="ABO65604.1"
FT                   /translation="MTSWPRLFSLPYFILGVLFTYLAIKSAHETVWNVSTIALAAFAAF
FT                   DFGTAFRLFFAPKR"
FT   gene            complement(238787..239479)
FT                   /locus_tag="GTNG_0221"
FT   CDS_pept        complement(238787..239479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0221"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65605"
FT                   /db_xref="GOA:A4IJV1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJV1"
FT                   /protein_id="ABO65605.1"
FT                   /translation="MQLSSFIGVPLLHALGIGQSAKSPIEAAKIASGYWAVISFLAALI
FT                   IILWLLRGVRDERGMRQLPLASSSMWAISGVFLALIAQSIAANIEWRLLGIEPGSENTR
FT                   QIIDIIRLTPLLVIVASIIGPILEEIVFRKIIFGSLYEKYHFWPAALVSSLLFAIAHME
FT                   PEHLLLYTAMGLTFAFLYAKTGRILVPIFAHVTMNTFVIVVQILLADELEKMMRQAGLP
FT                   LALWRLWL"
FT   gene            239868..240152
FT                   /gene="groES"
FT                   /locus_tag="GTNG_0222"
FT   CDS_pept        239868..240152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="GTNG_0222"
FT                   /product="GroES"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65606"
FT                   /db_xref="GOA:A4IJV2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJV2"
FT                   /protein_id="ABO65606.1"
FT                   /translation="MLKPLGDRIVIEVVETEEKTASGIVLPDTAKEKPQEGRVVAVGTG
FT                   RVLDNGQRVAPEVEVGDRIIFSKYAGTEVKYDGKEYLILRESDILAVIG"
FT   gene            240255..241877
FT                   /gene="groEL"
FT                   /locus_tag="GTNG_0223"
FT   CDS_pept        240255..241877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="GTNG_0223"
FT                   /product="GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65607"
FT                   /db_xref="GOA:A4IJV3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJV3"
FT                   /protein_id="ABO65607.1"
FT                   /translation="MAKEIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLK
FT                   NVAAGANPMGIRRGIEKAVAVAVEELKAISKPIKGKESIAQVAAISAADEEVGQLIAEA
FT                   MERVGNDGVITLEESKGFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITD
FT                   KKVSNIQELLPVLEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGD
FT                   RRKAMLEDIAILTGGEVISEELGRELKSTTVASLGRASKVVVTKETTTIVEGAGDSERI
FT                   KARINQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVAGGGTALMNVYSKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLE
FT                   GSIIVERLKNEKAGIGFNAATGEWVDMIEEGIVDPTKVTRSALQNAASVAAMVLTTEAV
FT                   VADKPEENKGGANPGMPDMGGMM"
FT   gene            complement(242530..243774)
FT                   /locus_tag="GTNG_0224"
FT   CDS_pept        complement(242530..243774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0224"
FT                   /product="Na+/H+ antiporter NapA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65608"
FT                   /db_xref="GOA:A4IJV4"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJV4"
FT                   /protein_id="ABO65608.1"
FT                   /translation="MNHLVLEVGTALVLVAIGSIIANRLNFSIIPFLIIIGMLVGPHAP
FT                   TIGIIDLTFIESNEIIQFLGRIGVLFLLFYLGLEFSVGKLIKSGKNIVVGGSIYVIMNF
FT                   VLGLVYGKTVGMPWMETLLIAGLLSVSSSAIVAKVLVDLRRTANPETELILGMILFDDI
FT                   FLALFLTTMSGVLLAGSTSFFGISLSVLTSVAYMLLFFVIARKGAPLLNKWLNIKSDEI
FT                   FIIVIFAILFFVAGFSETLHVAEAIGALLLGLVFSETEHRDRIEHLVVPFRDFFGAIFF
FT                   FSFGLTIEPSTLIHAFWLSLGAVIVTLLANMVAGMIAGRKAGLSYKASTNIGLTITARG
FT                   EFSIVVANLGITAGLNPILTPFTALYVLMLAILGPLFAKESKTIYKLLNKVFKWDKKLA
FT                   KEKEKQKERVEVAEK"
FT   gene            complement(243784..244278)
FT                   /locus_tag="GTNG_0225"
FT   CDS_pept        complement(243784..244278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0225"
FT                   /product="TrkA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65609"
FT                   /db_xref="GOA:A4IJV5"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026278"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJV5"
FT                   /protein_id="ABO65609.1"
FT                   /translation="MNIRESELPGIGYKFEIITRNKDKLVIVIHDDGRREIYHFDADDY
FT                   DEVVSSVTLSDQEARQIAGIIGGMAYKPKALETVEFAFDDLIIEWFQVEPNAPAANKKI
FT                   GELDIRNRFGVNVIAIKKKHSQKSYNPGPNTLIEAGDTLIMSGERQQIKEIMNHLLSNK
FT                   E"
FT   gene            245024..246394
FT                   /locus_tag="GTNG_0226"
FT   CDS_pept        245024..246394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0226"
FT                   /product="Fumarate hydratase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65610"
FT                   /db_xref="GOA:A4IJV6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJV6"
FT                   /protein_id="ABO65610.1"
FT                   /translation="MNERIERDSLGEVRVPADKYWGAQTERSRQNFRIGKETMPLELIY
FT                   AYAELKKAAAIVNEQAGKLSEAKRQAIVTACDEILAGQWDAHFPLVVWQTGSGTQTNMN
FT                   VNEVVARRANELLPDGEERIHPNDDVNMSQSSNDTFPTVMHIAIYTKIQTHLLPAIDRL
FT                   IGTFAAKERRYEKTIKVGRTHLQDATPLTFGQEISGWRTMLEKSKTMIVEATDKLLDLA
FT                   IGGTAVGTGLNAPPSFGEQVAKQLHAQTGYPFRSATNKFHALTSHDEIVYVHGALKALA
FT                   ADLMKIANDIRWLASGPRSGFGEIVIPSNEPGSSIMPGKVNPTQSEAMTMVAVQVFGND
FT                   AAIGFAASQGNFQLNVFKPVIAYNAIQSVQLLGDAIRSFDERCAQGLEANETKMKEYVE
FT                   RSLMLVTALSPHIGYDKAAEIAKLAHREGLTLKEAALQTGYVTAKQYEEWVRPEKMI"
FT   gene            complement(246530..247753)
FT                   /locus_tag="GTNG_0227"
FT   CDS_pept        complement(246530..247753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0227"
FT                   /product="Putative metal ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65611"
FT                   /db_xref="GOA:A4IJV7"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJV7"
FT                   /protein_id="ABO65611.1"
FT                   /translation="MGKSKWKMIGPGLIVAATGVGAGDLVAALVAGTNYGLVFMWAIIV
FT                   GAVFKFVLNEGVGRWHLLSGKTIFEGWQSMGKWASIYFGVYAIIWGFVYGAAGTSSCAL
FT                   AMSAMIPSIPLWAWAIIHGLAGFAITWSGRFQLFERVMNVLVGLMFVTVVGSALLVLPQ
FT                   LNDLWKTAVPDLPKGSLLYALGLIGGVGGSITMASYGYWLQENGWKGRSYVSPMRYDSA
FT                   VAYIVTAIFTLSLLILGAALLYGTNTSINGEQGLVSFASIMGNELHPAARWLFLFGFWS
FT                   ASFTSVIGVWNGVSYLFADFVRNMRKTPIGTESLNQSKAFRFYVFWLTFPPMLLHFIGK
FT                   PVGLIIAYGALGALFMPFLAVTLLYLLNSKKALPDEGRNHWLSNALLALCLALFAVLSI
FT                   NELIGLFT"
FT   gene            247883..248833
FT                   /locus_tag="GTNG_0228"
FT   CDS_pept        247883..248833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0228"
FT                   /product="Methanol dehydrogenase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65612"
FT                   /db_xref="GOA:A4IJV8"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJV8"
FT                   /protein_id="ABO65612.1"
FT                   /translation="MNEPLLSSIEQVVRNVERVIVGKRQVIVLSLTALLAKGHVLLEDV
FT                   PGVGKTMLVRALAKSFSTELKRIQFTPDLLPSDVIGISVYNPKEQQFEYKPGPIVGHIV
FT                   LADEINRTSPKTQSALLEAMEEGSVTVDGVTRQLPQPFFVMATQNPIEYEGTYPLPEAQ
FT                   LDRFLLKLQMGYPSHDEEIEMLNRLEKTAPLSEIGPVMSLEELLALQRKVTDVHVSDTV
FT                   KGYIVELVQQSRTHEAVYLGVSPRGSVALMKAAQAYALIHGRDFVIPDDVQQLAPYVLA
FT                   HRLLVRPEAKWDKLDGETIVAQLIARTPVPVRGRR"
FT   gene            248956..249999
FT                   /locus_tag="GTNG_0229"
FT   CDS_pept        248956..249999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0229"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65613"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJV9"
FT                   /protein_id="ABO65613.1"
FT                   /translation="MPFGLYALLIMIYPLRRATVSRTVPVGHYHVGESIPVTVRIDLPW
FT                   PIPLAALSVVEEEQKCGRAMFALSFRRRLSFTWSLRLPRGRHQLETVCLEVGDPFGWVS
FT                   KTASFHVPCTVIVYPRYIEWPFESIREWFAHGKAARPIPLHRDMAVAAGVREYVPGDKM
FT                   SWVHWKASARRQELMTKEFDEQRNNDWIVVLDGAPSPVFEELVTLAASVSKGLLDDGVP
FT                   VGLLFAGKKRSFLAPRSHDKQWPSILLQLAEVNGEGKEPLPRTLAEETNWRAAAGCIIL
FT                   TSALSIPLLQQLRTIASKRQVVLYVVSREWSHKQQSWADGLRRSGGDVLHIDPQMLQTI
FT                   RQGGENG"
FT   gene            249996..252158
FT                   /locus_tag="GTNG_0230"
FT   CDS_pept        249996..252158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0230"
FT                   /product="Membrane-bound protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65614"
FT                   /db_xref="GOA:A4IJW0"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJW0"
FT                   /protein_id="ABO65614.1"
FT                   /translation="MKQRAETMLSAVLPNGLAAWLLTEWLWPLDTVADTAHIGTFAMFV
FT                   VICFLFYTLRVPTWLSALGKIGYIWWALDEWFYDEAIWDVPRALWWDGVAWLVGGGASM
FT                   PDDALRTLAFFVSLWAASFVWHWLVVRRNRWFVPYALTVSYIAVLDTFFPYSGNGAIVR
FT                   LVALGFFAFVWLHGERMWAKGGAAYIRKWRAAALSIPAIAVTAGYVGPKLPPQWPDPVA
FT                   FIRSYAADSGEEFDTTTAAVVKKIGYGQNDSRLGGPFIADDTVVFIAKDEDRHYWRVET
FT                   KDVYTGKGWESFQSEQVKSFRNGRLMEHEWWSDKVKTAEQTAEITRQDQAFHLVYPIGL
FT                   QQVQTSDNIVYRMHMATEKIYTTDINANALPIQRYTITYMEPDFPIEALRSAAPVQDAS
FT                   FLKRYTQLPDTLPKRVRDLAKQITEGKETVYDKVKAIEQYFHMNGYAYETTNVAVPRAN
FT                   QDYVDQFLFETKQGYCDNFSTSMAVLVRSLGIPARWVKGYTSGQLVEEQNGAELYKVRN
FT                   NDAHSWVEVYFEGVGWVPFEPTQGFVNPYAFSLSTSNEEQQAPSLQPEEQETPRVSIEQ
FT                   LIEPSSQKQDRHWWKQLASVWSWKTVLTVFVALAALGGALYVTRRKWWPRWTIFCFRCR
FT                   RVDGPEWLVPAYLALLRQLHDYGLRRKEDETLRQYAIEVDRLLETNEMGRLTKWYEQVI
FT                   YGANSDRIDIREARQLWENLIKRTIT"
FT   gene            252356..253897
FT                   /gene="guaA"
FT                   /locus_tag="GTNG_0231"
FT   CDS_pept        252356..253897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="GTNG_0231"
FT                   /product="GMP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65615"
FT                   /db_xref="GOA:A4IJW1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJW1"
FT                   /protein_id="ABO65615.1"
FT                   /translation="MDKMNQEMIVVLDFGSQYNQLITRRIREFGVYSELHPHTISAEEI
FT                   RALNAKGIIFSGGPNSVYDEQAFTCDPAIFELGLPILGICYGMQLMAHHLGGKVEKATH
FT                   REYGKALIQVKNDSLLFRGLPDEQVVWMSHGDLVTAPPSGFIVDATSSSCPIAAMSDER
FT                   RKWYGVQFHPEVRHSIYGNDVLKRFVFDVCGCHGDWTMENFIDEQVRRIREQVGGKKVL
FT                   CALSGGVDSSVAAVLVHRAIGDQLTCIFVDHGLLRKGEAESVMKTFREQFQMNVIKVDA
FT                   KERFLAKLKGVSDPEQKRKIIGNEFIYVFDDEAAKLEGIEFLVQGTLYTDIIESGTATA
FT                   QTIKSHHNVGGLPEDMKFELIEPLNTLFKDEVRALGTQLGIPDEIVWRQPFPGPGLGIR
FT                   VLGEVTEEKLEIVRESDAILREEVKKAGLDREIWQYFTVLPDIRSVGVMGDARTYDYTV
FT                   AIRAVTSIDGMTADWARIPWDVLERISTRIVNEVPHVNRVVYDITSKPPATIEWE"
FT   gene            254415..255632
FT                   /locus_tag="GTNG_0232"
FT   CDS_pept        254415..255632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0232"
FT                   /product="Transposase (02)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65616"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJW2"
FT                   /protein_id="ABO65616.1"
FT                   /translation="MVKVTKPNHWRKIRMYSQFIKELIDLPDVLIEKERKEGERWIFEL
FT                   SLPEQCPLCPVCLQRTTKMTRKKKQWMHGYAQRIGVFWIELPVERRRCCTCGMTFSTSY
FT                   PGISPRSVATDVFQQWVAQSCIGTSIQAVARMLKLPYTTVERWFYTHAPSFLSNTIQPK
FT                   AVCVDEFAFRKGHDYGVAVMDAETGEVYSIEAGKNEAAIRSALTCVSSSVQCVVSDLAP
FT                   AMKKAIQGACPEAVHVVDYFHVIQLFTEALDRCRKYLAKGGKKHGNVRYVCCLLSQCPE
FT                   KLTEEERQTVREWCKESDYLQVVYQSLQHFRYVSKSQGERQAKRRLEAWIHRYLFCTCS
FT                   VVRAIAKALAKRTEEIISCILSPYSNGKMEGTNNKIKLIKRRGYGYRNIQRFALRVRLE
FT                   TATTLQ"
FT   gene            255689..256114
FT                   /locus_tag="GTNG_0233"
FT   CDS_pept        255689..256114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65617"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJW3"
FT                   /protein_id="ABO65617.1"
FT                   /translation="MNVSIDYLLDDGETLDEMVMREPYNLSEYGKGLKSSKKNRVIRDK
FT                   FPNAEIYSLLAYQKLTKGEKIVDNALGFFTDAPFGMPEFLNYLKNNDKRFYLVEKDGKQ
FT                   FFVTVTDEFIETRQLANRIDSKKFEIGNWKFKKTGKI"
FT   gene            256551..257876
FT                   /locus_tag="GTNG_0234"
FT   CDS_pept        256551..257876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0234"
FT                   /product="Guanine-hypoxanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65618"
FT                   /db_xref="GOA:A4IJW4"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJW4"
FT                   /protein_id="ABO65618.1"
FT                   /translation="MRKYFQFDELGTNYRTEIIAGLTTFLSMAYILFVNPFTLSLGAVG
FT                   DFPDELRIDQGAVFVATALAAAYGSILMGVLARYPIALAPGMGLNAFFAFTVVLHMGVP
FT                   WQTALAGVFVSGVIFTILTLTGIREKIIDAIPVELKYAVGAGIGLFITFIGLQNAGIIV
FT                   NNDATLVGLSNLRDGNTLLAIFGLFITVILMVKKVNGGVFYGMVITAVVGMIFGLIEVP
FT                   KQIVGAIPDISPTFGVAIEHLPDIFSLKMLGVVLTFFIVDFFDATGTLLAVANQAGLLK
FT                   NNKLPRAGKALLVDATAVMVGAVFGTSTTTSYIESSAGVAAGGRSGFSAVVTGILFLLA
FT                   LFFSPLLSVITAPVTAPALIIVGVLMASSIGEIDWKKFEIAVPAFFTLITMPLSYSIAT
FT                   GIAVGFIFYPITMILRGRGKEVHPLLYVLFVIFICYFIFLRE"
FT   gene            258018..258563
FT                   /locus_tag="GTNG_0235"
FT   CDS_pept        258018..258563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0235"
FT                   /product="Ribosomal-protein-serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65619"
FT                   /db_xref="GOA:A4IJW5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJW5"
FT                   /protein_id="ABO65619.1"
FT                   /translation="MVFIRYVEKDVWLKLLTQEDAEPLFALVDSCRAHLRQWLPWVDST
FT                   KTVEDSKAFISQGLQKFASGNGFEAGIFYQGQLAGVIGVHYIDWANRKASIGYWLGESF
FT                   QGKGLMTKACKACIDDLFVEQGVNRVEIRCAVGNQRSRAIPERLGFVMEGTIRDAEWLY
FT                   DHFVDHVVYGMLAREWKR"
FT   gene            258793..260345
FT                   /locus_tag="GTNG_16s006"
FT   rRNA            258793..260345
FT                   /locus_tag="GTNG_16s006"
FT                   /product="16S ribosomal RNA"
FT   gene            260732..263661
FT                   /locus_tag="GTNG_23s006"
FT   rRNA            260732..263661
FT                   /locus_tag="GTNG_23s006"
FT                   /product="23S ribosomal RNA"
FT   gene            263954..264070
FT                   /locus_tag="GTNG_5s007"
FT   rRNA            263954..264070
FT                   /locus_tag="GTNG_5s007"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(264324..264767)
FT                   /locus_tag="GTNG_0236"
FT   CDS_pept        complement(264324..264767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0236"
FT                   /product="Stress response Hsp-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65620"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJW6"
FT                   /protein_id="ABO65620.1"
FT                   /translation="MANENPFTPFSDWTKHWQQFFQNDFWGNIQPFLSSSNKSSSGMNI
FT                   YKKDNELLIVISLPGLEKIEDAEVYVSYKTLEVKAMINLNFQGFDLVEEGIFQGQFEKM
FT                   IPLPFPVKADRIEATYHNGLLFIHLHRLIPEEQKKKIIIKKSK"
FT   gene            265133..265621
FT                   /gene="purE"
FT                   /locus_tag="GTNG_0237"
FT   CDS_pept        265133..265621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="GTNG_0237"
FT                   /product="Phosphoribosylaminoimidazole carboxylase I"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65621"
FT                   /db_xref="GOA:A4IJW7"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJW7"
FT                   /protein_id="ABO65621.1"
FT                   /translation="MNPLVGVVMGSRSDWETMKHACDILEELGVPFEKKVVSAHRTPDE
FT                   MFRYAETAEERGIKVIIAGAGGAAHLPGMIAAKTTLPVIGVPVQSKALNGLDSLLSIVQ
FT                   MPGGVPVATVAIGKAGATNAGLLAVSIVGLFEPRYMEALKARREAIRKQVVESSDQLD"
FT   gene            265614..266762
FT                   /gene="purK"
FT                   /locus_tag="GTNG_0238"
FT   CDS_pept        265614..266762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="GTNG_0238"
FT                   /product="Phosphoribosylaminoimidazole carboxylase
FT                   ATPasesubunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65622"
FT                   /db_xref="GOA:A4IJW8"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJW8"
FT                   /protein_id="ABO65622.1"
FT                   /translation="MTKRRIVPGQTIGIIGGGQLGRMMALAAREMGFRIAVLDPTPGSP
FT                   CGQVADVEITAPYHDLNAIAELARVSHIITYEFENIDARALEWLEENAYVPQGSRLLAV
FT                   TQDRALEKAAIVEAGLPVAPYAEVNGWDELEQAVRTIGFPCVLKTRRGGYDGKGQYVLR
FT                   GERDLAKAAELFDFGPCILEGWVSFVKEMSVIVARNGDGETAVFPVAENIHVENILHQT
FT                   IVPARIPEHVEERAIRYAKTLATSFSLVGTLAVEMFLTEDGEIYINELAPRPHNSGHYT
FT                   INACATSQFAQHIRAVCNWPLGSTELLKPAVMVNILGEHVESIIRQIDAFAGTTYVHLY
FT                   GKHEAKPKRKMGHVTVLADNVDEALARLESWQIWHDRRLERV"
FT   gene            266759..268054
FT                   /gene="purB"
FT                   /locus_tag="GTNG_0239"
FT   CDS_pept        266759..268054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="GTNG_0239"
FT                   /product="Adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65623"
FT                   /db_xref="GOA:A4IJW9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJW9"
FT                   /protein_id="ABO65623.1"
FT                   /translation="MIERYTRPEMGAIWTEENRFKAWLEVELLACEAWAELGVIPKEDV
FT                   RRLRENASFDIHRIKEIEEETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTALGY
FT                   LLKQANTILRRDLENFIQVLKEKALEHKYTVMMGRTHGVHAEPTTFGLKLALWYAEMKR
FT                   NLERFEQAAKMVEVGKISGAVGTYANIDPFVEQYVCEKLGLTPAPISTQTLQRDRHAYY
FT                   MATLALIATSIEKFAVEIRGLQKSEVREVEEFFAKGQKGSSAMPHKRNPIGSENMTGMA
FT                   RVIRGYMVTAYENVPLWHERDISHSSAERIILPDATIALNYMLNRFANIVKNLLVYPEN
FT                   MKKNMERTFGLIYSQRVLLALIDKGMTREAAYDLVQPKAMEAWEKQVPFRSLLEADERI
FT                   TSQLTKEELDDCFDYRHHLKHVDTIFARLGLE"
FT   gene            268128..268859
FT                   /gene="purC"
FT                   /locus_tag="GTNG_0240"
FT   CDS_pept        268128..268859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="GTNG_0240"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamidesynthase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65624"
FT                   /db_xref="GOA:A4IJX0"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJX0"
FT                   /protein_id="ABO65624.1"
FT                   /translation="MMPTKQQLLYEGKAKKIYATDEADVLWVEYKDSATAFNGEKKATI
FT                   TGKGRLNNEISSLLFMKLQEAGVANHFIQKLSPTEQLVKSVTIIPLEVVVRNVVAGSLA
FT                   KRIGLAEGTPLEVPLVEFYYKNDDLGDPLLLEDHITILKLASREEIAQLKSEALKVNDV
FT                   LRAHFAERKVRLIDFKLEFGRTTDGAILLADEVSPDTCRLWDAETNEKLDKDVFRRDLG
FT                   SLTEAYEVILQRLGGESACIK"
FT   gene            268847..269101
FT                   /locus_tag="GTNG_0241"
FT   CDS_pept        268847..269101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0241"
FT                   /product="Phosphorybosylformylglycinamidine synthetase,
FT                   PurS component"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65625"
FT                   /db_xref="GOA:A4IJX1"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJX1"
FT                   /protein_id="ABO65625.1"
FT                   /translation="MYKVKVYVTLRESVLDPQGTAVKGALHSLSYTEVKDVRIGKFMEL
FT                   VIEDTSRDIDKLVREMCEKLLSNPVIEDYRYEIEEAVAR"
FT   gene            269098..269784
FT                   /gene="purL"
FT                   /locus_tag="GTNG_0242"
FT   CDS_pept        269098..269784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="GTNG_0242"
FT                   /product="Phosphoribosylformylglycinamidine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65626"
FT                   /db_xref="GOA:A4IJX2"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJX2"
FT                   /protein_id="ABO65626.1"
FT                   /translation="MKFAVIVFPGSNCDVDMYHAIADELGEEVEYVWHDEENLDRFDAI
FT                   LLPGGFSYGDYLRSGAIARFSKVMAAVKQAAEAGKPVLGVCNGFQILLEAGLLPGAMRR
FT                   NQGLKFICRPVQLVVENNETMFTSAYGKDEVITIPIAHGEGNYYCDEQTLNRLVENRQI
FT                   VFRYHGENPNGSLADIAGIVNERGNVLGMMPHPERAVDALLGSADGLKLFRSIVNYWRE
FT                   THVVTA"
FT   gene            269768..271996
FT                   /gene="purQ"
FT                   /locus_tag="GTNG_0243"
FT   CDS_pept        269768..271996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="GTNG_0243"
FT                   /product="Phosphoribosylformylglycinamidine synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65627"
FT                   /db_xref="GOA:A4IJX3"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJX3"
FT                   /protein_id="ABO65627.1"
FT                   /translation="MSLLLEPNAAMIKEQKLYREMGLTDEEFARIEAILGRLPNYTETG
FT                   IFSVMWSEHCSYKNSKPVLKKFPTDGPHVLQGPGEGAGIVDIGDGLAVAFKIESHNHPS
FT                   AIEPYQGAATGVGGIIRDVFSMGARPIALLNSLRFGELTSPRVKYLFEHVVAGIAGYGN
FT                   CIGIPTVGGEVQFDPAYEGNPLVNAMCVGIIRHEDIQRGVATGVGNTVMYVGAKTGRDG
FT                   IHGATFASEELSEQSEAKRPAVQVGDPFMEKLLLEACLEAVKSDALVGIQDMGAAGLTS
FT                   SSAEMASKGGFGIEMNLDLVPQRETGMTPYEMMLSESQERMLLVVEQGREEEIAAIFAK
FT                   YGLEAKAIGKVTDDKMLRLFFHGEVVAEIPVDALAKDAPVYHKPSAEPDYYREFQAMPT
FT                   YIPQIEDYNRTLLGLLAQPTIASKEWVYDQYDYMVRTNTVVAPGSDAAVVRIRGTNKAL
FT                   ALTTDCNSRYLYLDPEMGGKIAVAEAARNVVCSGAKPLAITDCLNFGNPEKPDIFWQLE
FT                   KAVDGMSEACRTLGTPVVSGNVSLYNETNGEAVYPTPVVGMVGLVDDLSHVTTQPFKQA
FT                   GDLIYVIGEAKPEFGGSELQKWLEGRIFGKAPELDLAVEASRQRQLLTAIRAGVVASAH
FT                   DVAEGGLAVALAECVIGASGLGANVTVSGDLVSELFSETQSRFVVSVKKEHQEAFEQLV
FT                   EAKLIGEVTNDSILTVNGEHGGTVIRLSVDEMRNVWKGAIPCLLKSKD"
FT   gene            271972..273384
FT                   /gene="purF"
FT                   /locus_tag="GTNG_0244"
FT   CDS_pept        271972..273384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="GTNG_0244"
FT                   /product="Phosphoribosylpyrophosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65628"
FT                   /db_xref="GOA:A4IJX4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJX4"
FT                   /protein_id="ABO65628.1"
FT                   /translation="MLAEIKGLNEECGIFGIWGHEDAARLTYYGLHSLQHRGQEGAGIV
FT                   VASGGNLFGHKGLGLVTEVFQSDTFDALHGSAAIGHVRYSTAGGGGYENVQPLLFRSQT
FT                   GSMALAHNGNLTNAIDLKLSLEAQGSIFQTTSDTEVFAHLIRRSQAPTFVGQMKEALSQ
FT                   IEGAFAFLLLTETALYVALDPHGFRPLSLGRLGSAYVVASETCAFDVIGATYEREVAPG
FT                   ELLIISGEGVRSERFAPEQPRSICSMEYIYFARPDSHVDGINIHTARKNLGKQLALEAP
FT                   AEADIVTGVPDSSISVAIGYAEASGIPYELGLIKNRYVGRTFIQPSQALREQGVKMKLS
FT                   PVRGVVAGKRVVMVDDSIVRGTTSRRIVTMLREAGALEVHVRISAPPITHPCFYGIDTS
FT                   SKEELIAAKHTVEDICRLIGADSLAFISQEGLLSAIGRPEGIPHRGQCLACFTGQYPTR
FT                   VNQTTRPCMTVK"
FT   gene            273482..274522
FT                   /gene="purM"
FT                   /locus_tag="GTNG_0245"
FT   CDS_pept        273482..274522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="GTNG_0245"
FT                   /product="Phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65629"
FT                   /db_xref="GOA:A4IJX5"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJX5"
FT                   /protein_id="ABO65629.1"
FT                   /translation="MVKAYKQAGVDIEAGYQAVALMKQHVQKTMRPEVLGGIGGFGGLF
FT                   DLSSLDYRQPVLVSGTDGVGTKLKLAFLLDRHNTIGIDCVAMCVNDIVVQGAEPLFFLD
FT                   YIACGKAVPEKIAAIVKGVADGCVEAGCALIGGETAEMPGMYAEDEYDLAGFVVGIAEK
FT                   ERLVTGQTIQAGDVLIGLPSSGLHSNGYSLVRRIIFEQAKLSLDEIYEPLDVPLGEELL
FT                   KPTRIYAKLLRSVLGRFTIKGMAHITGGGFIENIPRMLPQGLGVRIQRGSWPVLPIFDF
FT                   LRAKGNLEEEEMFSVFNMGIGLVLAVSPETAAPLVQWLDEQNEPAYIIGEVVEGAGVSF
FT                   TGGNEA"
FT   gene            274519..275148
FT                   /gene="purN"
FT                   /locus_tag="GTNG_0246"
FT   CDS_pept        274519..275148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="GTNG_0246"
FT                   /product="Phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65630"
FT                   /db_xref="GOA:A4IJX6"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJX6"
FT                   /protein_id="ABO65630.1"
FT                   /translation="MKRLAVFASGSGTNFQAIVDAVKRGELPADLALLVCDRPGAKVIE
FT                   RAARENVPTFVFSPKDYPSKAAFESEILRELSERQIEWIALAGYMRLIGPTLLSAYEGK
FT                   IVNIHPSLLPAFPGKDAIGQAYRAGVLETGVTIHYVDEGMDTGPVIAQRAVPIVPGEPI
FT                   EALEARIHAVEHELYPAVLRMLLGETEQQEERIEKNGSQTSINQRV"
FT   gene            275114..276652
FT                   /gene="purH"
FT                   /locus_tag="GTNG_0247"
FT   CDS_pept        275114..276652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="GTNG_0247"
FT                   /product="Phosphoribosyl aminoimidazole carboxamide
FT                   formyltransferase/IMPcyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65631"
FT                   /db_xref="GOA:A4IJX7"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJX7"
FT                   /protein_id="ABO65631.1"
FT                   /translation="MAVKRALISVSNKEGIIPFAKQLTELGIEIISTGGTKRALEDAGI
FT                   SVISISNVTGFPEILDGRVKTLHPAIHGGILAIRSDERHQAALAEHGIRLIDLVVVNLY
FT                   PFQQTIAKPDVTLAEAIENIDIGGPTMVRAAAKNYADVAIVVDPADYPTIIEELKTNGS
FT                   IQAETRQKLAAKAFRHTAAYDAMIAEYLTNLTGEEYPETLTVTYTKKQSLRYGENPHQS
FT                   ASFYAKPLGAAFSIAQAKQLHGKDLSYNNINDANAAINLVREFQEPAVVAIKHMNPCGV
FT                   GVGATLLEAFTKAYEADPVSIFGGIIAVNREVDKETAERMHDIFLEIVIAPSFSDEALA
FT                   ILTKKKNIRLLTLDFAAADVKEKMLVSVSGGLLVQDADTYTLEDAEWNVVTKRQPTEAE
FT                   CEQLRFAWNVVKHVKSNAIVLAKNGMTVGVGAGQMNRVGAAKIAIEQAGEQAAGAVLAS
FT                   DAFFPMDDTVEAAAKAGITAIIQPGGSIRDADSIRKANEYGIAMVFTGVRHFKH"
FT   gene            276679..277971
FT                   /gene="purD"
FT                   /locus_tag="GTNG_0248"
FT   CDS_pept        276679..277971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="GTNG_0248"
FT                   /product="Phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65632"
FT                   /db_xref="GOA:A4IJX8"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJX8"
FT                   /protein_id="ABO65632.1"
FT                   /translation="MNILVVGRGGREHAIAWKVAQSPLAGKLYAAPGNPGIGEVAELVN
FT                   IDELDIDALVQFAKQNAIDLTIVGPEAPLAAGIADRFMAEGLRIFGPNQAAALIEGSKA
FT                   FAKELMKTYGIPTAEHATFSSYEEAKAYIEEKGAPIVIKADGLAAGKGVTVAQTVEEAL
FT                   AAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEG
FT                   PNTGGMGAYSPVPQISADMVQRALETILRPTAKALASEGRPFTGVLYAGLIATAEGPKV
FT                   IEFNARFGDPEAQVVLPRLKTDLLEAILAVMEGKELELEWTNEAVLGVVLAAKGYPGAY
FT                   ERGVAIRGLDRLAPDALLFHAGTKREGGTLYTNGGRVLLLAAKGGTLAEAKEKAYQQLA
FT                   AIECDGLFYRRDIGRRAIERASAVDTRMKGR"
FT   gene            complement(278188..278439)
FT                   /locus_tag="GTNG_0249"
FT   CDS_pept        complement(278188..278439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0249"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65633"
FT                   /db_xref="GOA:A4IJX9"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJX9"
FT                   /protein_id="ABO65633.1"
FT                   /translation="MPMANIGIVNALIRITFGLTVVAWATARFARRPWCTSYLLAILLG
FT                   AMKVGEGITRFCPVTALFENMQRERLLNEQKETVVNPT"
FT   gene            278528..280273
FT                   /locus_tag="GTNG_0250"
FT   CDS_pept        278528..280273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0250"
FT                   /product="Adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65634"
FT                   /db_xref="GOA:A4IJY0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJY0"
FT                   /protein_id="ABO65634.1"
FT                   /translation="MGEQRYRWKSSELREQAAVIDGKRSPTKVLVNATYLHSYFREWVK
FT                   GNIWIHGDRIVYAGERLPDRIDESCEIIDCRGYVLVPGYIEPHVHPFQLYNPHSFARYA
FT                   AMYGTTTLLNDNLFFLLQLDDEEALLFLQEMNALPTSMYWWCRFDGQTELEREDEQISN
FT                   ARIKRWLDQETVLQGGELTSWPKLASGDDIVLYWMQEAKRRRRKIEGHFPGASEKTLVK
FT                   MALFGVDGDHEAMTGKEVRLRLWHGYTVTLRHSSIRPDLPVLLEEMKALGIRYYDKCLL
FT                   TTDGSPPAFYENGVMDQLLRIVIEHGVPVIDAYAMATINAARHYGIEHLHGSIATGRIA
FT                   HINFLRSAHDPTPVQVLAKGEWVKREGDSSGSWPALKWEQFGIRPLSVSWELEWDDLQF
FT                   SMPMGLRLENAVIVKPYSVSIDTSRDRLGHDHDECFLMLLDRNGCWRVNTMLKGFSSAL
FT                   GGLASSYSNTGDFILIGKHKEDMMLAFRRMKDIGGGIVLVEDGNVLFELPLPLSGMTST
FT                   LEMETLINEEKTFVRLLRERGYYFEDPVYSLFFLQSTHLPYVRITQRGIYDVMHKTVLF
FT                   PSIMR"
FT   gene            280293..281312
FT                   /locus_tag="GTNG_0251"
FT   CDS_pept        280293..281312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0251"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65635"
FT                   /db_xref="InterPro:IPR021416"
FT                   /db_xref="InterPro:IPR023158"
FT                   /db_xref="InterPro:IPR035328"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJY1"
FT                   /protein_id="ABO65635.1"
FT                   /translation="MCPLKHWLFVISCAVLLLGGCTAKSEPKPTEPAKPSPEQPSESPA
FT                   EEKQMFPLTGLPTEGDIDQRVVSVMINNHPKARPQSGLHQADIVYEVLAEGDITRFLAL
FT                   YQSELPERVGPVRSAREYYIDLSDGYHALYVCHGWSPEAKTRLEQGNTDYLNGLFYDGT
FT                   LFQRVSFRKAPHNSYITFANIEKGAEQNGYVWTDDIDPLLFRDDEPSGEQVETVRITYS
FT                   HRAYAQVEYRYAPEQKGYYRYSGGEQTVDYDTHEPVVVQNVMIIAARHQVIDSYGRRDI
FT                   DFTSGGQGYLLQNGVMQPIEWKNVDGRLLPYRDGVPVGFVPGKTWINIVPELTIVESK"
FT   gene            281630..281794
FT                   /locus_tag="GTNG_0252"
FT   CDS_pept        281630..281794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65636"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJY2"
FT                   /protein_id="ABO65636.1"
FT                   /translation="MTRLKQAKECAWLRQYSSNMRKQGSKDAAAAYKHFFGRGAKHPKF
FT                   KKKNKQSSG"
FT   gene            282721..283038
FT                   /locus_tag="GTNG_0253"
FT   CDS_pept        282721..283038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0253"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65637"
FT                   /db_xref="GOA:A4IJY3"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJY3"
FT                   /protein_id="ABO65637.1"
FT                   /translation="MQIDKLRGKELDQLFKAILSLRDIEECYRFFDDLCTVNEIQALAQ
FT                   RLEVARMLREGYTYHKIETETGASTATISRVKRCLNYGNDAYAMALDRIKEEERQAANE
FT                   A"
FT   gene            283144..283863
FT                   /locus_tag="GTNG_0254"
FT   CDS_pept        283144..283863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0254"
FT                   /product="Geranylgeranylglyceryl diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65638"
FT                   /db_xref="GOA:A4IJY4"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJY4"
FT                   /protein_id="ABO65638.1"
FT                   /translation="MEEIRAWRHVFKLDPNKPIDDERLERLCESGTDAVIVGGTDGVTL
FT                   DGVLDLLARIRRFSVPCALEVTDIEALTPGFDAYLIPMVLNSCRVDWVIGRHHEAVKQY
FT                   GDVMNWDEIFAEGYCILNGECKAAKLTEANTALDDDDVVAYARLAEHLYKLPIFYLEYS
FT                   GTYGNPSLVEKVKRALSRTQLVYGGGIMTPEQAAEMARYADTVVVGNAVYDSFESALAT
FT                   VEAVKRIDGENEISGVK"
FT   gene            283892..286066
FT                   /locus_tag="GTNG_0255"
FT   CDS_pept        283892..286066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0255"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65639"
FT                   /db_xref="GOA:A4IJY5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJY5"
FT                   /protein_id="ABO65639.1"
FT                   /translation="MNFLSEKLLAHLNKEQQEAVKTTEGPLLIMAGAGSGKTRVLTHRI
FT                   AYLMAEKHVVPWNILAITFTNKAAREMRERVQALLGGAAEDVWISTFHSMCVRILRRDI
FT                   DRIGINRNFSILDPTDQLSVIKAILKEKNIDPKKFEPRTILGTISGAKNDLLTPEQFAK
FT                   RASTYYEKIVSDVYQEYQQRLLRNHSLDFDDLIMTTLQLFDRVPDVLQYYQYKFQYIHI
FT                   DEYQDTNRAQYTLVKKLAERFQNICAVGDADQSIYRWRGADIQNILSFERDYPNAKVIL
FT                   LEQNYRSTKRILQAANEVIEHNVNRKPKRLWTENPEGKPITYYEAMNEADEAQFVAGRI
FT                   QEAIESGARRYSDFAVLYRTNAQSRVIEEMLLKANIPYQIVGGLKFYDRKEIKDILAYL
FT                   RVIANPDDDLSLLRIINVPKRGIGASTIDKLVRYAAEHELSLFEALGELEMIGLSAKAT
FT                   GALAAFRGQLEQWTQLQEYVSVTELVEEVLDKSGYRDMLKAERTIEAQSRLENLDEFLS
FT                   VTKHFENASDDKSLIAFLTDLALISDLDELNGNDQTEEGDAVVLMTLHAAKGLEFPVVF
FT                   LIGMEEGIFPHNRSLDDEDEMEEERRLAYVGITRAEEELVLTSAQMRTLFGNIQMNPPS
FT                   RFLNEIPAHLLETVSRRQMTASRPVVSRPQVNGAVGVWKVGDRANHRKWGIGTVVSVRG
FT                   EGDDQELDIAFPSPIGIKRLLAKFAPIEKV"
FT   gene            286088..288100
FT                   /locus_tag="GTNG_0256"
FT   CDS_pept        286088..288100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0256"
FT                   /product="DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65640"
FT                   /db_xref="GOA:A4IJY6"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJY6"
FT                   /protein_id="ABO65640.1"
FT                   /translation="MDRQQAKRRAAELRELLNRYGYEYYVLDRPSVPDAEYDRLMQELI
FT                   AIEKQYPELKTSDSPTQRIGGPPLEAFRKVTHRVPMMSLANAFNEGDLRDFDRRVRQEV
FT                   GEAAYVCELKIDGLAVSVRYEDGYFVQGATRGDGTTGEDITENLKTIRSLPLRLNEPVS
FT                   LEARGEAFMPKASFLRLNEERQARGEELFANPRNAAAGSLRQLDPKVAASRQLDLFVYG
FT                   LANAEELGIESHSAALSYLQSLGFKVNPERRRCATIDEVIAFVNEWKEKRPQLPYEIDG
FT                   IVIKVDSFAQQRQLGATAKSPRWAIAYKFPAEEVVTTLIGIEVNVGRTGAVTPTAILEP
FT                   VRVAGTTVQRATLHNEDFIREKDIRIGDAVIIKKAGDIIPEVVGVVVDRRDGDEVPFTM
FT                   PTHCPECESELVRLDGEVALRCLNPKCPAQLRERLIHFASRSAMNIEGLGEKVVTQLFN
FT                   AGLVHDVADLYQLTKEQLVGLERMGEKSAANLLAAIEASKQNSLERLLFGLGIRYVGAK
FT                   AAQLLAEHFETMERLEAATKDELMAVPEIGEKMADSITTYFSQPEAVELLNELRTYGVN
FT                   MAYKGRKRTAETPASSVLAGKTVVLTGKLASMSRNEAKEQIERLGGRVTGSVSRSTDIV
FT                   IAGEDAGSKLDKAQQLGIEIWDETRFLQEISREEQ"
FT   gene            288097..289320
FT                   /locus_tag="GTNG_0257"
FT   CDS_pept        288097..289320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0257"
FT                   /product="Sex pheromone staph-cAM373 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65641"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJY7"
FT                   /protein_id="ABO65641.1"
FT                   /translation="MKRISIISSLVACRWIKRARKRLAVLGLASFCLLSACAPKFDQGE
FT                   EVVQNKGSKEQEAVIPKYNISDSYYRVVLPFKPSGARGQVVGDLNTRLDVDEFETGLMR
FT                   LASEQFPTDDYLFQEGQYLDGKTVNKWLERKRTSNQLKEEKMKPEDNIGLNPPISDTGT
FT                   NEQKNKQSPIYLASILEHDYLVKVDNDKVKLGGVAIGLALNSVHYYSTEQGYPREVKIK
FT                   DDVIEREGKQIAAEVLKRLRNIKGLGSVPITIALYKQAPRSSVTPGHFFAVTHVDEGSN
FT                   TIDKWEAVNEEYYLFPSDEAEKNHRDDWLKFNNFKSDVEDFFPNYTGIVGKGLYVNDQL
FT                   QKLTINITIPFYGKMEVIGFTQYVTGLVMEKFPDYITVNVYISSTGQPESLIVRQAKVN
FT                   EPFVHIYR"
FT   gene            289720..290280
FT                   /locus_tag="GTNG_0258"
FT   CDS_pept        289720..290280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0258"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65642"
FT                   /db_xref="GOA:A4IJY8"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJY8"
FT                   /protein_id="ABO65642.1"
FT                   /translation="MKAICVFCGSSYGQNSKYKEAAQELGMFLARRGITLIYGGGKAGL
FT                   MGEVAEAVLGHQGHVVGIIPQFLKDREVAHDRLSELVVVDTMHTRKAKMNEAADGFIAL
FT                   PGGYGTYEELFEVLSWSRVGLHQKPIGLLNVDGFFDPLLDLLRHTVQQGFAAPQDLELI
FT                   VSAGDVPTLYERMSMFRHRRGQR"
FT   gene            complement(290307..291749)
FT                   /locus_tag="GTNG_0259"
FT   CDS_pept        complement(290307..291749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0259"
FT                   /product="Amine oxidase, flavin-containing"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65643"
FT                   /db_xref="GOA:A4IJY9"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJY9"
FT                   /protein_id="ABO65643.1"
FT                   /translation="METMISIIRNGLKKTSIPKKIVVIGAGMAGLVAASLLKQAGHRVT
FT                   ILEASERVGGRIYTIRSDFRDDQYFEAGAMRIPHTHRLTLEYIQKFNLPIHPFVNSTPR
FT                   DILYFRGIKARLSEYERHPDLFGFPIASYERGKTASELLQMAVRPVIQFIEQNPEKHWP
FT                   IVIEQLDRYSFDTYLRYNPFGLRLSVGAIDMIKAVLSLEGFPELSFLGLLRELMTLFTP
FT                   NMRFYKIVGGNDRLPKAFLPQLKDELLFSHKVQKIVQNKNSVTIHAIHTKILQPFQITA
FT                   DRVIVTIPFSILQFVDIEPRHSFSENKRKAIRELHYVGSTKTGIQFKTRFWEKEGLFGG
FT                   RTVSDLPIRYTQYPSQGIGTTGPGVVLASYTWEDDTIPWDSLSAEERLEYTLKNLAVLY
FT                   GEQVYREFETGTSHSWVRYPYSGGAFTLMKPNQITEISPYIATPEGRVHFAGEHTSTHH
FT                   GWIQGAIESGICAAYEVNNSPA"
FT   gene            complement(291879..292652)
FT                   /locus_tag="GTNG_0260"
FT   CDS_pept        complement(291879..292652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0260"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65644"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJZ0"
FT                   /protein_id="ABO65644.1"
FT                   /translation="MNIAFDHLVHLTERPEQAKAAFEQLGFTASHGGRHLSWGTYNALC
FT                   YFKPLCYIEWIGIADMQTANTCGNPLITLLVADSQEGSGFSQLAFRTNDIESLTKQLRN
FT                   KGFTPIGPFPGSRQRDDGKLLTWSMLFLEDDTGGAFRYPFFIEWGDSDDMRMNELAPLM
FT                   RHPIGSPSLSSISLYTLDLDRAIDGYRRLFGLPVPEVRHDEEGTYAELTVGGIALRFYK
FT                   ADDRPSTRPFLCRIAGIQPRRRFELAGGTYIVSES"
FT   gene            293456..293746
FT                   /locus_tag="GTNG_0261"
FT   CDS_pept        293456..293746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0261"
FT                   /product="Glutamyl-tRNAGln amidotransferase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65645"
FT                   /db_xref="GOA:A4IJZ1"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJZ1"
FT                   /protein_id="ABO65645.1"
FT                   /translation="MSRISIEQVKHVADLARLAMTDEEAELFTKQLDAIITFAEQLNEL
FT                   DTENVPPTSHVLDMRNVMREDEPEPGLPREEVLKNAPDQQDGQFRVPAILE"
FT   gene            293759..295216
FT                   /locus_tag="GTNG_0262"
FT   CDS_pept        293759..295216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0262"
FT                   /product="Glutamyl-tRNAGln amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65646"
FT                   /db_xref="GOA:A4IJZ2"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJZ2"
FT                   /protein_id="ABO65646.1"
FT                   /translation="MSLFDHTVSELHTLLQKKEVSISDLVDESYRRIGEVEEKVQAFLT
FT                   LNEEQARAKAKELDDKLAKGEETNPLFGLPIGIKDNIVTKGLRTTCASKILYNFDPIYD
FT                   ATVMERLNAAGAITIGKLNMDEFAMGSSTENSGFQLTRNPWDLERVPGGSSGGSAAAVA
FT                   AGEVPFSLGSDTGGSIRQPAAFCGVVGLKPTYGRVSRFGLVAFASSLDQIGPITRTVED
FT                   NAYLLQVIAGVDPMDSTSANIDVPNYVEALTGDIKGLKIAVPKEYLGEGVAEEVRQSVL
FT                   AALSVLEKLGATWEEVSLPHSKYALATYYLLASSEASANLARFDGVRYGYRTDNAKNLI
FT                   DMYKQTRSEGFGSEVKRRIMLGTFALSSGYYDAYYKKAQKVRTLIKRDFENVFEQYDVI
FT                   IGPTTPTPAFKIGEKTSDPLTMYMNDILTIPVNLAGVPAISVPCGFVDGLPVGLQIIGK
FT                   HFDESTVYRVAHAFEQATDYHKQKPVL"
FT   gene            295230..296660
FT                   /locus_tag="GTNG_0263"
FT   CDS_pept        295230..296660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0263"
FT                   /product="Glutamyl-tRNAGln amidotransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65647"
FT                   /db_xref="GOA:A4IJZ3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IJZ3"
FT                   /protein_id="ABO65647.1"
FT                   /translation="MNFETVIGLEVHVELKTKSKIFSSSPNAFGAPPNTQTNVIDLGYP
FT                   GVLPVLNRQAVEFAMKAAMALNCEIATETKFDRKNYFYPDNPKAYQISQYDQPLGKNGW
FT                   IEIEVNGKKKKIGITRIHLEEDAGKLMHTGDGYSLVDFNRQGTPLIEIVSEPDIRSPEE
FT                   AYAYLEKLKAIIQYTGVSDCKMEEGSLRCDANISLRPLGSDKFGTKTELKNLNSFNFVR
FT                   MGLEYEAKRQEKILLSGGVIRQETRRFDEATKTTVLMRVKEGSEDYRYFPEPDLVMLYI
FT                   DDEWKERVRASIPELPDARRKRYVEEWGLPEYDAKVLTLTKEMADFFEATVANGADPKL
FT                   ASNWLMVEVSGYLNSEQKELHDIALTPESLAGMIKLIQNGTISSKIAKKVFKELVEHGG
FT                   DPEKIVKEKGLVQISDEGALRKIVLEVLDANPQSVEDYKNGKDRALGFLVGQVMKATKG
FT                   QANPPLVNKLLVEEINKR"
FT   gene            296847..298151
FT                   /locus_tag="GTNG_0264"
FT   CDS_pept        296847..298151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0264"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65648"
FT                   /db_xref="GOA:A4IJZ4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJZ4"
FT                   /protein_id="ABO65648.1"
FT                   /translation="MSEERAFRPETLAIHAGQQPDAETGSRAVPIYQTSSYVFRDSEHA
FT                   ANLFGLKEEGYIYTRIMNPTNDVLEKRIAALEGGVGALALSSGQAAVFYSLINIASAGD
FT                   EIVSSSSIYGGTYNLFAHTLRKFGITVKFVDSSDPENFEKAITGKTKAVFAETIGNPKN
FT                   DVLDIEAVADIAHRHGIPLIVDNTVASPYLLRPIEFGADIVVHSATKFIGGHGNSIGGV
FT                   IVDSGKFDWKGSGKFPEFTEPDPSYHGLVYVDAVGEAAYITKARIQLLRDLGAALSPFN
FT                   AFLLLQGLETLHLRMQRHSENALAVAKFLEEEEAVESVSYPGLPSHPSHELAKKYLPNG
FT                   QGAIVTFEIKGGVEAGKKLIDSVKLFSHLANIGDSKSLIIHPASTTHEQLTPEEQLSAG
FT                   VTPGLVRLSVGTESIDDILEDLRQAIRQSQTVAVK"
FT   gene            298823..298993
FT                   /gene="sunA"
FT                   /locus_tag="GTNG_0265"
FT   CDS_pept        298823..298993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sunA"
FT                   /locus_tag="GTNG_0265"
FT                   /product="Lantibiotic antimicrobial precursor peptide"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65649"
FT                   /db_xref="GOA:A4IJZ5"
FT                   /db_xref="InterPro:IPR006079"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJZ5"
FT                   /protein_id="ABO65649.1"
FT                   /translation="MAKFDDFDLDIVVKKQDDVVQPNVTSKSLCTPGCITGVLMCLTQN
FT                   SCVSCNSCIRC"
FT   gene            299768..302908
FT                   /gene="spaB"
FT                   /locus_tag="GTNG_0266"
FT   CDS_pept        299768..302908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaB"
FT                   /locus_tag="GTNG_0266"
FT                   /product="SpaB"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65650"
FT                   /db_xref="InterPro:IPR006827"
FT                   /db_xref="InterPro:IPR023809"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJZ6"
FT                   /protein_id="ABO65650.1"
FT                   /translation="MNDLVFKNIDTFMIRTPVLSVDNYLRFFDQKLTEGEMKERLLEIC
FT                   HNPVFRESILVASKSLYNKMIDFCNGKEIKKYDYFIKAIYKYLIRISTRPTPFGLFAGV
FT                   DFGEYTDENTSIRYGTNKYKKFARPDLEWLMKIIKKLEQEQYEQLWFTVNDSIFLKGER
FT                   AYLLHSTRKDDDKRVNEISVRVTLPFKITCELARHLIHYQTLKKELIKQFPNTSEEKIE
FT                   RFLKQLIENEFLISNLRPPLTVMDQLDYLIKRLKESHIEEWSNELIDIQQKIRTYTMTP
FT                   LGEGEQIYKELHKKMKKLADTKNVLQVDMKLNLQEKKLNKQVIKDVNELMHILLPFSMT
FT                   YQQTDSPLSRYKQEFIEKYGVDREVPLLEMLDNDLGIGAPMDYTNPKNARLAVGVPHQL
FT                   IDEQLREYFLHKYIEAVKDKKSITITEDEIKELGLDDYDYQSIPDSLDINVIVKCDSEQ
FT                   DLENNHFKYYIGPNLGSTHAGKSFGRFSYMMEGEEKLFETLNKEMLNLNNDSGEYVTCE
FT                   LVYLPNETRHANVTRNIHNSEYELALFTNNSKDEYHRLSLNDILIGIENDMFYAKSKTL
FT                   NKKLIITMNNMLNTQNAPNAIRFLYDISLDGKKIWCNFPWDTIFQDYAYIPAIEYKNFV
FT                   IAPRKWVINKIIKTNDKISFTEFEKRFKKFCSDYDVPKYVYLTFADNRILLNTEDENCL
FT                   RILHHEFNNRYGNIILSSYEEADLHLVKDDDEKEYVCELVIPLVKVKQENRQWYAKAKK
FT                   SNHIPSFSDIRVKLPFENWLYLKLYGVHSRADDFIAFYLSEYCREKLAKGEIEKYFFIR
FT                   YADPEQHIRLRLNASEEKLLQIYPDMKQWLRTLIEKRVVSRFSIDCYEREIERYGGTEL
FT                   IDLAENLFFFDSIVVEDILKLKRLKHIQFSDEVIGMVSIIHYMEQFGLNYESQLDFLQQ
FT                   QVNKQDYREDFQKNRSVYMKVCNTDNDWQGLRDTDEGMLLLNVLNQRNRSIKEYASKIQ
FT                   DGLEASSELSILDSVVHLHCNRLFGIDREFEKKIRTLVAHTLYALKYIKAHGLVLKN"
FT   gene            303075..304904
FT                   /gene="spaT"
FT                   /locus_tag="GTNG_0267"
FT   CDS_pept        303075..304904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaT"
FT                   /locus_tag="GTNG_0267"
FT                   /product="Putative SpaT"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65651"
FT                   /db_xref="GOA:A4IJZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJZ7"
FT                   /protein_id="ABO65651.1"
FT                   /translation="MNIKEYDDHVTIKDIVKSIRIVPKTLVLIKNVDKQSFFIIIFLSL
FT                   LMGGAPIVTLLGSQNLLNAIGSQNIHIIISALIFYISAVLLSEIISSFMEYYQNKFQTL
FT                   INYKLNLQIMDKCTRLSLRHFEDAEVYDMLQRVQNETPYKPFEVFLSILGAISAIVTFF
FT                   SSMMILIHWKPWVLIILIFIPLVFSFYFFKIGQREFNVSWLRAPEKRKSWYLSYLMTRD
FT                   NTFKEVKIYNLAGYILNKFKEINKTFVGQDIHLFKRRTVFTFIFELVEQICINTVLVII
FT                   IISALAGEILIGHVVGLIQALNLISSNSKKILNIIHSLYKNNLYINQLFEFLGLDEEVL
FT                   DKGDRFVSGIDKIENIKIRNLTFRYPTNPKVVLKNINLDINKGERIAIVGANGSGKSTL
FT                   IKLLLKLYEHDEDSIFYNGVSINDLDTEQLRKNIAVLFQDFVKYELKLRENVGFGDITR
FT                   IDRDGELKQAMERARVNFIEDLDTQLGLWFVDGVQLSGGQWQKVAIARALFRDASVYIL
FT                   DEPSSALDPISEKEVIDMFINMTKDKIGIFISHRLSTAKLADKIVVMNDGEIVGIGTHW
FT                   ELLATNELYRRMYELEALKNEEEYEHLNESAGL"
FT   gene            304873..306180
FT                   /gene="spaC"
FT                   /locus_tag="GTNG_0268"
FT   CDS_pept        304873..306180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaC"
FT                   /locus_tag="GTNG_0268"
FT                   /product="SpaC"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65652"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR020452"
FT                   /db_xref="InterPro:IPR033889"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJZ8"
FT                   /protein_id="ABO65652.1"
FT                   /translation="MSISMKALVCNLAKKLSDYENMKRIVNHPSNYIKIGNKTINPFNE
FT                   LSLSHGLPALCALYGELSEQYPDEGWDLLGHQYMKKIGEQMNQHGFPSLSMFTGLAGIG
FT                   LAAVCLSKGGKRYQNFISTINQVIEERIGEMIEYLKQKPYPNMDDYDAISGVAGIASYC
FT                   LLFPQEMKKSITLILKYIIDLSQDKQMEDINVPGWYIPPMNAFSDTERRKWPSGFFNIG
FT                   LSHGIPALLIVLCNAKKLNIYVHGQDECIQRIADFLMKFQIKDENGSYWGTHVSLEEYK
FT                   NGSVLNKDTRDAWCYGTPGVAYSLLIAGKTLNNQSYIDCAVSGMKLASKRLYNIFSPSF
FT                   CHGLSGVAYICNRFYEETNISDFKEAACKLVDDIIKFYNEEFPFGFKNIEESEGSTKYY
FT                   DYVGLIDGTAGILLTILAIQNSKKTPWDCAFLLSEV"
FT   gene            306523..307221
FT                   /gene="spaR"
FT                   /locus_tag="GTNG_0269"
FT   CDS_pept        306523..307221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaR"
FT                   /locus_tag="GTNG_0269"
FT                   /product="Subtilin biosynthesis regulatory protein SpaR"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65653"
FT                   /db_xref="GOA:A4IJZ9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJZ9"
FT                   /protein_id="ABO65653.1"
FT                   /translation="MNNKKILVVDDDEDICCTIKQYLELHHYQVETVHSGVEALKMIND
FT                   DFDLIVLDIMMEGIDGMELCTIIRDRVDYPIVFVSAKTLEEDKVQALAIGGDDYITKPF
FT                   SLKELKARIDSHLRREERIRSNERYLLSSKNITIDLLANEVFCKGKKLPLTKKEYEIVK
FT                   LLMLNKKVVFSKERIFERVWGIDSDSQLDTVTESIKNIRKKIKAVDPETSYIQTLYGLG
FT                   YKWDVTDEKE"
FT   gene            307208..308626
FT                   /gene="spaK"
FT                   /locus_tag="GTNG_0270"
FT   CDS_pept        307208..308626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaK"
FT                   /locus_tag="GTNG_0270"
FT                   /product="Sensory transduction protein kinase SpaK"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65654"
FT                   /db_xref="GOA:A4IK00"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK00"
FT                   /protein_id="ABO65654.1"
FT                   /translation="MKKNKTIKRDFYLLVVKVVLATAISSAVTYLCLIYLIITLATNDV
FT                   VKPTNYFVKDLDLIEKKVKENEEAIFKGRLIPIHRYSEKIQGEVVDISGKHLYGDREII
FT                   DDQVDISQSINREIVKGSYVYRFIPLKHDNAIQAVYVLKAPFGFIINNQNRFEAVLIYA
FT                   VMFISPLIFFIVYLIFFTSRLYKSLFHNVKLLLQASDHIASGNFDFQVSGLKRKEFIKI
FT                   QDSFNTMISALKEMVERLAKTDDERKMMVSSIAHDIRTPLTVIQGQIDLIQDLRKLDHF
FT                   DVTPHLEIIRKNCGKMTMLTDNLSLLYKVENDHFSLNGKEVDVRQILEEKKLEISTMVY
FT                   HQKSINICFDVNLQKSRYILDEAMLMRVLDNILYNSLRFTKSGEIKLEVYDEKEGNECK
FT                   IYFRCSDTGTGFKENDTSLLFQPFYQDKQYKNHVGLGLYIAKRIVNHHGGEIWAYNNEK
FT                   GGATVEFYIKELSD"
FT   gene            complement(308720..309154)
FT                   /gene="spaI"
FT                   /locus_tag="GTNG_0271"
FT   CDS_pept        complement(308720..309154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaI"
FT                   /locus_tag="GTNG_0271"
FT                   /product="SpaI"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65655"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK01"
FT                   /protein_id="ABO65655.1"
FT                   /translation="MKNSILLLMLIGILFIGGCSLVSDLKKTATQNMEIDRKLPKYELN
FT                   KENLQEIHYQGRTYMIQAAKVDRNQLNKPIGKVAETITINEHHQILSKKELRKIEVIPD
FT                   QTDEKRTHLNFGWVYSIKGVNPDEEVAVTVNHQFLIAKRK"
FT   gene            complement(309209..309823)
FT                   /gene="spaG"
FT                   /locus_tag="GTNG_0272"
FT   CDS_pept        complement(309209..309823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaG"
FT                   /locus_tag="GTNG_0272"
FT                   /product="SpaG"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65656"
FT                   /db_xref="GOA:A4IK02"
FT                   /db_xref="InterPro:IPR022294"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK02"
FT                   /protein_id="ABO65656.1"
FT                   /translation="MAVSLPIIISLLTGLMSYQEEKAGSFMNILTGPVSKVQWYVGKLT
FT                   LLIFIACADILLATILMLFGMKYVLKVAHIHYQLFLQGAMLSIVGSLILFSLHLFISFA
FT                   FGMGASIAVGSGGFLISALIGATSLGDHVWSYIPWAWAVRLSQFPILMMPEVKQALGAQ
FT                   LLNSFSLSLWEGIAYALLSFIIVTIIGSIWFHRWEGNQPHE"
FT   gene            complement(309999..310745)
FT                   /gene="spaE"
FT                   /locus_tag="GTNG_0273"
FT   CDS_pept        complement(309999..310745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaE"
FT                   /locus_tag="GTNG_0273"
FT                   /product="Putative SpaE"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65657"
FT                   /db_xref="GOA:A4IK03"
FT                   /db_xref="InterPro:IPR021205"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK03"
FT                   /protein_id="ABO65657.1"
FT                   /translation="MLNMFESERLKYKRTFAKKLVFIAPLFFVLYAIITMPTVNSTHNY
FT                   FEYAVFNWWPLIFVPIGTALIASLSTVREKKSGNDKVLRCHDISIVRLWWSKITVIAYY
FT                   MLLSTIELIILLVLLKWLFPNSLSSATVAVFASLVIWLTSLAYIPIGLFVAERFGMVVS
FT                   IIVSVIGLALGVVMAAQPYWLFIPWSWGMRMMCPIVGVHPNGVPLEKGSPLLDPSVIPI
FT                   GLAIALVMFLLLSFLTAVWFARKEVY"
FT   gene            complement(310764..311453)
FT                   /gene="spaF"
FT                   /locus_tag="GTNG_0274"
FT   CDS_pept        complement(310764..311453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spaF"
FT                   /locus_tag="GTNG_0274"
FT                   /product="Putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65658"
FT                   /db_xref="GOA:A4IK04"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK04"
FT                   /protein_id="ABO65658.1"
FT                   /translation="MGEYMLETHHVSKAFGKQLVVDDVSIKVKKQTVYGLLGPNGAGKS
FT                   TLLKMLTGLLRPTKGEIMINGHPWSRKDLKDIGVLIESPALYGNLTAHENLLVHAKLLH
FT                   LPESRIQEVLNIVGLENTGKKKASQFSLGMKQRLGIAKALLNHPKLIILDEPTNGLDPL
FT                   GIQDLRKLIQSFTENGITVILSSHILSEVKQLADYIGIIQNGKLRYEGKIDESQDLEKL
FT                   FVDVVNE"
FT   gene            complement(312108..312737)
FT                   /locus_tag="GTNG_0275"
FT   CDS_pept        complement(312108..312737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0275"
FT                   /product="Glycine betaine/L-proline ABC transporter
FT                   (permease), putative"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65659"
FT                   /db_xref="GOA:A4IK05"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK05"
FT                   /protein_id="ABO65659.1"
FT                   /translation="MELLQTFIERQEEIWIAFQEHVLLSAIAMGIAIAVAVPLGVVLTR
FT                   YRKLAEPIIGIAAIIQTIPSLALLGFMLPIFGIGKLPAIIALTLYALLPILRNTYTGIL
FT                   GVDPALVDAGRGMGMTSRQILWMVELPLSLPVIMAGVRTATVLTIGVAALATFIGAGGL
FT                   GDLIDRGLRIADKNLILAGAIPAAILAIVFDWLLRKVEKKVTPKGL"
FT   gene            complement(313127..314260)
FT                   /locus_tag="GTNG_0276"
FT   CDS_pept        complement(313127..314260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0276"
FT                   /product="Glycine betaine/carnitine/choline ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65660"
FT                   /db_xref="GOA:A4IK06"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK06"
FT                   /protein_id="ABO65660.1"
FT                   /translation="MIRFENVTKQYEDGFVALKNINLEIRKGELVALIGPSGCGKTTTM
FT                   RMINRLIEPTSGKVYIDGQDISELDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLK
FT                   KWEKHAYEKRVDELLELVGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPDIILMDEP
FT                   FSALDPISREQLQDDIIRLQEEIHKTIVFVTHDMDEAIKIADRIALMKDGEIVQFATPD
FT                   QMLRRPANSFVREFIGEDRLQMRTRQTAVPTAEDLMSDDVATISPRRGLAEAFRLMKAR
FT                   KVDSLVVVDKKRSFLGIVTLKQIEQRYNEEHLLVADIADYDVTTLQKEAGVTDVAALFQ
FT                   DSDVRIIPVLDGDRLVGGITRSSMMRALAEWTFQQHA"
FT   gene            complement(314277..315179)
FT                   /locus_tag="GTNG_0277"
FT   CDS_pept        complement(314277..315179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0277"
FT                   /product="Proline/glycine betaine ABC-type transport
FT                   system, permease component fused to periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65661"
FT                   /db_xref="GOA:A4IK07"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK07"
FT                   /protein_id="ABO65661.1"
FT                   /translation="MLRKWFMSLLAVGLVLGLAACSGKSDAKGKIVITGKKFTEQMILT
FT                   HVLAEYVKANTDLDVEVKESLGGAFMLQQAIENGDIDMYVEYTGTGYLNILKQPYDPTK
FT                   TPEQIYNETKKLYKEKYNIAWLKSLGFNNTYALAMRRDLAEKLGVKTYSDLVNHSSSLT
FT                   FGSDAEFFERSDGYDGLVDTYGFHFKKTVNIDPDLQYEAAKNGKIDVITAYTTDARIKK
FT                   YDLVVLKDDKQYFPPYYAVPIIRQEVLDANPGLEEKLNQLANILTDEKMMELNGEVNLE
FT                   GKQPRKVAIDFLKSEGLID"
FT   gene            complement(315458..315874)
FT                   /locus_tag="GTNG_0278"
FT   CDS_pept        complement(315458..315874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65662"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK08"
FT                   /protein_id="ABO65662.1"
FT                   /translation="MEVDDKRILLLSVLTWIFYFFSFPTTATDNRVSSLIAFTLYLLRQ
FT                   HSLRNMYLFFHDSPLFVRGHPFYSLFRSPHFAIGAPLLHTIANYVSKHPNNSRPRATSW
FT                   PPAVWRCFIFLAMGCKLSAMTKASLASPLGRPVN"
FT   gene            316172..316918
FT                   /locus_tag="GTNG_0279"
FT   CDS_pept        316172..316918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0279"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65663"
FT                   /db_xref="GOA:A4IK09"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK09"
FT                   /protein_id="ABO65663.1"
FT                   /translation="MRLTITMNGRQGPVSLPLHYQHLLQGLLYRSLESKQLATFLHEIG
FT                   FRHEKRSFKLFTFSRLFGRHEVDRVKKTIRFLDEFQWHIDTILPELTEQLGQQLLLRRE
FT                   IWLYDQPVEVKSVKMDKVEIRQSTIEVAMLSPLTVYSTYETIDRRKKTHFFGPDDEVFP
FT                   HLIELNFRHKYQAYYGVPPVERLSIQPVHVHQRHRVVTLFKDMYITGWLGHYRLSSSPE
FT                   QLTFLYHVGLGSRNSQGFGMFCLTGK"
FT   gene            318005..318448
FT                   /locus_tag="GTNG_0280"
FT   CDS_pept        318005..318448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0280"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65664"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK10"
FT                   /protein_id="ABO65664.1"
FT                   /translation="MNNRIQQFWNDFCKATGQEGIEYKDAFQFGAFPDRLADLVVKGKK
FT                   TATTSGYVFYELEKEPIPKAGEYYIVLDGQGEPVAVIQIQSVEIVPMNEVTEEFALAEG
FT                   EGDYRSWWDAHEKFFTESLKEYDMEFSPDMLVVCERFKKVYPK"
FT   gene            complement(318801..320039)
FT                   /locus_tag="GTNG_0281"
FT   CDS_pept        complement(318801..320039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0281"
FT                   /product="multidrug resistance protein B-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65665"
FT                   /db_xref="GOA:A4IK11"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK11"
FT                   /protein_id="ABO65665.1"
FT                   /translation="MDWKRSVRILWLCNFMVSAGMTMVIPFLSLFLWQMGVTEHHALSM
FT                   WTGLVFSATFLSAAIMAPIWGMFADKYGQRANLIRAGIGMGLLTACMAFAASPMALLVL
FT                   RFLVGFFSGFITVSFSYLARIVPKDHSGEALGTLQTGSIAGNIIGPLIGGALSDLFGFR
FT                   PVFLVTGLCILLTLLPVMFWLEKDPVVPQTKKNKASFKEVFEHRPLIILFIATFLVQIA
FT                   VLGVNSMMTIFVQSLVGNTSNLAFLSGLASSITGIATIIGAPYLGKLGDRIGQEKTLPI
FT                   LLVLSGLFALPQVWTDNIYALYVWRFLQGLVVGGVWPAIQALINVQSPRRIQGRVFGVT
FT                   ASSRFLGNLTGPTAAGAIASLFSIAYIFAFSSLLLIVTGALVGYAHRRSSSVWRKEMKE
FT                   KLTTWTHRLHSRH"
FT   gene            complement(320212..320865)
FT                   /locus_tag="GTNG_0282"
FT   CDS_pept        complement(320212..320865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0282"
FT                   /product="phage shock protein A-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65666"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK12"
FT                   /protein_id="ABO65666.1"
FT                   /translation="MGVFRRIKTIVLAEVNEQIDQWEDPIAMTKQYLRELKQQLEQGRQ
FT                   ALAQQWVAEQRYATLIAQAEETVEKRNRQAKLALERNEEAVAKLALGDKLLYEKKLETY
FT                   KQQYETIKAKTAEIVRRLNQLRERYDELAAKQLELTARVNAAKALKQIDTTLASFSADE
FT                   ALRGFARMEERVIALEAEASAARFGTNAVLSPVPFEEEVERELAKWKEAQSTNA"
FT   gene            complement(320825..321355)
FT                   /locus_tag="GTNG_0283"
FT   CDS_pept        complement(320825..321355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0283"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65667"
FT                   /db_xref="GOA:A4IK13"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK13"
FT                   /protein_id="ABO65667.1"
FT                   /translation="MSILKKLRALALLALIVLAGVSLFHVLTPHEVIVYRRLSVPFDGM
FT                   HGGLGHHHLIFRVEPRAGWLIPGLLMWFIPLLLVGVGAIWLVAKRSKRWIGWALITLGI
FT                   AALLPKWVLLGLALAAVYTFGRHQTRKSVAAETWKPTTAPISTDWLDEWEKIVQKEGKT
FT                   NGCVPPDQNNRSR"
FT   gene            complement(321516..322925)
FT                   /locus_tag="GTNG_0284"
FT   CDS_pept        complement(321516..322925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0284"
FT                   /product="Two component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65668"
FT                   /db_xref="GOA:A4IK14"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK14"
FT                   /protein_id="ABO65668.1"
FT                   /translation="MSSKRCGEWDIKLINNWNEWRQWLRRLGNADLFRRTHWRLTALYS
FT                   GIFTLFLALFVVIAAALFYWITTSEQEQRITRLAEQEANTIEQFLLKQSNFDLFDDQSL
FT                   VLFSEDQLFFYVISPTGRLLAGDEVHRRLRPYFLSALSHLDTNEQTPVYLTVSLPKHMP
FT                   GLARDAARDWRVLTAAHPLVIRGDVVGMLYIGMDVTSFFGVFHWLLIVLIGLAILFLAV
FT                   GVALSFFMSKRALVPIEEAYERQRQFVADASHELRTPLSVVFSSVEALTLEEDVMKNEL
FT                   AHRLLDRLREELKRITKLMNDLLTLARADAKHAALELAKQTFDFRPHAERTFQLISELA
FT                   AKKQITMNFHAPEQAMVTADPDKLTQLLYILLDNAIKYTPEGGNVTLSIRTEPKQFVLS
FT                   VKDTGIGIPPEDIGRIFDRFYRVDKARSRQQGGHGLGLSIAKWIVDAHGGTIHVQSQLG
FT                   QGTEFLVLLPA"
FT   gene            complement(322879..323541)
FT                   /locus_tag="GTNG_0285"
FT   CDS_pept        complement(322879..323541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0285"
FT                   /product="Transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65669"
FT                   /db_xref="GOA:A4IK15"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK15"
FT                   /protein_id="ABO65669.1"
FT                   /translation="MKVLLAEDDLHLWELIVHLLKKKGIDHIDWVQEGEDAYDYAMAEF
FT                   YDVVVLDWMLPNGDGVDICRRLRQNGYTGAILILTAKDAVQDRVTGLEAGADDYLVKPF
FT                   EIDELVARLKALARRTFVPLQEETVTFHGFTLNRTSHTLHRNNEEISLTPREFQLLDLL
FT                   VQNQGQVVPRETILDRVWGWDADVSMKTIDATIKLLRKKLKDDVIQTVRGVGYKIDK"
FT   gene            323905..325113
FT                   /gene="hhoA"
FT                   /locus_tag="GTNG_0286"
FT   CDS_pept        323905..325113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hhoA"
FT                   /locus_tag="GTNG_0286"
FT                   /product="Protease HhoA"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65670"
FT                   /db_xref="GOA:A4IK16"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK16"
FT                   /protein_id="ABO65670.1"
FT                   /translation="MDMMTFEPTPPPQPKRRGRFVSWMAASVAGAVIGSVATWYVAPKW
FT                   LNQGNVAQTQLTQTNGKKSETLPLQPTASTNTNMIAAINEVADAVVGVINIQKQADFFS
FT                   NQVQNTEAGTGSGVIFKKDGNTAYIVTNNHVIEGANEVEVALANGKKVKADIVGADALT
FT                   DLAVLKIPANGVTKVASFGDSSNVPIGEPVAAIGNPLGLDLSRTVTEGIVSGKRTMPVS
FT                   TSAGNWEIDVIQTDAAINPGNSGGALINSAGQVIGINSMKIAQMGVEGLGFAIPSENAQ
FT                   PIVEQLMKDGTVKRPYLGVQLVDVADLSADVRNDELKLPSSVTQGAAVTAVEPFSPAAE
FT                   AGLKSKDVIVAINGDKIDSVSALCKYLYTKTSVDERIKLTIYRDGFETTVSVTLKTKQN
FT                   NQS"
FT   gene            325166..325447
FT                   /locus_tag="GTNG_0287"
FT   CDS_pept        325166..325447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65671"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK17"
FT                   /protein_id="ABO65671.1"
FT                   /translation="MKSPPCEYNRLDGGDHASLLQDRRKDSEQRGGTTTALRMCRMTAS
FT                   IPFWYIQQRGEKENGKQMKEAEIPSNVVRCSNPRSASGYIADLKRSVW"
FT   gene            325860..326159
FT                   /locus_tag="GTNG_0288"
FT   CDS_pept        325860..326159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0288"
FT                   /product="Sodium/pantothenate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65672"
FT                   /db_xref="GOA:A4IK18"
FT                   /db_xref="InterPro:IPR010398"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK18"
FT                   /protein_id="ABO65672.1"
FT                   /translation="MKHDIFSKDPRYKIARKEVWIGIGLVIFNFIWWYGFAYGLGSVPA
FT                   NQYSYIFGFPAWFFYSCILGLIVMSLLVFTVVKFFFKEVPFDEDEIDGEGRGVK"
FT   gene            326156..327625
FT                   /locus_tag="GTNG_0289"
FT   CDS_pept        326156..327625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0289"
FT                   /product="Sodium:pantothenate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65673"
FT                   /db_xref="GOA:A4IK19"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011849"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK19"
FT                   /protein_id="ABO65673.1"
FT                   /translation="MNWEVIIPLIIFLLITFSVGVWANKYVSKTNSFLQEYFLGSRELG
FT                   GFILAMTMMATYGSASSFIGGPGVAYTTGLGWVLLSMAQLPAGYFVLMILGKKFAIAAR
FT                   KYQAITLIDFLKSRYESKWVVLLSALSIIIFLFSAMAAQWVGGARLIESLTGLSYTTAL
FT                   FIFAVSVLVYVIIGGFRAVAMTDAIQGTVMFIGTFILLIATIVAGGGVSNIISELATEN
FT                   PNLITPFGAEGELTPLYVSSFWILVGVGVVGLPQITVRAMSYKNAKAMHRAIIISTVFV
FT                   GFIMLAMHLIGVFARVIIPGVEIGDKVMPLLTLHVLPAWLAGIVLTAPLAAIMSTVDSL
FT                   LILVSSSIVKDVYLNYIKPEATEKQIKTVSFGVTTIIGILVFLMALSPPDLLIWLNLFS
FT                   FGGLEAAFIWPVILGLYWKKGNKYGAIASMIVGVGSYIVIHTYFGNLFGLHTVVVPVLL
FT                   SCIVYVLTSLITNKTMGMKVDYGLSHQTKEV"
FT   gene            327629..328858
FT                   /locus_tag="GTNG_0290"
FT   CDS_pept        327629..328858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0290"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65674"
FT                   /db_xref="GOA:A4IK20"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK20"
FT                   /protein_id="ABO65674.1"
FT                   /translation="MNNYVTDSTLRLLRDREEVVKLTQALVRIPSVYRPGDPEGNEQKV
FT                   AQYVANYLKQMGVEVHIEEVEPGRPNVIGIIDSGKPGKTILFEGHTDVVTEGDRSAWTY
FT                   DPFGAEIVNGRIYGRGTNDTKGNLACMITAVHSLLREKEQWKGKIILCIPCDEEGMMIG
FT                   IKHFIQRGWAKGVDGAIICEPEENQVCIAQKGAMRIVIRVYGKMAHGAIPLSGINPNTR
FT                   MAKLICELEQLEKREKERLGKHPLLGWPSITPTILKAPVRGDAQINVIPDQCMTTLDIR
FT                   TIPGQDHEELCEEIQRIFERLAEEDPDFKGEFEVIENRPWTKTSKDEPIVKAVAEAVRR
FT                   VTKKEPYYNGVPGATDGTFLHLEGIPIVTIGAGDREIPHQVDEYVDIDELAETTEIYRT
FT                   AALLFLNEEV"
FT   gene            328862..329935
FT                   /locus_tag="GTNG_0291"
FT   CDS_pept        328862..329935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0291"
FT                   /product="Tartrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65675"
FT                   /db_xref="GOA:A4IK21"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK21"
FT                   /protein_id="ABO65675.1"
FT                   /translation="MREFRIAVLPGDGIGPEVMNEALKVLRILKDKDYTFQFHADMFLW
FT                   NSEYYLQHGRMMPENGLDILKNYDAILFGAIGDPRVPDDISVWELIMPIRKRFCQYVNL
FT                   RPVKKLKGIPEQFIHQERPINFVIVRENAEGEYSNSGGRIYQGTDQEIAVQNTIITRKG
FT                   TERIARYAFQYAKKHGYQKVINATKSNAVVHSMKLWDEVIEHVASEYPDIQLEKYYIDA
FT                   LAAYFVQRPDTLQVIVASNLFGDILSDLGSALVGGLGISPSANINPEGVFPSMFEPVHG
FT                   SAPDIAGKGKANPIAQIWSAALMLQSLGREDLASIILKAIEKVTEHGEKLTEDLGGNST
FT                   TAEMGEEIVRQIVKIMG"
FT   gene            329962..330708
FT                   /locus_tag="GTNG_0292"
FT   CDS_pept        329962..330708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0292"
FT                   /product="Oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65676"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK22"
FT                   /protein_id="ABO65676.1"
FT                   /translation="MRFLDKVVIVTGAAGGMGKAAVKRFLDEGAHVVALDLYPKGIPET
FT                   ADHFYPLAVDVTNEEKVKQVFQEIRNQFGKIDALVNFVGIAQQAEPIEQVSLNKWMKIL
FT                   NTNVTSLFLLCKEAVQIMKDTRNKGAIVNVASISVVRPRPGLQSYIASKGAVVSFSQAL
FT                   ALELAPYQIRVNVIHPGPCDTDMLGEFAALGSDVNVVKEEIFKKSIPLGELIQPEDVAS
FT                   TALYLCSDEAHMITGSVIHVDGGRGI"
FT   gene            331077..332528
FT                   /locus_tag="GTNG_0293"
FT   CDS_pept        331077..332528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0293"
FT                   /product="Aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65677"
FT                   /db_xref="GOA:A4IK23"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK23"
FT                   /protein_id="ABO65677.1"
FT                   /translation="MGMKKRKMYVDGKWIDSKSGEAITVFNPANYEPIAQVPRGNSEDV
FT                   NDAVEAARRAFESQQWRNVKPHERGYILLEMAKRIRECKDELARLETLDVGKPLSQSYA
FT                   DVEAAARYFEFYGGVADKIMGETIPVEPGILDYTIREPLGVTAHIIPWNYPIQISSRSA
FT                   AAAIAAGNAVVMKPAEDAPLTTLKLAEFFDELNLPNGIFNVVTGFGHEAGAALALHPDI
FT                   DHVTFTGSVETGIFVMQAAAKNVVPVTLELGGKSPNIVFSDCDKEKALHWIVKSIIQNA
FT                   GQTCSAGSRLIIEKSIKDSFVEALVERFKNMTIGPGIEDVDIGPIISKKQFDIIQNFLS
FT                   IAEREGKILVGGRRVMIPGNEKGYYVQPTIVDEVDANSPLAQEEIFGPVLTVLTFESEE
FT                   EAIQMANGTKFGLVTGIWTSDVKRAHRVAERVQSGQVFINNYGAGGGIQMPFGGYKRSG
FT                   FGREKGLEALRNYTQLKNIALKYSD"
FT   gene            complement(332839..334608)
FT                   /locus_tag="GTNG_0294"
FT   CDS_pept        complement(332839..334608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0294"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65678"
FT                   /db_xref="GOA:A4IK24"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK24"
FT                   /protein_id="ABO65678.1"
FT                   /translation="MTGGFLALFSTRQGEQQMPDVTISIWTAVVGFFLSFLAYFFKKWC
FT                   PSLYVYILTAILGIGWIVYVFLDQGFIKTVPIFFIFVFSFFSSPVPERSKVQLQEIIDQ
FT                   LKEQGAREIVLSKNKERLLVDFLFSGLFIVIAVLYFLFGPDSPITLILLYSFVSLVVGL
FT                   TKRVELFRALRLFYAEHEEVLYAVSLFETKKYPLEELSEVSVQTRPDVLQLFQLFSLFS
FT                   PNMDYTTSMGKTWKLSFSGEKVYFTPDPSESMAFLLKEEIHKMEEVEVKPFYHQNNWKR
FT                   LLGKWYFAATVKGVGAYAALITLFTLMGIGPIVTTIVMVLFWIFNLWISDRVLKIALDM
FT                   KKIDDPDLLPIIEKVFSRAGLSHVDIYVTESAEYNGFAIGANIGRSLVALTSETLKLPH
FT                   EAIEGILAHEAIHVKKRDVLMGQLLRFLLIGLVLAGVFLFYKDFQNWLEHAQIFVFLSL
FT                   WLLIFLLPAFQSLFTQWMEVRADHLGATLLDGGNAQMANSLTILCEYQDRALEKSAGYY
FT                   VTFEKEQEANKKDKKISSLERDSWFFRFLEFQFMSHPPMYWRVHSLQTTETGWSIGKIK
FT                   LWWCSRFRESLPN"
FT   gene            335375..335911
FT                   /locus_tag="GTNG_0295"
FT   CDS_pept        335375..335911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0295"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65679"
FT                   /db_xref="GOA:A4IK25"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK25"
FT                   /protein_id="ABO65679.1"
FT                   /translation="MFGYPPEVVYGAVLVVSALLTVLYFFFSDVLDGLFDVAAHPLFSP
FT                   QLVLSFFIVASAVGLLAEWYTDWASHWIIWLSVGVALIVVLLLHFFVFLPLRSAEASLG
FT                   YTDAELEGSLAKVIVSVPPDGFGEILISRKSGAVAKAAKSMNNEAIPSGEEVIIVRMEN
FT                   GIAVVARHDPYQLSI"
FT   gene            335933..337453
FT                   /locus_tag="GTNG_0296"
FT   CDS_pept        335933..337453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0296"
FT                   /product="Flottilin"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65680"
FT                   /db_xref="GOA:A4IK26"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK26"
FT                   /protein_id="ABO65680.1"
FT                   /translation="MTVAPWLIVVGVVVLLLIGLIAIFIARYRTVGPDEALIVTGSYLG
FT                   NKNVHVDESGNKIKIVRGGGTFVVPIFQQAEPLSLLSIKLDVQTPEVYTEQGVPVMADG
FT                   VALIKVGSSIGEIATAAEQFLGKTRQDMENEAREVLEGHLRSILGSMTVEEIYKNRDKF
FT                   SQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLDALGKPRIAQVKRDADIATAEAEKE
FT                   TRIKRAEADKEARKAELERMTEIAEAEKINQLKLAEFRQEQDIAKARADQAYHLEEAKA
FT                   KQEVMAQQMQIKIIERQKQIELEEKEILRRERQYDSEVKKKADAERYAIEQKAAAEKAK
FT                   QIAEADAQKYRVETLAKAEAERIRLDGLAKAEAEKAKGEAEAEIIRLKGLAEAEAKQKI
FT                   AEAFERYGQAAVLDMIIKMLPEYAKQVASPLSNIEKLTIVDTGSGAGGGANRVTGYATN
FT                   LMASLQETLKASTGIDVKQLLENIAQGGTPASPVNPPTASGQQTNTNE"
FT   gene            337598..338518
FT                   /locus_tag="GTNG_0297"
FT   CDS_pept        337598..338518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0297"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65681"
FT                   /db_xref="GOA:A4IK27"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK27"
FT                   /protein_id="ABO65681.1"
FT                   /translation="MKRARVIYNPTSGRELFKRHLPDVLVRLEKAGYETSCHATEGPGD
FT                   ATKAARQAAEREFDLVVAAGGDGTINEVVNGIANQPYRPKLGVIPVGTTNDFARAIGVP
FT                   RSIEGACEVIATGEPVAIDIGSVTNEDQTRYFINIAGGGRLTELTYEVPSKLKTMLGQL
FT                   AYYLKGIEMLPSIKATEAQIEYDGKLFEGEIMMFLVSLTNSVGGFEKLAPDSSLNDGLF
FT                   DFIIVKKTNLAEFIRLVTLAARGEHINDPHVIYTKANRVKVRSSMQLNLDGEFGGMLPG
FT                   EFVNLYRHLEVFMPKEKAAQVRTGP"
FT   gene            338593..339975
FT                   /locus_tag="GTNG_0298"
FT   CDS_pept        338593..339975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0298"
FT                   /product="RNA methyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65682"
FT                   /db_xref="GOA:A4IK28"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK28"
FT                   /protein_id="ABO65682.1"
FT                   /translation="MAKQQAPVAKNDYYDVTFTDLTHDGLGVAKVDGFPLFVKNALPGE
FT                   RAKVKVIKVKKGYGYGRLIELYEPSPDRVEPPCPVYRQCGGCQLQHLSYEGQLKAKEKQ
FT                   VKEVLARIGKLEHVTVHPVIGMKNPWRYRNKAQVPVGEREGGLIAGFYKERSHEIIDMD
FT                   ACFIQQEKNDVVVQAVKRIAERYGVRPYDELTHRGVLRHIVARYGAATGEVMVVLVTRT
FT                   ERLPHEQEIVRDIIRDIPDVKSIVQNINPERTNVIFGAKTRVLWGSEFITDRIGDIQFA
FT                   ISARSFYQVNPEQTKVLYDKALEYAELTGTETVIDAYCGIGTISLFLAKKAKHVYGVEI
FT                   VPEAIEDAKRNAALNGITNVTFAVGAAEDVIPRWYEEGIRADCLVVDPPRKGCDAALLE
FT                   TIMAMKPPRVVYVSCNPATLARDLRILEDGGYETIEVQPVDMFPHTAHVESVARLALKI
FT                   RA"
FT   gene            complement(340644..342029)
FT                   /locus_tag="GTNG_0299"
FT   CDS_pept        complement(340644..342029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0299"
FT                   /product="Sodium:dicarboxylate symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65683"
FT                   /db_xref="GOA:A4IK29"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK29"
FT                   /protein_id="ABO65683.1"
FT                   /translation="MNIYLIIFNIAILLLLIGVLVYMQKKHVSFSKRVFTALGLGIVFG
FT                   FALQGVYGAGSAIVQQSTQWFDIVGTGYVKLLQMIVMPLVFISIVMAFTKLSVSNHLGK
FT                   IATLIIGLLLGTTAIAASIGIMSSLGFQLEAMEIPSGEAEQTRGQELEQKYEQIQNLSF
FT                   PQKIIELLPANPFLDFTGQRSTSTIAVVIFAAFVGIAYLGVARKQPEQAEMFKKIVDAL
FT                   YAIVMRIVTLVLRLTPYGILAIMSRVTATSDINTIAKLGKFVVASYIALFVMFAIHLII
FT                   LALAGLNPITYVKKVLPVLSFAFTSRSSAATLPLNVKAQTTALGVPEGIANFAGSFGLS
FT                   IGQNGCAGIYPAMLAVMIAPTVNIDPTSPSFILTLILVVTISSFGVAGVGGGATFAAIL
FT                   VLSTMNLPVALAGLLISIEPLIDMGRTALNVSGSMTAGVVTSRITKELDVNVYNEETQK
FT                   LEA"
FT   gene            342368..343141
FT                   /locus_tag="GTNG_0300"
FT   CDS_pept        342368..343141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0300"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65684"
FT                   /db_xref="GOA:A4IK30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK30"
FT                   /protein_id="ABO65684.1"
FT                   /translation="MEEVLQVKEINKIYQGKVAFQALTNVSFSVEKGEFIGIMGPSGSG
FT                   KTTLLNLISTIDKPTSGKVLINGQDPHQLKKERLAEFRRKELGFVFQDFNLLDTLTLEE
FT                   NIMLPLTLENVDPELIEEKVKTISKKLGIDAILTKRTYEVSGGQKQRTAIARAIIHQPK
FT                   LLLADEPTGNLDSKASKDVMQTLQMINENDQTTMLMVTHDPYAASYCHRVIFIKDGKLY
FT                   NEIYRGTDQKAFFQQIMDVLSMLGGDRDDFSTVRL"
FT   gene            343116..344987
FT                   /locus_tag="GTNG_0301"
FT   CDS_pept        343116..344987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0301"
FT                   /product="ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65685"
FT                   /db_xref="GOA:A4IK31"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK31"
FT                   /protein_id="ABO65685.1"
FT                   /translation="MTFPQFAYKNITRNLRAYMAFYLSSSFAVMIFFMFAMFIFHPALE
FT                   TGYMNNIAKKGMKFAEWIIFGFSIFFILYSLSTFLKTRKKEFGILTIHGASPKQLRWLI
FT                   TLENVFIGLASIITGILGGTVLAKFFFIAGAYMVKMEPLQLYFPLEALGITVGVFLLLF
FT                   ILISQFMLFTIHSEEVISLLKGSEKPKKEPKPSILFSVLGILFLGTGFGMSLFAGIDMG
FT                   SAVVITLCTVIGTYLFYSQLSVWMIQLLKRNKKMYRKGINLLWISDLTYRIKDNARLFF
FT                   IVSIVSAVAFTATGTLATYKLMFSTAETSYAMEFLSYATNQDEKKQLEFIKEKLEQENI
FT                   DYQQTIFKAIEARQGPMSYPVLVVSHQDWVKQFPELQAPNIHDGEGIYYGEAKRGGYTI
FT                   VNGNKTKLLTDDQQMSITLQSIEEPVFYLSDILVVDHNTFRQLEQNHELSTMYGFQFEN
FT                   WKESLEISQEIQSQIVGETFNPNAQYFSKAVRYFETVQLPSLSLFIGLFIAIIFFLAAG
FT                   SFLYFRLFADLYEERKKYKSLAKIGLSEKEMVKISTIQMAILFFLPFLLAIIETGFALH
FT                   VLQREGGYFHVFQSGVITILGFLGLQIIYFIIMSHSYNKHLKEYVFR"
FT   gene            345012..345368
FT                   /locus_tag="GTNG_0302"
FT   CDS_pept        345012..345368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0302"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65686"
FT                   /db_xref="InterPro:IPR006542"
FT                   /db_xref="InterPro:IPR036166"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK32"
FT                   /protein_id="ABO65686.1"
FT                   /translation="MKKIIGMIIALVVVFVGFFTIVPEEDRDHINPFIPKEVVYVQIYE
FT                   DPAPHGQRYKYTLTGYTEDGEEKEITFTAGKVLKEKAILKVNAKGSFVEKWEEVQPEEL
FT                   PEKVRGKMDSVPSN"
FT   gene            345769..346119
FT                   /locus_tag="GTNG_0303"
FT   CDS_pept        345769..346119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0303"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65687"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK33"
FT                   /protein_id="ABO65687.1"
FT                   /translation="MTTHKIYKMSFSKVYPNYIAKAEKKGRTKSEVDEIIRWLTGYTQD
FT                   ELEAQLEKQVDFETFFAEAPQLNPNRVLIKGVICGVRVEEIEDPLMQNIRYLDKLIDEL
FT                   AKGKSMEKILRK"
FT   gene            complement(346191..346502)
FT                   /locus_tag="GTNG_0304"
FT   CDS_pept        complement(346191..346502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65688"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK34"
FT                   /protein_id="ABO65688.1"
FT                   /translation="MSLFLLLFVHYFHQQSEQLTHHRHVASFRHHPFRGVHLSFLDSLL
FT                   LVRGDSLHSLFRFLCLHWFTSFRNWRSSSSNNHKYVSNSPNDRRCLASSSPVVGSSYT"
FT   gene            347171..348166
FT                   /pseudo
FT                   /locus_tag="GTNG_0305"
FT                   /note="nonfunctional Type I restriction-modification system
FT                   R subunit due to frameshift"
FT   gene            348394..348717
FT                   /locus_tag="GTNG_0307"
FT   CDS_pept        348394..348717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0307"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65689"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK35"
FT                   /protein_id="ABO65689.1"
FT                   /translation="MNTQFKKGVLELCVLALLNKQDRYGYEIVQKISEQMVISEGSVYP
FT                   LLRRLKKEDYLTTYLQESNEGPPRKYYKLTEKGRNHLRNLHEEWMQFSEGVNQIIKDGG
FT                   LHE"
FT   gene            348710..349270
FT                   /locus_tag="GTNG_0308"
FT   CDS_pept        348710..349270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0308"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65690"
FT                   /db_xref="GOA:A4IK36"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK36"
FT                   /protein_id="ABO65690.1"
FT                   /translation="MNKQQFLTALETELKKLPHEEREEIIQDFEEHFYIGMANGKSEEE
FT                   ISQSLGSPKQIAKEIAAVSRIEKIEASATVGNVLRAVWAVIGLGFFNFVTVFGPFLALL
FT                   AVVFVGWFIGVAFIASPLILLVSAINHPGMFDLFSLFFSIMLCGSGWFIVRGMLYVTKV
FT                   LTDLLVRYLRYNVSLVKGGLKHD"
FT   gene            349263..350066
FT                   /locus_tag="GTNG_0309"
FT   CDS_pept        349263..350066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0309"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65691"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK37"
FT                   /protein_id="ABO65691.1"
FT                   /translation="MINTRHISFLALILLVVGAIGSFITFKPASKPFSVSEERILTDKT
FT                   ITDIEIRANDENVNIFSTKDSKTKVQLTGTSVEKMDHYFSVEVEDGTLLIKLKDDKPFF
FT                   DFFHFRGTSLTLDVYLPEKVYESLHVDMNNGEIQAEKLRINNIEAKLANGYLEMKDIVA
FT                   TMLKADSDNGEIHLENIEGEIYGNVNNGQIYLKTNHLDRSLTLESDNGDIEIKTDQKPT
FT                   NAVLDIKTKNGEVTVFGNSNWDTVIGNGENQIKLTTNNGDIRIVK"
FT   gene            350442..351275
FT                   /locus_tag="GTNG_0310"
FT   CDS_pept        350442..351275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0310"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65692"
FT                   /db_xref="GOA:A4IK38"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK38"
FT                   /protein_id="ABO65692.1"
FT                   /translation="MVNHMIQSVAEKLSCLPFIEGVVLGGSRARGTHEEDSDIDIGIYY
FT                   NAELFDLNAMNQVAAELDDERRSNLVFPPGAWGKWVNGGGWLVINGYHVDFILRDIKRV
FT                   EQIIKETEQGMVTADYQTGHPHGYISAMYRGELAISKILYAKDETFCQLKKRAETYPAA
FT                   LRKSLIDFFMFEAEFSLLFVKKNVKANDKYYIVGHVFRMISCLNQVIFACNHAYCINEK
FT                   KAIKLIETFEHKPENYAQKVNRIFELLGSSLMECCDMTEKLYNEVKQLVSEINHF"
FT   gene            351395..351985
FT                   /locus_tag="GTNG_0311"
FT   CDS_pept        351395..351985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0311"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65693"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK39"
FT                   /protein_id="ABO65693.1"
FT                   /translation="MMRSENRFTPRSDEELQKLTVGELKPHNAPITLVEYDPRWPELFE
FT                   REAKRIRSVLGSKALQIEHVGSTSVPGLCAKPIIDMLLVVEDSADEPSYVPALEAAGYR
FT                   LRIREPEWFEHRLFKGPDTDINLHVFSKGTSEIDKMLRFRDWLRSNESDRDKYAQVKRS
FT                   LAKNKWRHVQHYADAKTSIVQEILARTNDSNAK"
FT   gene            352400..352741
FT                   /locus_tag="GTNG_0312"
FT   CDS_pept        352400..352741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65694"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK40"
FT                   /protein_id="ABO65694.1"
FT                   /translation="MFRPSTVDTKRFVRVSWGWVRCFAGLCPNYFLRLSSYEDLVPLMR
FT                   LNSCNIYYPIYINLQKGVVYNKEKKKGKELFCFRSHLCNNCCILHVLSYYFISFPAFLC
FT                   SHASYFVDN"
FT   gene            352668..353039
FT                   /locus_tag="GTNG_0313"
FT   CDS_pept        352668..353039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65695"
FT                   /db_xref="GOA:A4IK41"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK41"
FT                   /protein_id="ABO65695.1"
FT                   /translation="MCLAIISFPFLLFYAVMHLISLTTDVRIHSLGTFSSLKIILTFFI
FT                   TTVVTTGMVGTIFSIILKRSKGMFGFLSEALLMLAFFYLYVLVYSLVSDDIVMTDKGRL
FT                   YVSYVCIDSSSIYWCKTAL"
FT   gene            353721..354911
FT                   /locus_tag="GTNG_0314"
FT   CDS_pept        353721..354911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0314"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65696"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK42"
FT                   /protein_id="ABO65696.1"
FT                   /translation="MLSISLGLPEFKVIKHELLSYGYAIHVEKTETQERCPHCGFATSS
FT                   VHDRRTRKVRDLAIFHQPVYLFVKVKRYRCWNCSQVFSASLESIPPNQHYTNRFCEYLY
FT                   ELCEGSTIQEVSRKHRIPYTTLERIYYSIASKKAKERQTATEVSSPEGMVLSLDEIAVK
FT                   KGHQYETVLMDARAGSVMGMHADRQCDSAINLLSQNGLSKEMVQTVILDMWEPYHKAVR
FT                   ALFPSASIVIDKYHVVQKVTQALDQARKEFSPLKKARYLLLKGCEKLRKDQRLRLDDIL
FT                   EEYPVLSIAYYLKELFRDFYRTDGYNEAKERLEEWIKLAKQSPFASFQEAANTLERWKE
FT                   PILSYFLCPYTNARIEGTNHKIKNIKRRAYGYRNLERFRLRVFLECTGNTTGSQAA"
FT   gene            355961..357430
FT                   /locus_tag="GTNG_0315"
FT   CDS_pept        355961..357430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0315"
FT                   /product="Alanine carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65697"
FT                   /db_xref="GOA:A4IK43"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK43"
FT                   /protein_id="ABO65697.1"
FT                   /translation="MIEKFVETVNGLLWSPLLIVFIVFCGLYFSIRTRFLQIRHFKEMV
FT                   KLVTTGKGSDVGVSSFQALTMSLSGRIGVGNVAGTATGIAYGGPGAVFWMWVITFIGAA
FT                   TAYVESTLAQIYKEEQDGQYRGGPAFYIEKGLGWKWFAIVIAVAILLAMAVLMPGIQAN
FT                   SIADSVYNAFGINKLVTGIIVISILGFTIFGGVKRIARTAEIVVPFMAAGYLLIAIAII
FT                   GVNFDKIPEVFALIFKSAFGAEQVFGGIIGSAVMWGVKRGLYANEAGQGTGAHPAAAAE
FT                   VSHPAKQGLVQAFSIYLDVFLVVTATALMILFTNQYNVINEKTGEPIVVNLEGVEPGAG
FT                   YTQAAVDTLLPGFGSAFIAIALFFFAFTTMYAYYYIAETNLAYLVRGKNKGIAFLGLKI
FT                   IFLAATFYGTVKTATTAWAMGDIGLGIMVWLNLIAILLLFKPAYIALKDYEEQLKQGKD
FT                   PEFNSSKYEIKNATFWENGYKKSEENQKKAL"
FT   gene            357625..357804
FT                   /locus_tag="GTNG_0316"
FT   CDS_pept        357625..357804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65698"
FT                   /db_xref="GOA:A4IK44"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK44"
FT                   /protein_id="ABO65698.1"
FT                   /translation="MNVTNVSISSVILFLFVVSVILFVYGFVRKRKAVKWMALCFFSAS
FT                   IGLAVFVILLMRYM"
FT   gene            complement(358300..359532)
FT                   /locus_tag="GTNG_0317"
FT   CDS_pept        complement(358300..359532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0317"
FT                   /product="Sodium:dicarboxylate symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65699"
FT                   /db_xref="GOA:A4IK45"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IK45"
FT                   /protein_id="ABO65699.1"
FT                   /translation="MKQLIAKWNRVSLVKRIIIGIIIGITLAVTVPESTKWISIFGSLF
FT                   VGALKAVAPVLVFFLVISAISRHQSGQKTNIQHILILYGFSTFLASLTAVVASFLFPVH
FT                   LSLTESAKEVSPPSNITEVIQSLLFNIVDNPVHALLNANYIGILTWAVLLGIALRTAPE
FT                   TTKNVIAHFSDAISQIVTWVINFAPIGIMGLVFDAIVTNGLSALIDYGKLLAVLLGTMC
FT                   FVAFVMNPLIVFLNIRQNPYPLVWRCIRESGVTAFFTRSSAANIPVNLRLSEMLGLNKN
FT                   TYSISIPLGATINMAGAAVTISVLTLAAVHTLEIEVDLGTALILSVLSAIAAAGASGVA
FT                   GGSLLLIPLACSLFGIPNDIAMQVVGVGFIIGVLQDSCETALNSSSDVLFTATAEYAKR
FT                   RKEGKQVAIKA"
FT   gene            359807..361198
FT                   /locus_tag="GTNG_0318"
FT   CDS_pept        359807..361198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0318"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65700"
FT                   /db_xref="GOA:A4IK46"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK46"
FT                   /protein_id="ABO65700.1"
FT                   /translation="MIDGAKQSFITDIEQLDKKGAGQAVVWQEEEGKRKKLKLTIPSTL
FT                   PGEKVRVLIDRPKRRKANARLEEVIEAHPERLEPPCPHFDRCGGCVWQHWQYEGQLRHK
FT                   TEHVKALLEQHGFDPNIVRETIGMEHPWHYRNKMEFTFSPEGLLGLHEQGNFRQIISLE
FT                   TCLIAGERIVKAAMEVARWARDHQLPGYHKDTHEGLLRHVMVRESFATGEVMVALFATE
FT                   APEGELKQAADDLTERITKALPEVKSLLWLENRAWADRIQAEQTHVLAGRDFIYDELCG
FT                   FRYRLWFDTFFQTNPVQAAKLVELALEMGKPQPHEKMIDLFCGVGTFSLPFAKRVKALA
FT                   GIEIVETSIESAKRNAKDNGIDNTYFLARDARRGIDEVLEQFGRPELLLLDPPRSGAGG
FT                   KVMRKIGRSQPERIVYVSCNPETFAADIAELVPFGYTLKTVQPVDMFPHTAHVELVALM
FT                   SRVDK"
FT   gene            361435..361845
FT                   /locus_tag="GTNG_0319"
FT   CDS_pept        361435..361845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0319"
FT                   /product="Phage tail-host specificity protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65701"
FT                   /db_xref="GOA:A4IK47"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK47"
FT                   /protein_id="ABO65701.1"
FT                   /translation="MKDIWNWIQIIVTALGGFMGGFLGGLDGFLYALIILVVADYITGI
FT                   MCAIVDKELSSEIGYRGIFKKVLIFILVGVGHMIDTHLIGDGSVLRTAVIFFYCSNKGI
FT                   SMLENASRLGLPIPEKLKNVLAQLHNKGGNES"
FT   gene            complement(362637..363419)
FT                   /locus_tag="GTNG_0320"
FT   CDS_pept        complement(362637..363419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0320"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65702"
FT                   /db_xref="GOA:A4IK48"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK48"
FT                   /protein_id="ABO65702.1"
FT                   /translation="MNFGEKLVKLRKEKGLSQEALAEKLNTTRQAISKWENGQGFPETE
FT                   KLLMIANIFEVSIDYLLKESAENNDDKEDGYYVSREMAEGFLLSSKKIANHVGIGFGLF
FT                   ALAFEPYFILGTTSLLGVLLIIIIATLGIISFATLGFDQGQYTVLKKEVLLFDSNYIKE
FT                   LRTRYEGFKRKHLGTTIVGGSLLAVGFLAFALEKKLEMGILVPYYPIFVFLIAVGLALS
FT                   VRTITIISAYQLLVKNNEHTNRLSFKLKQKIKKKFDEY"
FT   gene            complement(363593..364483)
FT                   /locus_tag="GTNG_0321"
FT   CDS_pept        complement(363593..364483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0321"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65703"
FT                   /db_xref="GOA:A4IJN7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJN7"
FT                   /protein_id="ABO65703.1"
FT                   /translation="MISNWNSEHAWTYEIDPILEALFRYIDSLSLPETPYVTGRPPVSK
FT                   KSLLKCFFLKTYFSIDSLRKLVRILQRFRCFQRACGLGEVPHLSTFSRAAKWFREQGFP
FT                   VFHAQLLKDLEVRYPQIVLIDSTALRSSLYDSQAKWGVSTRYHWFKGYKLHLCTTAEGI
FT                   ILSHVLTTANRNDAAVAPELLVSLKQWDIEFVLGDAAYDSEKVRQTAEQSGILFISPIN
FT                   RRNSEERKDAYGRVLPVFLKTRFGQWLFGLRREIERVFNELKSDGLEQPRWYGFHRYVL
FT                   HVLCCILMHNFEFLL"
FT   gene            complement(364797..365963)
FT                   /locus_tag="GTNG_0322"
FT   CDS_pept        complement(364797..365963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0322"
FT                   /product="Transposase (04)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65704"
FT                   /db_xref="GOA:A4IK50"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK50"
FT                   /protein_id="ABO65704.1"
FT                   /translation="MSKSIPNVDWTNQLESVIRQFVKEKLELIMREEIKNFLEIEQAGT
FT                   SNMRNGYYQRNLDTQYGRIEGLLVPRDRNGEFQTQLFAPYQRHTGWLEEAIIRMYQSGM
FT                   STREIGKFIERILGNAYSPATISRITDVVKEDIEKWHTRPLHKRYSVLYLDGLYVKLRR
FT                   ETVEKEAIYVVLGGNEEGYREILDFFVGGQESAYVWQEILQQLYNRGVKEVLLGVFDGL
FT                   PGLEEAFKAVYPKADVQRCVVHKVRNTLHRVRKKDQFEVAEDLKLIYRAPNKEMALQMF
FT                   QQFESKWSSKYPREVQSWANELDVLLTFMDDPSSIRSVIYTTNAIERTIKEIRKRLKPM
FT                   NSLNSLEAAEKIVYLTIQDFNEKWAGRKLRGFAEAHEALQRMFEERYH"
FT   gene            367085..367618
FT                   /locus_tag="GTNG_0323"
FT   CDS_pept        367085..367618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0323"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65705"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK51"
FT                   /protein_id="ABO65705.1"
FT                   /translation="MVGDRLTRFAHELANKFTLYFDVYRDEQISDFPLAFIAHYKRRDE
FT                   RYMVTKKIKVYGVENQQLVFATVANEPVSLPFVRRFRDVIDQHKHQFIQEHTEHMSTIV
FT                   LGLIIADGKLDEVVLKEVRKYRKVKFLKFGWHGWVEMYMAVLHPTQKTVHIHPKGRSFV
FT                   KSIETLMREDKISL"
FT   gene            367615..369231
FT                   /locus_tag="GTNG_0324"
FT   CDS_pept        367615..369231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0324"
FT                   /product="Carbon starvation-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65706"
FT                   /db_xref="GOA:A4IK52"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK52"
FT                   /protein_id="ABO65706.1"
FT                   /translation="MSAVTLLLISAIAFIVAYFTYGKYLDRKLGVDPNRPTPAVEMADG
FT                   KDYVSTNRPVLLGHHFATIAGGGPIVGPISAAVFGWIPAVLWIVLGSIFFGGVHDYASL
FT                   QASIRHKAQSIGTVIKEYIGKRGQTLFLSFSIATIILIVGVFIVLVADTFANVPAAATA
FT                   SILFIFVAMLFGFFVNQMRVNFVLASIIGVIVMFACVWIGIVFPIKMSATFWVFFLIIY
FT                   SYVASVLPVWLLLQPRDYLNSYLLYGMMLGGFIGILFANPTLQLAGFTGFYNENLGPLF
FT                   PILFITIACGAISGFHSLVASGTTAKQLDNERSGRFIAYGGMLIEGFLAVIVVCSVAYL
FT                   TTEQFTQRLAELGGPIPAFSAGLGYFMSHFGIPETVGTTFVALAASAFLMTTLDSATRL
FT                   GRYGVQEFAEGRSKTFANPHVATGVIVVGAAALALSGTWSDLWPLFGSANQMLGALALL
FT                   AVSVWLVKRGTKSWFAIIPMIFMFIVTLSALLVFMRTNFLSGNIFLVVCGFILFVLCIF
FT                   LVLEAYRSFTKPKDKDTTVKA"
FT   gene            369701..370561
FT                   /locus_tag="GTNG_0325"
FT   CDS_pept        369701..370561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65707"
FT                   /db_xref="InterPro:IPR025051"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK53"
FT                   /protein_id="ABO65707.1"
FT                   /translation="MLPAHDTCTVYHGTNLFAARVIRKIGIRLDVQRELTDFGKGFYVT
FT                   LNPQQAKNWAQIRAMHPQISPDLLAQLNMSQSQYFNHPEIKIPACLVYELNVSQLRQLN
FT                   GKEFSLPHEPGWERHQRSWERFVLDCRTGKRHHYDYVYGPVAKGHLTNIEKIKVSHTKD
FT                   QLSLNSMRAVTCLSALDIVAFKPEDIYMKAFLLKQLWNHIQNSENARNYRFLHEIRNEL
FT                   MMIGNLTSRQADKMLRQSLTSLPFSSIIMHEPAAYWAFSVLYGMRKLWYKEYEVYMKKK
FT                   HGARK"
FT   gene            complement(370611..371399)
FT                   /locus_tag="GTNG_0326"
FT   CDS_pept        complement(370611..371399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65708"
FT                   /db_xref="GOA:A4IK54"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK54"
FT                   /protein_id="ABO65708.1"
FT                   /translation="MKFIRPLERLKWIFTKKFNRNHAKIKSTKEMYSVKGYKYSPKRHA
FT                   MHMRIVHAIMKQAPSPPKTERPIAILIGGGTASGKTMMRKTVIEKQLAEEGVQAIIVDP
FT                   DDIKTYIPEYHSLQKTHPNDAARLVHQESRDISDLLLKQLIRHRKHFIYEGTMARTRAY
FT                   KQLMKKLKKAGYKVHIYIVDIPLELAKQRAKERAKMTGRKIPYQVIENTHKLVPRTFQA
FT                   IKDFADRYYVYDNQDKLVLIASNDYIEPVLYNNFLKKGKT"
FT   gene            371659..372459
FT                   /locus_tag="GTNG_0327"
FT   CDS_pept        371659..372459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65709"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK55"
FT                   /protein_id="ABO65709.1"
FT                   /translation="MNGNFCFSFSIRKWKVEQGGQYFLLLSSYNIVFNERGGWVMKKTS
FT                   VFGLLFLLLISGCVNESGDKVKLNQQIQEQAQLIDQLKQQNKELAKKAAEWQTMNEKKV
FT                   LSAALAIVEALKAKDMDRLAMYVHPDKGVRFSPYGHVDIANDVVFAKDELPSLMKSNRI
FT                   YRFGTFDGSGEPIMMTFSDYFQKFVYDVDFANPHMIGNNIVIGKGNTLENIHEVYPDGV
FT                   FVEFHFTGFDEQYDGMDWKSLRLVFEQDGGSWRLVGIVHDQWTT"
FT   gene            complement(372595..373356)
FT                   /locus_tag="GTNG_0328"
FT   CDS_pept        complement(372595..373356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0328"
FT                   /product="Sporulation-control protein Spo0M, putative"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65710"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK56"
FT                   /protein_id="ABO65710.1"
FT                   /translation="MFKKLLSSIGIGAATVDTKLAKAQYAQGETVEGVVEVRGGSVEQR
FT                   IDEIYLALVTTYIREIDDKKVEEKAVLARYRVSDSMTIQPNETKTIPFQFALPYDVPIT
FT                   LGSSKVWLQTGLDIKMALDPQDRDYLTIEPHPLVAAFLEAAHQLGFRLRHVQCEQAPRY
FT                   WQRRLPFVQEFEFRPTRGAFRGRLDELEAVFFVSEHGVETILEIDRKARGFAGLLAEAL
FT                   DMDETLVRFTYGPNDIASLPQLLANVIQRHS"
FT   gene            373523..373924
FT                   /locus_tag="GTNG_0329"
FT   CDS_pept        373523..373924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0329"
FT                   /product="Mutator mutT
FT                   protein/7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65711"
FT                   /db_xref="GOA:A4IK57"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK57"
FT                   /protein_id="ABO65711.1"
FT                   /translation="MKRVIHVVGAAICNEQGDVLCALRGPQMSLPNVWEFPGGKVEEGE
FT                   SSEAALVREIREELGCTISVGKLLADVFHKYEHAIVHLQTYEARLIDGEPRAREHAELR
FT                   WVPLSQLRTLAWAPADLPTVEALLAKSCS"
FT   gene            complement(374125..375366)
FT                   /gene="resE"
FT                   /locus_tag="GTNG_0330"
FT   CDS_pept        complement(374125..375366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="resE"
FT                   /locus_tag="GTNG_0330"
FT                   /product="Sensor protein ResE"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65712"
FT                   /db_xref="GOA:A4IK58"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK58"
FT                   /protein_id="ABO65712.1"
FT                   /translation="MSRDFMNPELRLSSGVLLSLMAFFFLVAFIMLKLHHEQLKSDYIA
FT                   VFGSIASRIVEEHPELEQDIVPFMTTEISREEEEKGKEILAQYGLTEQLNDELFPYVHT
FT                   AIQKNERAVVLLFLLMALSLFLLNYSQYRTLYSRIRQLALAAEKVVEGDFNIIMSETRE
FT                   GDFSKLAVAFNGMRNTIRNQLDELKKEKRFLADLLSDISHQLKTPLSSMIIYNEIMLGK
FT                   QLSEEQQRMFLLQNEKQLERMKWLIQSLLKLAKLDAKALQMDRQQQSLNETVWQSIDDL
FT                   REQAVEANVHIRFENSEEVEFNHDRLWLKEAFINIIKNSIEHTPPGGNIDITIVSHPLY
FT                   TRVVIADTGEGISQDDLPHIFKRFYKAKTSKKPDSIGIGLALAKSIIEAHGGMIEAKSE
FT                   LGKGTTFSITFLNY"
FT   gene            complement(375366..376070)
FT                   /locus_tag="GTNG_0331"
FT   CDS_pept        complement(375366..376070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0331"
FT                   /product="Transcriptional regulatory component of sensory
FT                   transduction system"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65713"
FT                   /db_xref="GOA:A4IK59"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK59"
FT                   /protein_id="ABO65713.1"
FT                   /translation="MSKLLLVEDDESLALGIEFALQDEGYEVCRASTLEEGKALFASQS
FT                   FDLIILDINLPDGSGYDLCKHIRATSDVPILFLTALDEEVNIILGLELGGDDYITKPFG
FT                   VGVFLSRIKALLRRSAGHRATGMILKSGTITVDPLAATVEKNGQKISLSAQEYKLLLTL
FT                   MDRPCTVMSRDEILRELAEGTEAFFDENTLAVYIRRLREKIEDDPKEPQYIVTQRGLGY
FT                   KWNKEVTREKIL"
FT   gene            complement(376186..378669)
FT                   /locus_tag="GTNG_0332"
FT   CDS_pept        complement(376186..378669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0332"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65714"
FT                   /db_xref="GOA:A4IK60"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK60"
FT                   /protein_id="ABO65714.1"
FT                   /translation="MRSYKQLTWKYLKASKKRTALTILGITLSISLISAIGLFLFWIQQ
FT                   AEIEETKQTKGAYHVMFTKLDSDTVNKVIHNPNVSRYGFFTIGETMSINEKVMVTEYIA
FT                   TNRALELLPTHVKKGRLPKNETEAALEEWLLKQIDPQATVGSRITLQHKQYTVSGILGN
FT                   DVENQISNKGILLSKTNKIDETKASLLVEISEKADLEKTVNELKKLSDDRYVQLNTKLL
FT                   ILQGAGGDNEQAIGLYAAVAIIIGIVVISTIAIIYNSFQIGIVERIKQFGLLRAIGATP
FT                   KQIRAVVIREATFLSLIGIPLGLLCGLVAIYGIFFASKLIANEALFATPPIISRNILLL
FT                   SAAIGLTSIYFSAWLPARFAGSISPLAAISSRALIVKERIKKRKNRWISKWLGFEGMLA
FT                   AKNMKRDRKRYRITVFSITISVMLFIVFKSFMDMAFTISEHPNESRNIHFSIVKDTPEA
FT                   KGTAASISAALRALPTVDKVYEAYESHDFYAIIDKESELKAVQPFEGIYQPIDWPDGEK
FT                   IMVEATINIYDSESLKAARRYLEAGNIDEQQLTKENAVIVIKNNEFYNDKTKKFYNGPI
FT                   AHLQPGDEIYLEKDVGQRAPVSYKDAMQKVKVAAVVEDDPFHFRSSNPSRLKLITTKTV
FT                   AERLLSQQKLQPVQWNIKLKTAESEKEAEKQIEAVIRPYPSVMLINHIDTNRKAKSSIL
FT                   MLQILVYGFIIVVSFIGSVNIINTLTTNILLRKRELASLQAIGLTNKGLKKMIVLEGVM
FT                   YGTMGTLYGSIIGCGLSYLMYMFFIDVKQFSWQPPWTAMLIAGAAAVVIAYLSVLPPLA
FT                   RMKKEHLIEAIREEY"
FT   gene            complement(378701..379387)
FT                   /locus_tag="GTNG_0333"
FT   CDS_pept        complement(378701..379387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0333"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65715"
FT                   /db_xref="GOA:A4IK61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK61"
FT                   /protein_id="ABO65715.1"
FT                   /translation="MELLRVERLYKAYGTGENKVEALKYVNLSVEKGEFVAIVGASGSG
FT                   KSTLLHLIGGLDRPTSGNVFIDGENIYDYNEEKLAIFRRRKIGFIFQFFNLIPVLTVEE
FT                   NISLPALIDHDKVDKAYLNELIDILGLSNRRNHLPSELSGGQQQRVAIGRALLNKPSII
FT                   LADEPTGNLDSKHSKDIIELLKFTAKKYNQTILLITHDIQIAEMADRIVTIQDGEIISD
FT                   QYLQRS"
FT   gene            complement(379831..381000)
FT                   /locus_tag="GTNG_0334"
FT   CDS_pept        complement(379831..381000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0334"
FT                   /product="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65716"
FT                   /db_xref="GOA:A4IK62"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK62"
FT                   /protein_id="ABO65716.1"
FT                   /translation="MISSSFYYRVGIAGAGAFAEFLAGALAPLPSFHLAAVAGRTDAKR
FT                   RRVLDAYLRRKPKSDDVREYREAEELIADPHVDIVILTTPPHLHAPLAKQALEKGKHVL
FT                   LEKPGALAAEKLHANMELANRRQRALAVNLVLRYHPLVEAVKQLIHHALLGTVDYASLH
FT                   NAAHRVAQGHWFWDERQSGGIFIEHGVHFFEVGRHWFGEAAEARGFALTNTDGTRPRVG
FT                   ATVIHEQGGRHIPVHYYHGFTMDPAAPESTHWDIHTTRGRITLDGWIPMQLSVSGLVSA
FT                   DEAACIDNLLDAIPKQPSASAIEQIGQAANRLLSSTAPSDAPRILYERTVALSDRHGWY
FT                   EASAQARFLDFCRLIENPNERGLVTMEDAIADIALAESCTVAEKLSPAR"
FT   gene            381290..382333
FT                   /gene="manC"
FT                   /locus_tag="GTNG_0335"
FT   CDS_pept        381290..382333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manC"
FT                   /locus_tag="GTNG_0335"
FT                   /product="Nucleoside-diphosphate-sugar pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65717"
FT                   /db_xref="GOA:A4IK63"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK63"
FT                   /protein_id="ABO65717.1"
FT                   /translation="MKALLLAGGLGTRLRPLTENIPKPMAPIANRPWLEHLIIHLRDQG
FT                   VNEFVIAAHHCSEVIRRYFGDGKSWNVNITYALEPFPLGTAGAIKNAERWLDERFLVFN
FT                   ADIVHLPQLIPLLDFHRQHGGIATIVLTEVDDPSSYGVVEQDDQGQILRFIEKPRREEA
FT                   PSNRINAGMYILEPDVMRYIPAEQEVSIERETFPRLIEENTGVYGIVSSGYWRDMGTPA
FT                   RYRQVHWDALNREFPLPIKGREIQPGVFVGENVKISSGVLFVPPVLIGHNVKIGHQAVI
FT                   GPYAVIGDDCQIGSRVHCAHTIVWDRSLIRDRSRLQNSIFGYRTVTPAGEVFEDSIINQ
FT                   FKEAVQA"
FT   gene            382330..383520
FT                   /locus_tag="GTNG_0336"
FT   CDS_pept        382330..383520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0336"
FT                   /product="Glycosyltransferase (group I)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65718"
FT                   /db_xref="GOA:A4IK64"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK64"
FT                   /protein_id="ABO65718.1"
FT                   /translation="MTRIAYVSTYPPRRCGLATFTEHLRQSIDSVRGKVEGDRVIVLYN
FT                   EIDGDDAYRGNPAYWPLPAQNRAAYEKMARRVNESDIDVVVLQHEFGIFGGEAGEYILD
FT                   FIAALQKPLITTFHTVFAAPEPPYRPIQEKIAAASDAIIVMNRQAIGYLVKAFGLPEEK
FT                   IVYIPHGAPGPSSEERQSLRSRLGFHGRKVMFTFGLLSRGKGIESVLTALPGVVRKVPE
FT                   TLYVIAGQTHPEVKKREGEAYREELKALIHRLGLDDHVRMEDRYFSEEELIDYLTACDL
FT                   YVTPYPGMQQITSGTLAYAVGVGRPVVSTPYEHARDLLQGCEELLLPYGNTSVWEERLV
FT                   QLLADEAALERWERIVRQIGANTHWPRVGEQHIALFERVCTAANSGEVKAVDFVSH"
FT   gene            383540..384616
FT                   /locus_tag="GTNG_0337"
FT   CDS_pept        383540..384616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0337"
FT                   /product="Glycosyltransferase (group I)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65719"
FT                   /db_xref="GOA:A4IK65"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK65"
FT                   /protein_id="ABO65719.1"
FT                   /translation="MTDDTGLLEHSLGRIPRRREGYSTDDNARAIWACLEWLALLKNRE
FT                   MEKRLYRLLDRYLAFLLWAQNDDGTFHNNFFFDRTKEEETPSDDCLGRSFWAVASAYIQ
FT                   LNDPARCEAAADMLRRGMPAAWKLHSLRGIAWGLAACGLLLEKASPPGVDKEELATLAG
FT                   RFERRLLEAYWTHTDDGWRWYEPELTYGNGVLPWALWTAYRRAPRQEVREVAEESLAFL
FT                   IEMMSGPEGTIRPVGNRGWCSRRYRADWDQQPIDVMKLALAAREAYWATEDERYRDVVR
FT                   RCLAWFYGKNDGNVPLADRSDGSCCDGLGPNGPNPNRGAESTLSYLLTAAIAQSISVEV
FT                   VFDEYVDNETVRMANTRI"
FT   gene            384567..385976
FT                   /gene="manB"
FT                   /locus_tag="GTNG_0338"
FT   CDS_pept        384567..385976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manB"
FT                   /locus_tag="GTNG_0338"
FT                   /product="Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65720"
FT                   /db_xref="GOA:A4IK66"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK66"
FT                   /protein_id="ABO65720.1"
FT                   /translation="MNTSITKPFAWPTHVFKEYDIRGRAGEELDESFAYWLGRAFAEMM
FT                   QNEGERKAVVAHDNRLSSPALHRSLKNGLLDGGCDVIDIGLSTTPMFYYSLYNTDISCG
FT                   MIVTASHNPGDENGFKIAMGKTTIYGERIQALRKAMERLSQQQAQPEVTRGREETLDLV
FT                   PAYIKMLKEKIQLGPRQLKVVVDCGNGTPSIIAPKVLKEWGCDVIPLYCESDPTFPNHH
FT                   PDPVVPENLADLIKTVRKEQADLGIAFDGDGDRIGIVDETGTIRWGDQLMVLFWRDILK
FT                   RHPGAEAPVEVKCSQALVEEIERLGGRPFFHRTGHSHVKATLRRRPAIPFAGEMSGHLF
FT                   FNDEFYGYDDALYAAGRLLRLLSHDKRPLSEWFADVPYYVATPETRVTCPEEKKPVAID
FT                   AVKKRFASRYPVVDVDGARIQFREGWGLVRPSNTQPILVLRAEAKTEEALAEIKRQLAD
FT                   CLHTLELHVNW"
FT   gene            386238..387833
FT                   /locus_tag="GTNG_0339"
FT   CDS_pept        386238..387833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0339"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65721"
FT                   /db_xref="GOA:A4IK67"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR018771"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK67"
FT                   /protein_id="ABO65721.1"
FT                   /translation="MIIVDYDGNPVTKVSNMTELAELVLFVEKKGVASFFCPRELAIDG
FT                   RQRPTVVPAGHFGLKSIIAPVLVDGRAEYWVWAGVFVEEETKELIGDNAQKWTAAIKQA
FT                   DALPVGAVEAKLNEIEKMAAICGELISSERRKQKYHEYGQLLKTAVTDHSAVNRMDKLL
FT                   HELRKMDECLDMALYIEKRQQGWVVAATNGEKAARLYGKMIDELFPPLSFPEMSLCPSY
FT                   FQNVALDPRFSFFVRHGIRPKAMIIYPAIYEQKVEGWVIVGSETASSLPAAMKPLGAAL
FT                   VQYEHLLVKCAAADMKMNRHFMRLTMLMEIGRAMHVVQNDEEIVRMMTQFALELAYGDF
FT                   VCTILYVNGKAVTVHEGAISAEMASCYQEDVLRHYGRSIKQVAKSQVPSLRQVGDKTVM
FT                   EVPFFVRDGYYGVLAVHLKETDEAKEAEVYVTALVAVGVMMMNSAAQDGSGQTVNVQML
FT                   SEQLTSREMDVLELLVQGCSNREISERLFISVHTVKNHITNIFQKIGVNDRSQLIALVY
FT                   QLSHRRHEGSIIGR"
FT   gene            388106..388513
FT                   /locus_tag="GTNG_0340"
FT   CDS_pept        388106..388513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0340"
FT                   /product="Putative sigma-B regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65722"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK68"
FT                   /protein_id="ABO65722.1"
FT                   /translation="MPMKHMIMIRTMTIMKTVDILKAMDITEQLANEIGFLPRDCLFLR
FT                   LATEEACTNAYEYCQKTGRLPFRIFWKIDTSQFTIIVKQRGGCFSVAKTDNVNTGARGR
FT                   GLQLIAHIVDEVFVKRTGNNVLLCMCKCKKK"
FT   gene            388536..388868
FT                   /locus_tag="GTNG_0341"
FT   CDS_pept        388536..388868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0341"
FT                   /product="Probable anti-sigma factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65723"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK69"
FT                   /protein_id="ABO65723.1"
FT                   /translation="METRQGAIRTLTWTEDITLNNVESFRQALEQLLAERADQLIVNME
FT                   AVNYINSAGLGMIADSVMAARAQQKELVVAGVKGSLAEIFRIVKFYSFMKLFATEKEAI
FT                   DYLSGE"
FT   gene            388875..390398
FT                   /locus_tag="GTNG_0342"
FT   CDS_pept        388875..390398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0342"
FT                   /product="sigma factor sigB regulation protein RsbU-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65724"
FT                   /db_xref="GOA:A4IK70"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK70"
FT                   /protein_id="ABO65724.1"
FT                   /translation="MIDEFLEYLRHHKNFTWRELFDRLEKMNMLFGSNDYVYWLAAPDK
FT                   RKILFISSSCEQLYGLPPAAFYHDEDIWMKISYPDDHAKAEAKWALPWESKVSTQTYRI
FT                   VNQRDGSVRWVLERMVPVLSEAEEGNLISGFVMDITETKRNRDEIRLAEQVYASIEQAM
FT                   LVTDDEFAVRFVNSAFTKITGHSTEVVGQPLHTLYAGYYAAWFYEVIKNGIVESGQWQG
FT                   RVRWRRKNGSVSVRRTTVRAVHNQEGNISFYLFLFSGLHETPYAEAMKDDLKLAREVQK
FT                   RVLSKPLSANGIDIAGTYIPSQELGGDMYAWYQIDNQRYGIFLMDVMGHGAAASLICMS
FT                   VRSLLNGIIRKAIVPQAVFYELNRHMRQLYHENGQMTYYFTAVYVLVDVKKRMIEYASA
FT                   GHPPGFLFQPDGTVFELDRGCAPIGLLPGLFVDSGQLRYESGATLVLYSDGAIEGEAGS
FT                   VRQNIETFRDTLAPYVSLDERALLACLRRHFIQKGSLRDDFSAVVAKLR"
FT   gene            complement(390501..391232)
FT                   /locus_tag="GTNG_0343"
FT   CDS_pept        complement(390501..391232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0343"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65725"
FT                   /db_xref="GOA:A4IK71"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK71"
FT                   /protein_id="ABO65725.1"
FT                   /translation="MWELIFVFAILFVGSLIQGASGFGFGLFSMGLLPMVLTFKNSTLL
FT                   VLALTLIISFHVAVKFRKHIRGKDLLSILSFALAGRILSFFILTFYGETEIMRKLLGLV
FT                   LIGMVIYLYMSEKNAYAPSFKKPIFPMLIGLIGGIIGGIFAVGGPFFVFYFLMRYKEKE
FT                   SYNANLQASFVIMNSFTIVLHGIHGDFTDSFVLYFLLGAVAVLAGVHIGLKWFERLPHT
FT                   RIKTLASFIVFAAGVNLLAFS"
FT   gene            391517..391930
FT                   /locus_tag="GTNG_0344"
FT   CDS_pept        391517..391930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0344"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65726"
FT                   /db_xref="GOA:A4IK72"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK72"
FT                   /protein_id="ABO65726.1"
FT                   /translation="MAVTNPAGFWRRLLANLLDAIVIGIPISIIGYLITGSAEENWFTN
FT                   LVELLYALIVPAVWYGYTVGKRMIGIRIAKVNGGKVGIGTMFLRLFVGGLVYVITLGIG
FT                   LIVSAIMVAAREDKRSIHDFIAGTYVTTEKPTV"
FT   gene            392268..393512
FT                   /locus_tag="GTNG_0345"
FT   CDS_pept        392268..393512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0345"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65727"
FT                   /db_xref="GOA:A4IK73"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK73"
FT                   /protein_id="ABO65727.1"
FT                   /translation="MSYIIRTMFVVIPSTAVIGLAICLANSIRGAAFWWTLAATLLLGA
FT                   IVGFISATLNYRRFVAPIAVINKYLSKMTSGDLTVRVPLNSVRQLRPIATSLNNMADAW
FT                   QEVIGRIQHHADEVSQFSNQLATVAEQTTRATEQIAATMDGLASHAEEQASAARGTAES
FT                   VNDISRTLSDVARQTKEVAHSAQETATKAGDGKQSVMQMSEQMQFIYDHVQSLGQVVKG
FT                   LGERSNEIGQITEAITSIASQTNLLALNAAIEAARAGEQGKGFAVVADEVRKLAEQSVH
FT                   SAQQISDLISYIQEETKQAIASTERVVAEVAQGLDVVAVAGQSFADIREAVGQVSEQIG
FT                   QVSSAIEQMTGHARQVDEAFQQMTKIVEQSAASAANVSAATQEQMASVEEIASSSASLG
FT                   QMADEMRTMLKQFSV"
FT   gene            393917..395608
FT                   /gene="thiC"
FT                   /locus_tag="GTNG_0346"
FT   CDS_pept        393917..395608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="GTNG_0346"
FT                   /product="Thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65728"
FT                   /db_xref="GOA:A4IK74"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IK74"
FT                   /protein_id="ABO65728.1"
FT                   /translation="MENIRSFMSFPASRKVYVEGSRPDVRVPMREIALSPTKTPQGEVE
FT                   NKPVRVYDTTGPYTDPDFEPNVEKGLPLLRRNWIVERGDVEETEPQSTAGRAASLPFAR
FT                   RPLRAKPGKVVTQMHYAKKGIITPEMEFVAIREQIDPEIVRQEVAAGRAIIPSNINHPE
FT                   SEPMIIGRRFHVKINANIGNSAVSSSIENEVEKLLWAVRWGADTVMDLSTGKQIHETRE
FT                   YIIRNSPVPIGTVPIYQALEKVGGVPEKLTWDVYRETLIEQAEQGVDYMTIHAGVRLHY
FT                   IPLTVNRTTGIVSRGGSIIAQWCLAHHEENFLYTHFEEICEILKQYDVAISLGDGLRPG
FT                   SIADANDEAQFAELETLGELTKIAWEHDVQVMIEGPGHIPMQKIRENVEREQELCHGAP
FT                   FYTLGPLVTDIAPGYDHITSAIGAAIIGAYGTSMLCYVTPKEHLGLPNKEDVRVGVVTY
FT                   KIAAHAADLAKGHPAAQQRDDALSKARFEFRWNDQFNLSLDPERAREYHDETLPAEAAK
FT                   TAHFCSMCGPKFCSMNISHELQRKIKEEGMKEKANEFVRGGSSLYR"
FT   gene            395951..397126
FT                   /locus_tag="GTNG_0347"
FT   CDS_pept        395951..397126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0347"
FT                   /product="Aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65729"
FT                   /db_xref="GOA:A4IK75"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK75"
FT                   /protein_id="ABO65729.1"
FT                   /translation="MKMASDLVRRMPPYLFSDFERKKVELAKKGVDVIDLGIGAPDLPP
FT                   PSFLIETLKRELDDPRNYTYSPYAGCREYREAVADFYERQYGVKLDPDTEVLALIGSKE
FT                   GIVHLLQALIDPGDAVLVPNPGYPVYRTAIHLARGTPIDLPLDAARDYAPQFSAITPST
FT                   YDRVNIMLLNYPSNPTASLATIDVFIEAVMLAKKHRFLIAHDSAYSLLTFGDAFAPSVL
FT                   QVDGAKEVAIEFGSLSKSYNMAGCRIGYIVGNKEVIRALSILKSNIDTCQFLAVQKAAA
FT                   VALRSGDEAAKENSRIYEERMKAMTVALWQIGVPVQPPRATFFLWVPTAVGYSSAQFAA
FT                   RLLDEAGVIVTPGTAFGSAGEGYVRISLAAPKERLLEAVRRWKAIEWEGRP"
FT   gene            397108..398763
FT                   /locus_tag="GTNG_0348"
FT   CDS_pept        397108..398763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0348"
FT                   /product="acetolactate synthase large subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65730"
FT                   /db_xref="GOA:A4IK76"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK76"
FT                   /protein_id="ABO65730.1"
FT                   /translation="MGGTAMKKRVMRGLSVPQAIVECLKQERISHLFGVPGESYLPLLD
FT                   ALYDEPTLQFISARHEGGAAFMAEAYAKASGKPGVVLATRGVGASNLAIGVHTARQDST
FT                   PLVVLLGQVHRRFRGREGFQEVELDEWFRPLAKWAVEITDPERVPELVQRAFRVAKTGR
FT                   PGPVVVSIPEDVFASTVAEAVLMTMDVPRPAPADDEVKRIEAALAAARRPLIVAGGGVK
FT                   RGRAEQALRRVAEQYSLPVVAAFRRHDVFPHDHPLYVGHLGLGAPAAVVETAKQADVIL
FT                   AVGTRLAEVTTQDYTWPLPHQMLIHIDIDEEALGKVFSADIAVAADAHEALCALLGRHI
FT                   VPTWNEWVLERRQAYEETARLPQPPRNVQEAIIAQLQAQLPDDGMITNDAGNFAGWLHT
FT                   FFSFKEQHMYIGPTSGAMGYGLPAAIGAKLAHPERPAVSLSGDGGFLMTAAELETASRY
FT                   GVPVISLVFNNRMYGTIRMYQELQFPGRVVGSGLGEVSFARLARALGANGVTVETADEF
FT                   AAAFKQALTATKPTVIEVMTEPEQLSVTMRLSDR"
FT   gene            398898..400379
FT                   /locus_tag="GTNG_0349"
FT   CDS_pept        398898..400379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0349"
FT                   /product="Probable aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65731"
FT                   /db_xref="GOA:A4IK77"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK77"
FT                   /protein_id="ABO65731.1"
FT                   /translation="MKALNFINGKWQPALSGQWAPVINPANGETIGEVALSAAADVDAA
FT                   VKAAKAAQKKWALVPAPKRADVLYKVGLLLKERKEQLARLLTMEMGKVIEEARGEVQEG
FT                   IDMAFYMAGEGRRLFGDTTPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPAI
FT                   VAGNAVVWKPALETPFMARELAAIFTEAGLPDGVFNVVHGDGPTAGNALVEHPDVPVIS
FT                   FTGSNEVGRQIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIVWSAFGTSGQRC
FT                   TACSRVIVHERVKQELEWRLLEAVKTLKIGDGLDETVKVGPVIHEEALQKIERYVHIGR
FT                   EEGAKLLVGGHILSDGDYARGFYYAPTIFTDVTPDMRIAREEIFGPVVSIISVRSLDEA
FT                   IAVNNCVDYGLSSAIFTRDVNNVFRAMRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNG
FT                   HRDSGVAALDVFTEWRSIYVDFSGKLQRAQIDTDD"
FT   gene            400531..401691
FT                   /locus_tag="GTNG_0350"
FT   CDS_pept        400531..401691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0350"
FT                   /product="L-lysine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65732"
FT                   /db_xref="GOA:A4IK78"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK78"
FT                   /protein_id="ABO65732.1"
FT                   /translation="MVKVLVLGAGLMGKEAARDLVQSEDVEAVTLADVDLAKAEQTVRH
FT                   LQSEKLVALRVDAGDQQQLSTLMKGHDVVVNALFYRFNETVAKTAIATGVHSVDLGGHI
FT                   GHITDRVLELHDQAQKAGVTIIPDLGVAPGMINILSGYGANQLDEVESIQLYVGGIPVQ
FT                   PEPPLEYNHVFSLEGLLDHYTDPSLIIRDGKKQEVPSLSEVEPIYFERFGPLEAFHTSG
FT                   GTSTLSRSFPNLKRLEYKTIRYRGHAEKFKLLVDLNLTRNDVEVEVGGHKVKPRDVLLA
FT                   VLTPMLDLRGKDDVVLLRVIVGGRKDGKETVFEYETITFNDSERKVTAMARTTAYTISV
FT                   VAQLIGRGLITKRGVYPPEQIVPGNVYIDEMKKRGVVINEKKTVRL"
FT   gene            complement(401803..402960)
FT                   /locus_tag="GTNG_0351"
FT   CDS_pept        complement(401803..402960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0351"
FT                   /product="Multidrug resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65733"
FT                   /db_xref="GOA:A4IK79"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK79"
FT                   /protein_id="ABO65733.1"
FT                   /translation="MEERKQTRARWITVAAAFLAFMGIGVVDPILPVIAESIGATHWQV
FT                   EMLFTAYIFTMAVMMIPVGLVVSRVGDKQMMVIGLGLVTIFSLLCGFAADIPQLSIFRA
FT                   GWGLGNATFFATAMTLLIALTPQASTAVGLYEAAIGLGMAGGPLIGGLLGQHSWRYPFI
FT                   GTSVLIFIAFLLVAFFVYDPNKGKPKKAVGWQEMRHLLAFPPFLKGAIGGMLYYYGFFV
FT                   VLAYSPLVIKLSAIQIGLVFFGWGLCLAYGSAALAHRLETKYEPKQILPYSLLLFAVLL
FT                   LLLAVAEQTWFMIVLIILSGLVSGLNNALFTGYVMETSPYERGVTSGMYNFVRWMGAAI
FT                   APVLSGVIGHAVSAKAPFMIAMALSLVAFLFLAWRKREPSATKTV"
FT   gene            complement(402960..403388)
FT                   /locus_tag="GTNG_0352"
FT   CDS_pept        complement(402960..403388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0352"
FT                   /product="Transcriptional regulator MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65734"
FT                   /db_xref="GOA:A4IK80"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK80"
FT                   /protein_id="ABO65734.1"
FT                   /translation="MERLKIDDVAKATGLTKRAIRYYEEIGLIKPPARSEGGTRLYTQE
FT                   DIEQLKNIVAAREVLGFSLQELQHFLTLKEKIETHRAEYRQAIVSSEQQRELEQMAAGL
FT                   HQQIAMLDDKMKKMATLKQELKQMAEQIDAILEERREE"
FT   gene            complement(403524..404030)
FT                   /locus_tag="GTNG_0353"
FT   CDS_pept        complement(403524..404030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0353"
FT                   /product="Xanthine dehydrogenase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65735"
FT                   /db_xref="GOA:A4IK81"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK81"
FT                   /protein_id="ABO65735.1"
FT                   /translation="MEETTKCELVLHINGEQRTVITRQAETLLFVLRDELGLTGTKPGC
FT                   LNGDCGACTVLVNGTPIKSCMMLAIETVGKEITTIEGLRDTPIQHAFVRHFAFQCGYCT
FT                   PGFIMNIHALIEQHPNADQSTIQEWLQSNICRCTSYQEIEAAVKEALQAKKTDIQPSHN
FT                   RISRV"
FT   gene            complement(404052..404888)
FT                   /locus_tag="GTNG_0354"
FT   CDS_pept        complement(404052..404888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0354"
FT                   /product="Xanthine dehydrogenase FAD-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65736"
FT                   /db_xref="GOA:A4IK82"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK82"
FT                   /protein_id="ABO65736.1"
FT                   /translation="MVPFEFAYYRPQSIAEAVAMFIELEQKGKRPLYYGGGTEIITLSR
FT                   LGLVSTAAVIDMKAIPECRVLDADSDPLVLGAALSLTELVEANPFPLLTKAAKEVADRT
FT                   ARNQITLGGNLCGQIFYRETALALLVAEADIVIAGPNGVRQSRINDLFHQHLQLSRGEF
FT                   VVQIKVRRFAVELPHFHHKRRKQGEIGYPLVTIAALKKDETIHAAFSGVCPFPFRSAKV
FT                   EAHLNDRRRPATERIQAAVNAFPRPILHDIEGSADYRLFVAAQLLEDALRELGETI"
FT   gene            complement(404875..407202)
FT                   /locus_tag="GTNG_0355"
FT   CDS_pept        complement(404875..407202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0355"
FT                   /product="Xanthine dehydrogenase molybdopterin-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65737"
FT                   /db_xref="GOA:A4IK83"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK83"
FT                   /protein_id="ABO65737.1"
FT                   /translation="MAVGKSIIRKEAWDKVTGRAKYTNDFKEQGMLHAKLVTSPYAHAR
FT                   IISIETHEALAAPGVRAVLTGKGLPLTGEDMRDRPPIAADKVRYYGEVVAVVVADTLVQ
FT                   AEQAARLIRVVYEPLPAVGSPREALKEGAPLLHEELDRYERNKTTYPEPGTNIAHRTKI
FT                   RKGDIKQGFAESDVIIETSVSFAPSDHVAMETRCATAEIWPDGSIHISASSQSPFMIKR
FT                   LIHTYFGEEAGKIVVHTPLVGGAYGGKAPVQLELLAYLATKAVGGRKVSVWNNRECDMV
FT                   TSPVHIGLEATVKIGATKDGVFKAMEIVFLFDGGAYSDKAIDVSRAAAVDCTGPYHVEH
FT                   VWCDSLCVYTNRPYATPFRSFGHCEQSFAVERAIDELAKVLQLDPWDVRRKNAIRPGHT
FT                   TPTQVRLTKSNVGDMPACLDRLRELMRWDEWQRIELDAYTVRAKGISGGWKTSTIDTDS
FT                   SSGVILTFNSDGSVNVISGVVEIGTGTKTVLAQIVAERLKMNVDDVHVKMDIDTQTTPE
FT                   HWKTVASRGTFMAGRAALAAADDAIRQLKEIAACVLRVTPDDLEVGFGRVFLRDDPAIF
FT                   IPVKDIAYGYKFPNGNAIGGQVIGRGHYILRRLTPLDPETGAGKPGPEWGVCAEGVEVE
FT                   FNRRDYTYRIVKAYAVIDAGKVLNPKAALGQAMGAMSMGLSFASREGFLFDEAQRVLNP
FT                   QLRTYRPIHFGEHPTYIVEFIETPQIDAPYGARGIGEHGLLGMPAALANALSLAAGVPL
FT                   NELPLVPELIWRKQKGDSYGSL"
FT   gene            complement(407189..407827)
FT                   /locus_tag="GTNG_0356"
FT   CDS_pept        complement(407189..407827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0356"
FT                   /product="Xanthine dehydrogenase (molybdopterin-guanine
FT                   dinucleotide biosynthesis subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65738"
FT                   /db_xref="InterPro:IPR017615"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK84"
FT                   /protein_id="ABO65738.1"
FT                   /translation="MSELTIAGIYLAAGQSRRMGTDKRALPWGDGTLGTAGLKAALHSC
FT                   LSPIIVVVPPTDALVWLPDALLNHDKCRLVRCAACHRGQAHSLACGLQETIVVGADAAA
FT                   VLLADQPFVTTETIDALARFYRQHHPDYAAFSRFGTPMPPVIWGKQMFPALLALRGDAG
FT                   GRRLFCEPHWRGLLYEGDESIGMDIDTKEDYERAVIYREVKEGHSRGRR"
FT   gene            complement(407824..408852)
FT                   /locus_tag="GTNG_0357"
FT   CDS_pept        complement(407824..408852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0357"
FT                   /product="Xanthine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65739"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK85"
FT                   /protein_id="ABO65739.1"
FT                   /translation="MESYYAVLDAMAAAPGDGVFAIIIDVEGSAYQKEGTWMWIEASGK
FT                   TTGLLSGGCFEEAVAAHALDVLSNRQATSISFDLRAEDDWSWGQGAGCNGLVRIWLEPV
FT                   TSNTKPDWLALKRCLDRGEHVFMARSITDPREQPFFQSETGERFGGYSSPPRPEWLKEL
FT                   HGTPFFRGRNGVYETEEDTFFIQHFWPKPRLTIFGAGPDAPPLVSAAKAAGFSVTVSDW
FT                   RPAFCQPSHVPDADAWVVGFPHETIPKLHLTERDFVVIMTHQFERDRELMRWLADIPLA
FT                   YLGVLGPRRRTDRLFPSGTAPPFVRSPIGLPIGARSPHEIAISITAELINVLRGGPMET
FT                   AR"
FT   gene            complement(408914..409369)
FT                   /locus_tag="GTNG_0358"
FT   CDS_pept        complement(408914..409369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65740"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK86"
FT                   /protein_id="ABO65740.1"
FT                   /translation="MPPFRAETNVLLSHLPVYAATTAAPPHFCRTVPPAIHRTSRYKRS
FT                   SPPIISPSYGDTTQRHKQICARREQQIGGFHFATFARTAAASSRQKAITSLSLRAMAPI
FT                   SPTAVRLISKGENQWWANNNLEQLTRLLIRTRSETLVPKTATITNVY"
FT   gene            complement(409466..409642)
FT                   /locus_tag="GTNG_0359"
FT   CDS_pept        complement(409466..409642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0359"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65741"
FT                   /db_xref="GOA:A4IK87"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK87"
FT                   /protein_id="ABO65741.1"
FT                   /translation="MTKKKQFPLRIDHDLYAVLEQWAQDEFRSVNSHIEFLLREAAKRA
FT                   GRLGKKKTDQQRS"
FT   gene            complement(409658..410503)
FT                   /locus_tag="GTNG_0360"
FT   CDS_pept        complement(409658..410503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0360"
FT                   /product="Somatin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65742"
FT                   /db_xref="GOA:A4IK88"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK88"
FT                   /protein_id="ABO65742.1"
FT                   /translation="MREQKAWYINGFIGIGGIVLLLIVGFFFLVQELFLPAILFFIIAV
FT                   LLATGITIVHPNQAKVLTFFGRYFGTIRDSGLFLTVPLTVRKNVSLRVRNFTSSKLKVN
FT                   DIQGNPIEIAAVVVFRVIDSAKAVFDVDDYEQFVEIQSEAAIRHVATKYPYDTFEDDSE
FT                   VTLRGNADVISDVLAAELQECLRVAGVEVVEARLTHLAYSPEIAGAMLQPQQAAPILAA
FT                   RKKIVQGAVSMAQMAIEQLDKENILELDDERKAAMVNNLMVAIVSERATQPVINTGSLY
FT                   "
FT   gene            410832..411281
FT                   /locus_tag="GTNG_0361"
FT   CDS_pept        410832..411281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0361"
FT                   /product="Hut operon positive regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65743"
FT                   /db_xref="GOA:A4IK89"
FT                   /db_xref="InterPro:IPR015111"
FT                   /db_xref="InterPro:IPR023552"
FT                   /db_xref="InterPro:IPR036482"
FT                   /db_xref="PDB:4OK9"
FT                   /db_xref="PDB:4OKQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IK89"
FT                   /protein_id="ABO65743.1"
FT                   /translation="MGKEKSVRIGRQALLLAMLDEGEEGAILDELRASNWRYCQGRVGA
FT                   MEPQKIVAAIETAAKRHEVVDGSLYRDMHALYHAILEAVHGVTRGQVELGDLLRTAGLR
FT                   FAVVRGTPYEQPKEGEWIAVALYGTIGAPVRGLEHEAVGLGINHI"
FT   gene            411431..412945
FT                   /locus_tag="GTNG_0362"
FT   CDS_pept        411431..412945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0362"
FT                   /product="Histidase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65744"
FT                   /db_xref="GOA:A4IK90"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IK90"
FT                   /protein_id="ABO65744.1"
FT                   /translation="MIVLTGHSLTIAEARRVIYDREPVAAALESMEAVRKSRAAVEQAI
FT                   ASGRTIYGVNTGFGKLADVRIDGSDLEQLQINLLRSHACAVGEPFAEEVVRAMLLLRAN
FT                   ALLKGYSGIRPVVIERLLAFLNSGIHPIVPQQGSLGASGDLAPLAHLALALVGEGEVMY
FT                   QGQRMPAIQALSQAGIPPLSLKEKEGLALINGTQAMTAMGVIAYLEAEQLAYDSEWIAA
FT                   LTIEALYGVIDAFDARIHEARGFLEQAEVAERLRRYLDGSQLITRQGERRVQDAYSIRC
FT                   IPQVHGASLRALRYVKETLEIEMNAATDNPLIFADGAVLSGGNFHGQPVAIAMDLLKIA
FT                   VAELANMSERRIERLVNPQLSEGLPPFLSPEPGLQSGAMIMQYVAASLVSENKTLAHPA
FT                   SVDSIPSSANQEDHVSMGTTAARHAYLIVQNVRKVLAIELICALQAVEERGIDQLAPST
FT                   SQLYHQARRIVPSIVADRVFSRDIEAVDAWLKQQAIRDRLAGGASV"
FT   gene            413045..414307
FT                   /locus_tag="GTNG_0363"
FT   CDS_pept        413045..414307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0363"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65745"
FT                   /db_xref="GOA:A4IK91"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK91"
FT                   /protein_id="ABO65745.1"
FT                   /translation="MFTHTVQPGDTLFSIGRRYGYSLEDLRLVNGMVEPNIVPGQALLI
FT                   PLYTYTVQPGDTLTAIARRSFVTLEQLRAANPNVNPNALRPGMKIVIPDISWYQATTFG
FT                   YYVVREPSADRAIIRDFAPYSSYITLFEYHFAPSGDIVNELNDAAAVEEAWRNRVTPLV
FT                   AITNLTPEGFSPTLVSQVLNNREARANLVENIFYLVSRKGYGGVNIDFEQIRGEDRDLF
FT                   TGFLRQLRDRLKPAGYVVTIAVPAKTSEDIPWLKGYDYGGIGTVVDYMFIMAYDWHHSA
FT                   SEPGPVAPIGGVRATLQFAVERVPRQKILLGLPLYGYDWIIPYQPGMLATARSNQEALL
FT                   TAMRYQSPIQYSLADESPFFRYTDALGNVHEVWFEDVRSMGQKMKLARQFQLAGVGAWQ
FT                   LTLGFAPGPWLLRKFFTVRKV"
FT   gene            414588..415286
FT                   /locus_tag="GTNG_0364"
FT   CDS_pept        414588..415286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0364"
FT                   /product="Membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65746"
FT                   /db_xref="GOA:A4IK92"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK92"
FT                   /protein_id="ABO65746.1"
FT                   /translation="MDRPLTISAAALLALWKIIAIDIILSGDNAVVIAMATRRLPKDQR
FT                   NKAIIWGTAGAVLLRILFAAIIVFLLNIPFVHFIGGVLLVWIAYKVLVEREEEANVQAS
FT                   DRLLKAIMTIIIADAVMSLDNVVAVAGAAEGHIGMLALGVAISIPIMIFGSKAIVRVME
FT                   KHRWIAYVGSGILAWTAGKMMVEDEGVLHLLHLSHGPFVYAVAAGVTIFVLAAGYIANK
FT                   KAEREEGTLI"
FT   gene            415329..416261
FT                   /locus_tag="GTNG_0365"
FT   CDS_pept        415329..416261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0365"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65747"
FT                   /db_xref="GOA:A4IK93"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK93"
FT                   /protein_id="ABO65747.1"
FT                   /translation="MDIRRILVTGRLYDELAALLPDKRPDKEYRFVAEEELKADDFVWA
FT                   DAYIGFQPAGPFSLANLRWVHSLGAGVDAFLWGREWNRNVLLTRTIGTFGEQIAEYCLS
FT                   YLLRDAQCHDVYAWYQEQRQWKPIAPKRLGEQRIVIYGTGEIGRRIAETLRLFGVSPIG
FT                   ISQSGKASAPFSAVYRPEEAEEALAVADWVIAALPLTAETHHLFDETFFSRLHNAGFIN
FT                   VGRGATVDETALVGALENRNIRLAVLDVFEEEPLPPHSPLWEHPNVLITPHIAALTSTE
FT                   DAVRSILDTLRCIEAGTPLNNVVDVSRQY"
FT   gene            complement(416308..417030)
FT                   /locus_tag="GTNG_0366"
FT   CDS_pept        complement(416308..417030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0366"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65748"
FT                   /db_xref="GOA:A4IK94"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR022823"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IK94"
FT                   /protein_id="ABO65748.1"
FT                   /translation="MTRGTIQNRDAFLQNIAKRLGRSPRLSGVSQPQWDYAPQWTVFAG
FT                   YSQDDLLSALREQCKLIHTDYIETTSSELAGALKQQVAAYGGGPVIVPDDPRFAEYGLS
FT                   ALLHDEWPAEQTAVHVWNSSLGRQNIDAAEQANVGIAFSEITLAESGTVVLFSRNEQGR
FT                   TIHFLPKTYIAIVPKSSVVPRMTQAAAYIHEQIEKGAVVPSCINFITGPSNSADIEMNL
FT                   VVGVHGPMKAAYIVVTDR"
FT   gene            complement(417027..418457)
FT                   /locus_tag="GTNG_0367"
FT   CDS_pept        complement(417027..418457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0367"
FT                   /product="Iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65749"
FT                   /db_xref="GOA:A4IK95"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022825"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IK95"
FT                   /protein_id="ABO65749.1"
FT                   /translation="MPMKIENGPFWKRVEENLQNDFMRGAVAGMQDRGYVRRLGVIEEL
FT                   GHWEEWRSLAEQIRKHTLENLDYYLMQLSENVAKRGGHVFFAQTAEEANDYIRRIALEK
FT                   QAKKIVKSKSMVTEEINLNPVLEAIGCDVVETDLGEYILQIDDHDPPSHIVGPALHKNK
FT                   EQIRDVFHRKLGYNKSSDPVELARHARETLRRDYLTADIGITGCNFAIAESGSITLVTN
FT                   EGNADLVTSLPKTQITVMGMERIVPTFKEMEVLVSMLTRSAVGQKLTSYITVLTGPREQ
FT                   GDADGPEEFHLVIVDNGRSSILGTEFQPVLQCIRCAACVNVCPVYRHIGGHSYGSIYSG
FT                   PIGAVLSPLLGGYDDYKELPYASSLCAACTEVCPVKIPLHELLIKHRQIIVEREGKAPV
FT                   AEKLAMKAFRLGTASPSLYRFGTKLAPSAFAPFAEDGRITKGPGPLKAWTESRVFPAPN
FT                   NERFRDWFRNRQKGGNPS"
FT   gene            complement(418476..419195)
FT                   /locus_tag="GTNG_0368"
FT   CDS_pept        complement(418476..419195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0368"
FT                   /product="(S)-2-hydroxy-acid oxidase, iron-sulfur chain"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65750"
FT                   /db_xref="GOA:A4IK96"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR022822"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IK96"
FT                   /protein_id="ABO65750.1"
FT                   /translation="MKVSLFVTCLIDLFYTNVGKATVELLERLGCEIDFPEAQTCCGQP
FT                   AYNSGYIKDAKEAMKQMMRAFADADYVVTPSGSCAAMLKEYPHIFRGDPEWEEEAKRLA
FT                   AKTYELTQFLVNVLRVEDVGASLPGRATYHTSCHMTRLLGEKEVPLRLLEHVKGLELVP
FT                   LPNAHQCCGFGGTFSVKMGPISEQMVDEKIEHIEEVKADYLIGADCGCLMNIGGRIGRV
FT                   GKPIRVMHIAEVLNHRN"
FT   gene            complement(419305..419967)
FT                   /locus_tag="GTNG_0369"
FT   CDS_pept        complement(419305..419967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0369"
FT                   /product="Transcriptional regulator GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65751"
FT                   /db_xref="GOA:A4IK97"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK97"
FT                   /protein_id="ABO65751.1"
FT                   /translation="MIKNGVLKPGDKLDSVQQLAEQFQVGRAAIREALTALKAMGLIEL
FT                   KQGEGTYVREFDPTMMTFPLSIAVLMNKEDIWHLLEVRKLLEAGAASLAATKRTDRDLK
FT                   AMMEALRQMKEGIGSDELGEKADFAFHMAIAAASQNPMLTSIMNSVSGMIVETMRETRR
FT                   IWLFSKQTTTEKLLAEHQAIFEAIREQNPDEARTRMLEHLTNVENVLYRYIRTQQSN"
FT   gene            420387..422018
FT                   /locus_tag="GTNG_0370"
FT   CDS_pept        420387..422018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0370"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65752"
FT                   /db_xref="GOA:A4IK98"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK98"
FT                   /protein_id="ABO65752.1"
FT                   /translation="MSAIVALIPILYFFWALAVKRMKGHVAGLTTLLLAVVLAVIAYRM
FT                   PAGKAVMSVTQGAVYGLLPIGWIIITSVFLYKLTVKTGHFDIIRNSVVSLTEDRRLQAL
FT                   LIAFSFGAFLEGAAGFGAPVAISAALLAGLGFNPLYAAGICLIANTAPVAFGAVGIPII
FT                   SMEGPTGVPAMEISKMVGRQLPFLSVFIPFYLVLIMAGWKRTIEVLPAIIVSGVSFALT
FT                   QYLSSNFLGPELPDILSSLVSIVALAVFLKYWKPRSTFRFATESEVAVAGQVARATHSS
FT                   GEVFRAWSPFLVLTALISLWGIPQVKAALTGHYEGTNSLLKFVNIIGSHLTFAPPVPGL
FT                   NNQILDANGQPIAAVYKLELLGAAGTAILLAAVVTKFIVNISWKDWAQTFVETLSELKY
FT                   PIVTIASVVGFAYIANSSGMSTTLGMALAKTGPLFPFFSPFLGWLGVFITGSDTSSNLL
FT                   FGNLQKVTATSIGMEPVLALAANSSGGVVGKMISPQSIAVACAAVGLTGKESDLFRFTV
FT                   KHSLFLIILIGIIVYLQSTVLSWMIP"
FT   gene            422125..423537
FT                   /locus_tag="GTNG_0371"
FT   CDS_pept        422125..423537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0371"
FT                   /product="Glycolate oxidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65753"
FT                   /db_xref="GOA:A4IK99"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR004490"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4IK99"
FT                   /protein_id="ABO65753.1"
FT                   /translation="MIPNEAKKRLIQIVGAENYDDTKAGRLVYSYDATPQFQSLPDAVV
FT                   APRNTQEVAEIAKICNEYRIPIVPRGSGTNLCAGTCPVEGGIVLLFKHMNRILEIDEEN
FT                   LTATVQPGVITLDLMRAVEEKGLFYPPDPGSMKISTIGGNISENSGGLRGLKYGVTRDY
FT                   VLGLEVVLANGDVIRTGGKLAKDVAGYDLTRLLVGAEGTLGIVTEATLKLIPMPETKQT
FT                   MLALYQDLEAAARSVSKIIANQIIPATLEFLDQPTLEVVEDYARIGLPTDVKAVLLIEQ
FT                   DGPKEVVERDMKKMADICRSEQAVSVELARSEEEAEALRTARRAALSALARLKPTTILE
FT                   DATVPRSEIAKMVKAINEIAAKYQLKICTFGHAGDGNLHPTCPTDARNREEMERVEKAF
FT                   EEIFAKAIELGGTITGEHGVGAMKAPYLEWKLGPAGIAAMKAIKQALDPNNIMNPGKVF
FT                   AKSTRKRVVVTR"
FT   gene            423534..424898
FT                   /locus_tag="GTNG_0372"
FT   CDS_pept        423534..424898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0372"
FT                   /product="Glycolate oxidase, iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65754"
FT                   /db_xref="GOA:A4IKA0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKA0"
FT                   /protein_id="ABO65754.1"
FT                   /translation="MTTKTEQAHIQKAFQERMDEDELMNCMRCGFCLPSCPTYIESGQQ
FT                   ETQSPRGRIALMKAVVDGLIEPDEEVERSLSLCLGCRACEQVCPSGVRYGHLLEEARDI
FT                   IAQHKRMPLHVRLVRKLVFAGLFPYQERMRKATAFLGWYQRSGLRAIVRKTGLLRLLPA
FT                   SFRQMERVLPDVPTAKEMKNRPHRLNPDEPAKKRVAFFTGCLMDTMFMTTNDATMRLLQ
FT                   LAGCEVIIPPSQGCCGALHGHGGEKEMAKELAKRNIAAFEQLDVDYIVTNAGGCGAFLL
FT                   EYDHLLKDDPEWCDRAAAFAAKIKDVSEVLVELEFHQLPLRVAPQTITYQDSCHLRNVM
FT                   KTASAPRRLLRAIEGAEFREMKDADRCCGSAGIYNLVEPEMSMQILDYKMEMAKQTKAT
FT                   TIVTANPGCLLQMKLGIERAGLTESVRAVHIVDLLLEAAEGAQAVREEERIRQTS"
FT   gene            complement(425095..426102)
FT                   /locus_tag="GTNG_0373"
FT   CDS_pept        complement(425095..426102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0373"
FT                   /product="Cell-shape determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65755"
FT                   /db_xref="GOA:A4IKA1"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKA1"
FT                   /protein_id="ABO65755.1"
FT                   /translation="MFASSELGIDLGTMNVRLFSQTKGLLFDEPAAIAYNRQADKLMAI
FT                   GQKAKQMIGKAPAHVEVTYPLRNGVIADFDQAKALLQQVFKQSSRQLGLSFKKPSIVMS
FT                   VPFHATSVERRSFYEIAKHCGAKHIHFIEEPVAAAIGADLPVGEPVANVIVHLGAGKTE
FT                   AAIISFGGVVACQSLRIGGNQLDEDIMQYVRQRYNLLIGEQTAEQVKIEIGSAPGTSLT
FT                   QPMTIHGRDFVTGFLKAVSLDPAEVQQAIKESLLQIAEAIRSVLEECPAELSGDIIDRG
FT                   IVLTGGGALLHGIEQWLSATLHVPVHVAPNPAEAVAIGTGKALQAIPKRLSTAL"
FT   gene            426594..427484
FT                   /locus_tag="GTNG_0374"
FT   CDS_pept        426594..427484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0374"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65756"
FT                   /db_xref="GOA:A4IJN7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJN7"
FT                   /protein_id="ABO65756.1"
FT                   /translation="MISNWNSEHAWTYEIDPILEALFRYIDSLSLPETPYVTGRPPVSK
FT                   KSLLKCFFLKTYFSIDSLRKLVRILQRFRCFQRACGLGEVPHLSTFSRAAKWFREQGFP
FT                   VFHAQLLKDLEVRYPQIVLIDSTALRSSLYDSQAKWGVSTRYHWFKGYKLHLCTTAEGI
FT                   ILSHVLTTANRNDAAVAPELLVSLKQWDIEFVLGDAAYDSEKVRQTAEQSGILFISPIN
FT                   RRNSEERKDAYGRVLPVFLKTRFGQWLFGLRREIERVFNELKSDGLEQPRWYGFHRYVL
FT                   HVLCCILMHNFEFLL"
FT   gene            complement(427570..428022)
FT                   /locus_tag="GTNG_0375"
FT   CDS_pept        complement(427570..428022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0375"
FT                   /product="Cell wall lytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65757"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKA3"
FT                   /protein_id="ABO65757.1"
FT                   /translation="MKKWLTLLSLSMIVLFSSLFVNVSDTSAAANKTRLIAEAKKLIGT
FT                   PYRYGGTTPKGFDCSGFVYYTHKKVGVTLPRSSKEMYKKGKYVHKSNLKPGDLVFFNTS
FT                   KRTKGVSHVAIYIGNNRVIHAVSRGVKIDNLNSSYWKTKYVGAKRL"
FT   gene            428407..430815
FT                   /locus_tag="GTNG_0376"
FT   CDS_pept        428407..430815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0376"
FT                   /product="Sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65758"
FT                   /db_xref="GOA:A4IKA4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKA4"
FT                   /protein_id="ABO65758.1"
FT                   /translation="MTASAVYMYAHRMAKQHGALSPWSAAPKLTAAFFICSLFLLGGGI
FT                   AWIDEAENREYGEYKESAKQIAGMIASDLAARGHEQLDENADRLPVYHSILAALGRWQQ
FT                   HGLVRSVYTLKKNEHGELYVVVAPAVDGSRSGRIDGKHEQAVPPGTIYRHAFAEIEEAF
FT                   RGRFAMEKHPRADGSGKSISTFMPIHGLDGTVNAVVGIDYDAKVYERRLKKERQKAAAI
FT                   MMMIYFIAVSIYLLVLHRQIGRKVLAAHKKTLAANEQRLRQLAEMTMEGVIVCASGKIV
FT                   EVNEAACRLLGYRESELVHLPINDVVVDGSMRPSCSNNGVERFEIELRRKDGAVFPAEI
FT                   VQHCYDDEGQKVTVVAVRDLTAQKQNEEPMHDIVSHDELTGLANKEAMYKVVERRLADA
FT                   KRFHREAAVMLLEVTSIKTINDFYGYAVGDEVLLHLARRWSEQEGITVGRWSGNEFIAV
FT                   LPDSSNEKAEEAAKRLIEVADEPIAVNGLELYVTVNVGISVYPKDGEETKTLIRKADIA
FT                   RYEAREKVVSDFLFFNEPMADRLHEKMAMERDLRRALEREEFELYYQPQIRLYDRQVIG
FT                   MEALVRWRHPEKGFIPPSLFIPIAEQTGMIIRINEWVIRTACQQTKQLIDQFPHLSVSV
FT                   NLSPYEFESRRFVDKLARLLADTGLPPHHLDLEITERMTMDTEHAFDILSKLKSLGVTI
FT                   SMDDFGTGYSSLSYLTDLPIDRLKIDRSFVQHIQGKKDVILPSIIRLGHNIGVKVLAEG
FT                   VETETEAAYLQGKRCDEAQGYYFSPPLPYGEFVRFLTEQHARRQAQELT"
FT   gene            430817..431188
FT                   /locus_tag="GTNG_0377"
FT   CDS_pept        430817..431188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0377"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65759"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKA5"
FT                   /protein_id="ABO65759.1"
FT                   /translation="MDGFWRIAEEKIREAMKNGEFDELPGFGKPLELEDVSHIPEELRI
FT                   GYLLLKNAGYVTEETELRKELMTLEDLLRCCEDDEKKKELMKKWTEKQLRFAELMKKRQ
FT                   QTNSKALRDYGRRIEEKFR"
FT   gene            431391..431954
FT                   /locus_tag="GTNG_0378"
FT   CDS_pept        431391..431954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0378"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65760"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKA6"
FT                   /protein_id="ABO65760.1"
FT                   /translation="MKSVWMAFFTSLVLAMPSWVTAGHHEAVNVHLPVGHMWKHGALDE
FT                   QKWMEMVQTYTPEQAGEWKKVLDERKALRQQFEDEKVKKAMKEKYKQMKKEREAALDRL
FT                   IDQLANKKITKEQFKQELKQLHKKKHWMTKEEKQRLHMLHEQTRQAMENNDQEAMKKLL
FT                   PQWLEHMKKENERLAKCLQEVKEG"
FT   gene            432056..432697
FT                   /locus_tag="GTNG_0379"
FT   CDS_pept        432056..432697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0379"
FT                   /product="Siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65761"
FT                   /db_xref="GOA:A4IKA7"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKA7"
FT                   /protein_id="ABO65761.1"
FT                   /translation="MGYPVILHLRGRRAVVVGGGKVAARKIRGLLEAGADVVMVAPEAE
FT                   PELQALAAAGTIVWRIKTFAPSDLEGAFLVIAATNDDKVNEAVAQAAAPGQLLNVVDAP
FT                   QRCDFHVPAVIRRGPLTIAVSTEGASPAVARRIRRELEDQYGEEYGPYLEFLQQARDIV
FT                   LREVADPEGRKRLFQALAADSFRQSGRWGEEFSHLLAKEKERSSKKGRER"
FT   gene            complement(432887..433540)
FT                   /locus_tag="GTNG_0380"
FT   CDS_pept        complement(432887..433540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0380"
FT                   /product="LmbE-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65762"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR023841"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKA8"
FT                   /protein_id="ABO65762.1"
FT                   /translation="MNEQHVLVVFPHPDDEAFGVSGTIAQYVQSGTPVTYACLTLGEMG
FT                   RNMGVPPFANRETLPLIRRQELEEACRVLGIHDLRLLGYRDKTVEFEDEEELADRIAAI
FT                   VSETNPSLVITFYPGYSVHPDHDACGAAVIRALKRWPKEQRPTVYCVAFSKNCEQDLGQ
FT                   PDIVHDVSSVIDTKLAAIRAHRSQTEGLMQAASKRGDALAWLKTERFWTYRWDD"
FT   gene            complement(433554..433901)
FT                   /locus_tag="GTNG_0381"
FT   CDS_pept        complement(433554..433901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0381"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65763"
FT                   /db_xref="InterPro:IPR014934"
FT                   /db_xref="InterPro:IPR036492"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKA9"
FT                   /protein_id="ABO65763.1"
FT                   /translation="MQPIDTTAVQEALNRLANRDIYIHLETTNGAYASHHNEGFFSAGA
FT                   YIRNALIRFTRGKITGPGPYRVGLKLDIGWVYAEGLTHWEWTKEGQLLLAGHDYEGKLA
FT                   VALELSDKPFA"
FT   gene            434065..434835
FT                   /locus_tag="GTNG_0382"
FT   CDS_pept        434065..434835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0382"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65764"
FT                   /db_xref="GOA:A4IKB0"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKB0"
FT                   /protein_id="ABO65764.1"
FT                   /translation="MGFQGNGVTVLNFDGTYRPQKRLFCFPHEWIDLADVPETNLYCSE
FT                   AALAEIERRLRRRRTRGAVLIGSGNYHYVTYLLLREISEPFTLVLFDHHTDAEQDESSL
FT                   ISCGSWVAHALQYAQLRKVVIVGPSFSPRNLRLSPNITVFPFADHDEWPNELLKAIPTG
FT                   SVYISIDKDVLRREDAVTNWDQGMMTLSRLLACLRLLLFYKKVLGVDICGEYPKAVIDV
FT                   FHPLCLEAQWKNEQANSAILETCFRYATSHLRPA"
FT   gene            complement(435088..435372)
FT                   /locus_tag="GTNG_0383"
FT   CDS_pept        complement(435088..435372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0383"
FT                   /product="Acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65765"
FT                   /db_xref="GOA:A4IKB1"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKB1"
FT                   /protein_id="ABO65765.1"
FT                   /translation="MKRVHVIVEGRVQGVGFRYFVQHEALKRQLTGWVKNNDDGTVEME
FT                   AQGHESAVQLFLDTIEAGTMFAKVSRMHIEQRDVRPDEKQFRIMYGGGL"
FT   gene            complement(435460..436206)
FT                   /locus_tag="GTNG_0384"
FT   CDS_pept        complement(435460..436206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0384"
FT                   /product="Ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65766"
FT                   /db_xref="GOA:A4IKB2"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKB2"
FT                   /protein_id="ABO65766.1"
FT                   /translation="MEAILYVSHGSRIAAARYEAARFVEQCKAAIDIPIQELCFVELAE
FT                   PDIVTGVDRCVAQGATRIIVVPLLLLSAGHAKHDIPAALELAKQRHPSLEIVCGTPFGV
FT                   HESMIDIIIDRIGEHPTPLDNESMILLIGRGSSDPDTKRDITAIARLLKEKTNVPHVDI
FT                   CFLAAIHPTLDEGLEQANASIYRHVFVVPYLLFTGVLMKTIERKLEALPVSHQQWHLCS
FT                   YLGYHPRLVTLIQEQVLSLSLAKKGA"
FT   gene            complement(436217..436993)
FT                   /locus_tag="GTNG_0385"
FT   CDS_pept        complement(436217..436993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0385"
FT                   /product="uroporphyrin-III C-methyltransferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65767"
FT                   /db_xref="GOA:A4IKB3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKB3"
FT                   /protein_id="ABO65767.1"
FT                   /translation="MGKVYLVGAGPGDPELITVKGLKCIQQADVILYDRLINEELLSYA
FT                   KPGAELIFCGKLPGYHVMQQETINHSLVLHAKKGKNVVRLKGGDPFVFGRGGEEAEALV
FT                   KHGIEFEIVPGVTAAIAATAYAGIPVTHREFSSSVAFVTGHRRDGIREDIKWESLAKGI
FT                   DTIAIYMGVHNLPYICEQLIKYGKMPETPVAVIQWGTTAAQRTVTGTLTTIAGIVAKEN
FT                   IENPSMIIIGDVVRLRANIQWFERLLASSAAAGATS"
FT   gene            complement(437134..437745)
FT                   /locus_tag="GTNG_0386"
FT   CDS_pept        complement(437134..437745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0386"
FT                   /product="Adenylylsulfate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65768"
FT                   /db_xref="GOA:A4IKB4"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKB4"
FT                   /protein_id="ABO65768.1"
FT                   /translation="MSTNIVWHHTSVTKKDRRERNGHHSAILWFTGLSGSGKSTVANAV
FT                   SRRLFELGIQNYVLDGDNIRHGLNKDLGFSAADRTENIRRIGEVAKLFVDSGQFVLTAF
FT                   ISPFAEDRALVRRLVEEDEFIEIYVNCPLEECEKRDPKGLYKKARRGEIREFTGIDSPY
FT                   EAPEAPELTVETHRYSVDECVEQVLAYLRERGFIPAAETN"
FT   gene            complement(437758..438918)
FT                   /locus_tag="GTNG_0387"
FT   CDS_pept        complement(437758..438918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0387"
FT                   /product="Sulfate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65769"
FT                   /db_xref="GOA:A4IKB5"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKB5"
FT                   /protein_id="ABO65769.1"
FT                   /translation="MSLSIPHGGTLINRWNPDYPLNEVTKTIELSNAELSDLELIGTGA
FT                   YSPLTGFLTKADYDAVVETMRLADGTVWSIPITLAVTEEKAKELAIGDKAKLVYGGDVY
FT                   GVIEIADIYRPDKTKEATLVYKTDELAHPGVRKLFEKPDVYVGGEITLVKRTDKGQFAA
FT                   FYFDPTETRKRFAELGWNTVVGFQTRNPVHRAHEYIQKCALEIVDGLFLNPLVGETKAD
FT                   DIPADIRMESYQVLLENYYPKDRVFLGVFQAAMRYAGPREAIFHAMVRKNFGCTHFIVG
FT                   RDHAGVGNYYGTYDAQKIFSNFTAEELGITPLFFEHSFYCTKCEGMASTKTCPHDAEHH
FT                   VVLSGTKVREMLRNGQVPPSTFSRPEVAAVLIKGLQKREAVTPSAR"
FT   gene            complement(438966..440039)
FT                   /locus_tag="GTNG_0388"
FT   CDS_pept        complement(438966..440039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0388"
FT                   /product="Sodium-dependent phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65770"
FT                   /db_xref="GOA:A4IKB6"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKB6"
FT                   /protein_id="ABO65770.1"
FT                   /translation="MLLAIAFIVSFFFAMNIGASGAAASMGVAYGSGAIPRKSVALLLC
FT                   GISVFLGSLGGGEVVKTIGSGIIPSSILTVKIVVIILTAATISLFAANIMGIPLSTSEI
FT                   TVGAVVGVGIAYQAVYFNKLLFIVSVWIVIPIIAFAFTLAVGKWFLALKRKYPQLEQGR
FT                   WQKTFMTLLIVTGCFEAFSAGMNNVANAVGPLVGAGLISVGPATILGGLSVAAGALLLG
FT                   RRVLETNGKKITNFSPFEGSAISGTGALLVIISSLFGLPVPLTQITTSAIIGIGTAKSG
FT                   LSIWQKRIVVQLLKVWLVSPIFSLVISYSLIKLLLDSDVYTVIAIFSVCLATLGVISLK
FT                   KTAVEEERSLHEHGGGI"
FT   gene            complement(440051..440758)
FT                   /locus_tag="GTNG_0389"
FT   CDS_pept        complement(440051..440758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0389"
FT                   /product="Putative phospho-adenylylsulphate
FT                   sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65771"
FT                   /db_xref="GOA:A4IKB7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011798"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKB7"
FT                   /protein_id="ABO65771.1"
FT                   /translation="MLTYDRWETVEKPSFPSDNETKGALDVLAWAYREYGDEIVYACSF
FT                   GIEGIVLIDLISQVKPDAEIVFLDTGLHFQETYDTIAKVKETYPSLRIIMKQPHLTLEE
FT                   QAAQFGDELWKRDPNKCCELRKVIPLREVLTGVTAWISGLRREQSPTRRHVEYVNKDDK
FT                   FRSIKVCPLIHWTWKDVWNYVYKHSLPYNVLHDRGYPSIGCAPCTAPALDPNDLRSGRW
FT                   AGQGKTECGLHLT"
FT   gene            complement(441168..441392)
FT                   /locus_tag="GTNG_0390"
FT   CDS_pept        complement(441168..441392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0390"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65772"
FT                   /db_xref="InterPro:IPR009507"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKB8"
FT                   /protein_id="ABO65772.1"
FT                   /translation="MDLSKRSAENVEYMIEQLKQKLKVMNFDALKPSHFSEEWYDELKD
FT                   IYEMVMKRETFSPSEMQAIVEELGNLRKK"
FT   gene            441623..442105
FT                   /locus_tag="GTNG_0391"
FT   CDS_pept        441623..442105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0391"
FT                   /product="Low molecular weight phosphotyrosine protein,
FT                   phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65773"
FT                   /db_xref="GOA:A4IKB9"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKB9"
FT                   /protein_id="ABO65773.1"
FT                   /translation="MVKVLFVCLGNICRSPMAEAIFRHLVKERGLDRVIAVDSAGTGSW
FT                   HVGEPPHEGTRRILNENDIDYSGIRARQVERRDLEEFDYIIAMDAANLNDLRRLAGSNS
FT                   SAVIARLLDFVPDREKDDVPDPYYTGNFVEVYHLVRSGCEHLLEAIIRDHRLVAGE"
FT   gene            442173..442994
FT                   /locus_tag="GTNG_0392"
FT   CDS_pept        442173..442994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0392"
FT                   /product="Ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65774"
FT                   /db_xref="GOA:A4IKC0"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKC0"
FT                   /protein_id="ABO65774.1"
FT                   /translation="MMFVRELARRFTEDEIPRLSAELAYYFLLSLFPFLLFLMTLLAYL
FT                   PIPHEDVLALVRQYAPKEALHLIETNVHHLMDVQNGKLLSLSIIGAVWSASNGMRAIMR
FT                   AFNRAYDVEENRPFWVARGLSVALTLGMIAVIIVALVLPVFGRTIGLFLFSALGLSEQF
FT                   LTVWNAFRWTTSSLLLFAVFTALYYFAPNKQLRCVNVVRGALFATAGWIATSLAFAYYV
FT                   NHFANYTAMYGSLGGLIVLMIWLYLSGMILVLGGEMNAIFDCEREGRKRMR"
FT   gene            complement(443232..443378)
FT                   /locus_tag="GTNG_0393"
FT   CDS_pept        complement(443232..443378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0393"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65775"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKC1"
FT                   /protein_id="ABO65775.1"
FT                   /translation="MSRAERKNMIEFIEKVRGLSREQLAYMTDAEIEYIYERYYHYHEE
FT                   SVE"
FT   gene            complement(443498..444631)
FT                   /locus_tag="GTNG_0394"
FT   CDS_pept        complement(443498..444631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0394"
FT                   /product="Transporter, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65776"
FT                   /db_xref="GOA:A4IKC2"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKC2"
FT                   /protein_id="ABO65776.1"
FT                   /translation="MRFAILTGIVAISGLSQGMLLPLLAMLLDESGVSSTVNGAHAAAL
FT                   YIGVLAISPFLEHPLGKYGYKPMIIMGGFIVICSLILFPLFSSFFLWLVIRFFIGMGDH
FT                   MLHFATQTWITDFSPPAERGRRLSLYGLAFGLGFTAGPLLASLASINEALPFYLAALLS
FT                   FIGWIAVFCLPNEKPKAFERSSSAAGRWIGAWKYAWPALLLPLAYGFLEAAIHSVFPLY
FT                   ALHKRMSAEQITLILPFFSFGGIIFQLPLGALSDRFGRRVAITGALLAGISCFLTALVV
FT                   DTSTVGLATCLFAAGMFTGSLFSLGIAYMTDLLPKTLLPAGNLLSGMLYSLGSIIGPPL
FT                   AGSAVDVTADAFFLAVSAVLLIPAVCLARRREREKAA"
FT   gene            444783..445835
FT                   /locus_tag="GTNG_0395"
FT   CDS_pept        444783..445835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0395"
FT                   /product="Calcium/proton exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65777"
FT                   /db_xref="GOA:A4IKC3"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKC3"
FT                   /protein_id="ABO65777.1"
FT                   /translation="MNKLFAWMTWIGVPVSVIGGFLHWPTVLMFVLYCLTIVALASYMG
FT                   RATESLAIVAGPRIGGLLNATFGNAVELIISIFALRAGLVDVVLASLTGSVLGNLLLVA
FT                   GLSFFVGGLKYKRQEFNIYDARHNAGLLTFAIFVAFVIPEVFTAEMAPDERLVLSVGIS
FT                   IIMILLYLAALYFRLVTHRGVYQHKSDEVEEHEEPEWGRGKATIILALATAAVAYLSER
FT                   LVHTFETVAESFGWSELFIGVIIVAIVGNAAEHASAIIMAYKNKMNVAVEIAVGSTLQI
FT                   AMFVAPVLVLVSLLFPEKMPLVFSLPELIAMGAAVLLTIVISNDGDTNWFEGATLLAAY
FT                   TIMGIGFYLL"
FT   gene            445988..446776
FT                   /locus_tag="GTNG_0396"
FT   CDS_pept        445988..446776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0396"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65778"
FT                   /db_xref="InterPro:IPR025548"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKC4"
FT                   /protein_id="ABO65778.1"
FT                   /translation="MKKWAVSLLTGVLLLYAATVPTMAASGKPAPGTVIDISKENTYPN
FT                   PTQDLPHLEPSSFTKQLLKSANVKIENPELIHLFNESSAANTPWAVGYRATIYLGQWPL
FT                   NYQSLETSTNWEYQKVNTNFLDNRSGEAAQKLYYRQEMQKHIRGGLTAKVPNEEAVKRM
FT                   MLNKAMEKTKLPLSFSTVVGIGTKKDQSYNVPAKKMGYLYAYAPAVNEKGKVTYGEVYI
FT                   VLKGNKKKIVVKNVTTRGVGAWIPVQDRLYMSYVISDQPR"
FT   gene            complement(446874..447998)
FT                   /locus_tag="GTNG_0397"
FT   CDS_pept        complement(446874..447998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0397"
FT                   /product="Thioredoxin-like oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65779"
FT                   /db_xref="GOA:A4IKC5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014866"
FT                   /db_xref="InterPro:IPR031004"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKC5"
FT                   /protein_id="ABO65779.1"
FT                   /translation="MRSSTMPAITPAYDPWEAYVDIEEYGKLELTNIELTTTTLCNMRC
FT                   EHCAVGYTLATKDPDALPLDLLIRRLEEIPHLRSLSITGGEPMLSLTSVERYVVPLLRY
FT                   AHERGVRTQLNSNLTLDLARYERIIPYLDVLHISHNWGTIDDFVDGGFAMMERKPTRAQ
FT                   REKYFQRMLDNAKALAKSGVMVSAETMINKRTVRHLETIHRQVVEEMGCRRHEIHPMYP
FT                   SDFAGALETLSLEELRQAIHHLLDIRDENVWMLFGTLPFYPCSDNEDDLRLLKRLYESK
FT                   NVTVRNDPDGRSRLNINIFTGDVIVTDFGDEPPLGNIIHDSLPDVYRQWRRSKLANELL
FT                   CHCPAARCLGPNVLVKQTYYRNVDFTKRSARVAR"
FT   gene            448224..449771
FT                   /locus_tag="GTNG_0398"
FT   CDS_pept        448224..449771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0398"
FT                   /product="Fumarase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65780"
FT                   /db_xref="GOA:A4IKC6"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKC6"
FT                   /protein_id="ABO65780.1"
FT                   /translation="MDKFQQSMYDLIVETSTKLPKDVRRAIAQAKVRENLGTRAAMALD
FT                   TIVENIQMADENVSPICQDTGLPTFKIKVPVGVNQIEMKKAIRAAVVEATKNGKLRPNS
FT                   VDSLTGKNSGDNLGEGVPVIKFEQWENDYIDVRLILKGGGCENKNIQYSLPCELEGLGR
FT                   AGRDLDGIRKCILHAVYQAQGQGCSAGFIGVGIGGDRSSGYELAKEQLFRPVDDVNPIE
FT                   ELRQLEEYIMENANKLGIGTMGFGGESTLLGCKIGVMHRIPASFFVSVAYNCWAFRRMG
FT                   VKIDPQTGEIMEWLYQDGEDIDLTKELEKAEAAAALEQGETRVIDLVPPLSEEQVRQLR
FT                   VGDVVRISGMIYTGRDAIHKYLMDHDAPVDLNGQIIYHCGPVMLKDEEGRWHVKAAGPT
FT                   TSIREEPYQGDIMKKFGVRAVIGKGGMGAKTLQALKEHGGVYLNAIGGAAQYYADCIQS
FT                   VEGVDLMEFGIPEAMWHLRVENFTAVVTMDSHGNSLHEDVEKSSLEKLAQFKEPVFK"
FT   gene            449944..450735
FT                   /locus_tag="GTNG_0399"
FT   CDS_pept        449944..450735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0399"
FT                   /product="Spore coat N-acetylmuramic acid deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65781"
FT                   /db_xref="GOA:A4IKC7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKC7"
FT                   /protein_id="ABO65781.1"
FT                   /translation="MKWLLSLVFIIALVPTPALAASNAPIHWGFKRSENHEPPSAGKEL
FT                   DELLAKYDAFYLGDTSEKTVYLTFDNGYENGYTAKILDVLKEKQVPATFFVTGHYLQTA
FT                   PDLVKRMAAEGHIIGNHSWHHPDLTTVSDERLREELEKVKEKTEELTGQKGMVYLRPPR
FT                   GIFSERTLSLARDLGYYHVFWSLAFVDWQTDRQRGWRYAYDQMMKQIHPGAIVLLHSVS
FT                   KDNADALPKVIDDLRKQGYTFASLDELMGKKMGLHPWLFRP"
FT   gene            450895..451761
FT                   /locus_tag="GTNG_0400"
FT   CDS_pept        450895..451761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0400"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65782"
FT                   /db_xref="GOA:A4IKC8"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKC8"
FT                   /protein_id="ABO65782.1"
FT                   /translation="MWKRTITVPAPYDFAHVLDRLSLDPLMAVDVERQRITVPLHLDGL
FT                   KIPVVIESIGTKEAPRFVVLAPHSNRQEDILERVSHLFQWQTPLAPVYDHFRTTELAPL
FT                   FARYEGLPLVLDFDLYFCLMKCFIHQQLHLKVGYRLTERFVKTFGEERDGVWFYPRPED
FT                   IAARSYDDLRALQLSRRKAEYIVDVSRLIADGTLRLDDLEQMEDGEVMERLTAIRGIGP
FT                   WTVQNFLLFGLGRPNVFPPADIGLQRAVERLFQLPKRPTASELALLGERWKPYTSYAAL
FT                   YLWRSIE"
FT   gene            451773..453167
FT                   /locus_tag="GTNG_0401"
FT   CDS_pept        451773..453167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0401"
FT                   /product="RNA methyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65783"
FT                   /db_xref="GOA:A4IKC9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKC9"
FT                   /protein_id="ABO65783.1"
FT                   /translation="MTKQQTKVKIQKGDQFPLTIQRIGINGEGVGYFQKQVVFVPGALP
FT                   GEEVIVEATDIHPTYAEAKIKRIRKRSSHRVTPSCPLYNQCGGCQLQHLSYEAQLEAKR
FT                   DIVIQALRRHVRRLDVDKIDIRPTIGMNDPWHYRNKSQFQVGVKKGKVLAGLYGLNSHR
FT                   LIDLSECRVQHPQTTRVTNIVKTILQDLRIPIYNERTRTGVVRTIVARVGFHTGDIQIV
FT                   LVTATKDIPRKELLIDEIRRRLPEVKSIVQNINGEKTSLIFGDETEVLAGDEYIQETLG
FT                   DLSFELSARAFFQLNPIQTVKLYDEVKKASALTGTERIVDAYCGVGTIGLWLARDAKEV
FT                   RGMDTIPEAIEDAKKNAKKHGFENTHYVVGKAEYWLPKWVKQGWKPDVVIVDPPRVGCD
FT                   RALLETILRVRPQTVVYVSCNPSSLARDLDTLARAYRVDYIQPVDMFPHTAHVETVAKL
FT                   ILTRYS"
FT   gene            complement(453560..454159)
FT                   /locus_tag="GTNG_0402"
FT   CDS_pept        complement(453560..454159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0402"
FT                   /product="Transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65784"
FT                   /db_xref="GOA:A4IKD0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKD0"
FT                   /protein_id="ABO65784.1"
FT                   /translation="MNDASKNVRRRGDALIESIYNATIELIKKVGYTNLTFQQIAHAAK
FT                   TSRTVLYRRWNTKFDLIHEIMEYKTKNALGGELIDKIEDTGSLRGDLLQLLTLYQSIYT
FT                   EGGLEIMNAILFEIGQDSEKLSKIETNARNKNILVMRKLLGFAKNRGEKIKEVSDATLT
FT                   LPFDLIRVENLLRRETMDAKRLELLVDEILLPVFLA"
FT   gene            454348..455754
FT                   /locus_tag="GTNG_0403"
FT   CDS_pept        454348..455754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0403"
FT                   /product="Transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65785"
FT                   /db_xref="GOA:A4IKD1"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKD1"
FT                   /protein_id="ABO65785.1"
FT                   /translation="MGKEKLPKGMISIAWILVLGAILPMLDSTIINIAVNDLAKAFSTT
FT                   FAVTQWVVTGYVLALGMAVPLSGWLMQKYDGKKVYMVALGLFLISSLLCGLAWDMQSLI
FT                   AFRMLQGLASGIIIPALTTLVVQAAGSENLGRVMSVVGIPVVFGPIAGPVIGGFILQHL
FT                   SWHWLFFVNLPIGGIALLIAQWKLPKFEAMNKSAKLDWIGILLLAMLSGMVVFGVTEIR
FT                   AQNTRATGILAFGIGAISLVAYLLYASKRKDQALIPLDLFKSKNFSAAFLSLFLAGFAT
FT                   NGPMLLFPMFFQNVLELNVITAALWLIPQGVGMLVTRPLIGKMTDKLGARYVVLPSIAI
FT                   TIIGTLPFVFFDADTSQWLIWLVLFVRGIGVGGITVPVMSDSYVGLQKLQVPAASVATR
FT                   IIQNVGAAFGSAILATVVSNALNVKEATVANFAGAYHAGFITSLIFMVISILPALFLTN
FT                   KMSIARVEGQ"
FT   gene            456470..457723
FT                   /locus_tag="GTNG_0404"
FT   CDS_pept        456470..457723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0404"
FT                   /product="Sugar transporter sugar binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65786"
FT                   /db_xref="GOA:A4IKD2"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKD2"
FT                   /protein_id="ABO65786.1"
FT                   /translation="MLIVFLLAACSGNKSSNTKVPEGRTEIVMWNLFGGGDAEYMQEIV
FT                   DAFNESQDKYFITNVFQEYEEYYTKLLTSIASGKGPDLAIAHSYVIPELVAEGLVTPID
FT                   KYASEIGLKWEEFNQNVLEAVIFEDKHYAVPIDTHPEIMFINNKLVREAGLLNDDGTVM
FT                   MEETPEGFVEFLTKLKEKLPEGKMPFAFSNVGEDPYRIWWALYNQLGGEHIVEGDLEHP
FT                   KYVLDTEKAIQAAKYIYDLYHTHKVIPLNLADFYSDFQTGNAAVMATGVWATGIWEKTD
FT                   GLEFTPMPFPNMFGQKAAWASSHTFVLPFYSNADEEVLKGAVEFMKFATDNGAMWAKAG
FT                   HIPAKDTVVESKEFKELPYRSDYAQVADYVKVVDKTVHARGIQDIMIRNLDRIWTNEAT
FT                   PEEAFKTIEQEVTELISN"
FT   gene            458347..459219
FT                   /locus_tag="GTNG_0405"
FT   CDS_pept        458347..459219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0405"
FT                   /product="ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65787"
FT                   /db_xref="GOA:A4IKD3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKD3"
FT                   /protein_id="ABO65787.1"
FT                   /translation="MRKKLLIQDLKAIPYLLPFFLVYVVFTIFPVFKGFEMSLHEWKLV
FT                   GKVDFIGIENYKKMISDPFFWETLWNTTKFVIYTTPTMILLALGLALLANLKTKLKKFF
FT                   RAAYFLPSILSVSVISFLAIYMLQPYNGFVNTFLHLIGIQAEPFWIADKKLAWVAIVVV
FT                   TLWWTVGFNMILFLAALQDIPDSLYEAAEIDGASRWQMFIHITLPQLVPIGKVILLLQI
FT                   IASYKVFAQIMLITGGGPGGTTRPLIQYIYEVGFNKNLMGYAATMSYALFMILLILSIV
FT                   QLRYQRKEN"
FT   gene            459223..460113
FT                   /locus_tag="GTNG_0406"
FT   CDS_pept        459223..460113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0406"
FT                   /product="Putative integral
FT                   membranebinding-protein-dependent transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65788"
FT                   /db_xref="GOA:A4IKD4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKD4"
FT                   /protein_id="ABO65788.1"
FT                   /translation="MSMPQLAPNIQDKTQIRQKSLLQRNRDSYLWIKVIIGLIAAVLFI
FT                   LPVIWMIFVSLKPDGYVTKNPVEWFLPPYTLDNYTRLLEESLILKWTWNSFIVAFITTL
FT                   LSLLVTSLAAFAISRLKFRYKNFILVFFLLGLMIPGEATIIPLYEVAKSLGLIDTYAGL
FT                   ILPMIASSMGIIVLKSFFDNVPKELIESAVIDGCSTFKLFYKIILPLSKPAISAIGIFT
FT                   FIGSWNNFLWPYLATLSEDLYTLPVGIPVFNSNYSTAYVLPMTANAIASIPVIIAFLIF
FT                   EKQIVKGISFTGIKG"
FT   gene            460136..461896
FT                   /locus_tag="GTNG_0407"
FT   CDS_pept        460136..461896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0407"
FT                   /product="Putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65789"
FT                   /db_xref="GOA:A4IKD5"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKD5"
FT                   /protein_id="ABO65789.1"
FT                   /translation="MNNVKVYNRTEYPRPQFKRKDWLNLNGKWSFAFDDENIGERNEWY
FT                   KNLSTSMEIQVPFTYETKASGIGDETFHPVVWYQRSFKIPEDQIGKKVILRFQASDYFT
FT                   KVWVNGHFVGDHKGGNSAFAFDITNVIDQYGENELVVKVEDSLSCYQPRGKQRWMDKNF
FT                   GCWYVQTTGIWQTVWLEFLNHQTIKSVKMTPNIDNHSIRFDYDLDVSLHEDLRLETVIN
FT                   FKGREIKRFSINPNRPQFHLEVDLLSEISEWKVFLWSPEDPNLYDVVFRLYDNEQLVDE
FT                   VESYFGMRKISIKDGKVLLNNKPLYQKLLLDQGYWPDTLLTPPSDEAIIDDINKTIQMG
FT                   FNGVRKHQKIEDERFLYWCDKKGLLVWSEMAATYEFSDQAVENFTKEWLEIVQQYYNHP
FT                   SIITWVPFNESWGIPNVAYDKKQQSFTESIYYLTKSIDQMRPVIVNDGWEHTVSDIITL
FT                   HDYEECGEKFYERYKDKDLILNNQIPHNKDKYAFAEGYTYKGQPVIISEYGGIAFKDEK
FT                   GWGYGHQVETEDEFLRRYQSITDAIKKLPYISGYCYTQITDVQQEVNGLLKEDRTPKIA
FT                   LEKIKKVNDS"
FT   gene            complement(461994..462920)
FT                   /gene="yoaV"
FT                   /locus_tag="GTNG_0408"
FT   CDS_pept        complement(461994..462920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yoaV"
FT                   /locus_tag="GTNG_0408"
FT                   /product="YoaV"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65790"
FT                   /db_xref="GOA:A4IKD6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKD6"
FT                   /protein_id="ABO65790.1"
FT                   /translation="MKKLSGQYLYIFLLVTIILLWSYGWVLTKMGLSYMGPFTFAALRF
FT                   LLASLTMIIILFFLKTPRPKGKEWMILFIIGLLQTTAMFLFINYGMMFVNVSKSSILIY
FT                   SMPIWSGILGYLFLHESLNYYKVVSLILGISGLVSIIGVDFFAVQNKSSIFGECFLLLA
FT                   AISWAGANIIVKKYFSNHNKIVVSTWQMIFGTIGVVVAAILMEWGQPIQFTTMSMFILI
FT                   YTGVIASSFCFTCWYVVLTKLDTTVASISLLFVPIVAIFLDWLLLNEKMTVNIAIGALL
FT                   ITIGVYLATVAKPKKKSIKRFSTEIKS"
FT   gene            464420..465085
FT                   /locus_tag="GTNG_0409"
FT   CDS_pept        464420..465085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0409"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65791"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKD7"
FT                   /protein_id="ABO65791.1"
FT                   /translation="MALKRYWQALWLSALVLMAGCHMEEQKEQPKKWPDTVAFQDEFTR
FT                   EFMASTKEVKEGYYLFQSQTDGYTMLFPKDAVVAKGLYERDGKDFESLAIGWDNEEENL
FT                   DYSIDLQYEQGEYMEDIETNLYLLSSRAYADYNGSYMKQEYNDKTIYFAKSQKDISVDD
FT                   KHDTEYLFFSYIKSNNSHQGVLFIYSVNCNDARKSCQVKVEEEEKTAKMLMRSITFYD"
FT   gene            465100..465447
FT                   /locus_tag="GTNG_0410"
FT   CDS_pept        465100..465447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65792"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKD8"
FT                   /protein_id="ABO65792.1"
FT                   /translation="MSQKLVLDTDLLRARIMALEYDHLTEAEIRRIYIEETGKEPPAHI
FT                   KVYHSDDFKEGQDFGFDGTIIHFYDEEQGINQKYTIARGSEMPEHDTWKSLDRRQQSDD
FT                   RVLLEFGAKAI"
FT   gene            465738..466337
FT                   /locus_tag="GTNG_0411"
FT   CDS_pept        465738..466337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0411"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65793"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKD9"
FT                   /protein_id="ABO65793.1"
FT                   /translation="MDEQKEQPKKWPDTVAFQNEYTRKFLVSPKEVKDGYYLFRSQTGG
FT                   FTMLFPEEARMDEGFYERHKEDYEDLTIIGSRQKENVAYTIHVIYENDEITEDIDTNLF
FT                   LLSSKAYADYDGEYKKMKGDKVTIYFAKNEQHTSINGKQDVVYKFFAYIKSNHSHQAVQ
FT                   FIYTIGCDDINKKCHIDIGKEEERAKMLMHSIKFQD"
FT   gene            466351..466560
FT                   /locus_tag="GTNG_0412"
FT   CDS_pept        466351..466560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65794"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKE0"
FT                   /protein_id="ABO65794.1"
FT                   /translation="MPQNLVLDTDLLRARIMALEYDHLTEAEIRRIYMEEAGKEPPAYI
FT                   KVYHSDDFKRGGISALMERLFILR"
FT   gene            466988..467587
FT                   /locus_tag="GTNG_0413"
FT   CDS_pept        466988..467587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0413"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65795"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKE1"
FT                   /protein_id="ABO65795.1"
FT                   /translation="MEEQKEQPKEWPDTVAFQDEYTRKFLVSPKEVKDGYYLFRSQTGG
FT                   FTMLFPEEARMDEGLYEKHEKDYERSFIRGSRKKENVAYTIHVIYENDEITEDIDTNLF
FT                   LLSSKAYADYDGEYKKMKGDKVTIYFAKKERHTSNNGKQNVVYKFFASIKSNHSHQAVQ
FT                   FIYTIGCDDINRKCHIDVAKEEERAKMLMHSIKFQD"
FT   gene            467599..469527
FT                   /locus_tag="GTNG_0414"
FT   CDS_pept        467599..469527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0414"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65796"
FT                   /db_xref="GOA:A4IKE2"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKE2"
FT                   /protein_id="ABO65796.1"
FT                   /translation="MMPQKLVLDTDLLRARIMALEYDHLTEAEIRRIYMEETGKEPPDY
FT                   IKVYHSDDFKKGRDFGFDGTIVHFYDEKQGINQKYTITRGSEEHENDTWKPHDWAYNMF
FT                   GILAGQSDRQYRYALRFDKIVTKKIQEELKRKRATIPLETIGMGHSLGGNLSQMLQLIE
FT                   KRFDHVYVINDAPPSVYQLSYLDEDFSYDLVETFNLKDKDFNAIYSLPPAELKAFAEEY
FT                   YKKHVDEHSIHHLTAEEDLLYAVSGVRGFIDIGSRDWIDTNNQFTSLKGLIEKIPDQDV
FT                   KAIQLYFSQYADVYNEKGLDGVVQAMTGVDLEWIESLTQYDVGDYVWNMPDIVEKVSDM
FT                   FKDMREKIPELLKHIKILQRHKEAILQAFVDSGFLTMEQKEAISQEVKHIEQDVKKLDQ
FT                   ILSDVRNNAVWFMALGGLSSGIALFVVFKQIKHYVTDILARLQTINRHMADVREAAVTS
FT                   VDAHSLHKVINTLARAKGREYDKQGNMILVGWIETEKGTKKIRLNISSAVRLYQKGLRI
FT                   TEEKEAVLRQIKWLYIQEYVEDFEGRKRQLIRKIEDMEQNPSAYQHLLGSFSYDAQQVY
FT                   VLRRIDVHESIPTMDPSIPDAFEGMFASYEQEIAKGRELIANIKQAFEQFFEKDKQLAN
FT                   LFDLRYE"
FT   gene            469543..469875
FT                   /locus_tag="GTNG_0415"
FT   CDS_pept        469543..469875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65797"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKE3"
FT                   /protein_id="ABO65797.1"
FT                   /translation="MRQLNMLYHFDVEQDLMDKATGFIQLLHRMQECDRDLVQVVRDAM
FT                   KDMQGKIADKTNEAIEQYQKRNEWQCEMYQNSMKTAALRYTNMINDMRGQNITLYYDVI
FT                   VREMKG"
FT   gene            470151..470444
FT                   /locus_tag="GTNG_0416"
FT   CDS_pept        470151..470444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0416"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65798"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="PDB:3ZBH"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKE4"
FT                   /protein_id="ABO65798.1"
FT                   /translation="MAGVIRLTPEELRGVARQYNVESSNVTELIARLDQMSHTLQGIWE
FT                   GASSEAFIQQYQELRPSFEKMAVLLNEVGQQLHNSATILEDTDQQIASQIRG"
FT   gene            470489..470914
FT                   /locus_tag="GTNG_0417"
FT   CDS_pept        470489..470914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0417"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65799"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKE5"
FT                   /protein_id="ABO65799.1"
FT                   /translation="MALFSVCMLDKEFNAVPLEHRECCDHSFQAHVGAAYRMGRSPQAT
FT                   MKLHFSMSMYIIGGFPTMYIQVTIDLRHYTHDVLDLRLSDLYSIKKMVEIVWQLKNIST
FT                   PPREGCWVRVENKQAVFPGCATLQASGITNGDRIVIL"
FT   gene            470949..472235
FT                   /locus_tag="GTNG_0418"
FT   CDS_pept        470949..472235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0418"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65800"
FT                   /db_xref="GOA:A4IKE6"
FT                   /db_xref="InterPro:IPR018778"
FT                   /db_xref="PDB:2YNQ"
FT                   /db_xref="PDB:4ANO"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKE6"
FT                   /protein_id="ABO65800.1"
FT                   /translation="MSEKKTYLETQLDAVMINDQPYTVIFQRAKLKMQDPLELEVLKEV
FT                   DPCIVRDIDVSEDEVKVVIKPPSSFLTFAAIRKTTLLSRIRAAIHLVSKVKHHSARRLI
FT                   FIVCPENLMFNRALEPFFLHVGVKESLPPDEWDDERLLREVKATVLALTEGEYRFDEYL
FT                   KFHETLKCSPIAKELWQADHLDAVLAVLEKWVDEEEAKERAKVHIPKKRWNMQRYIFFS
FT                   VIGLLIPAIIYVFYSFFFAQPKQEAYIQSTELFLQNKYSDVITTLEDYAPEDMPYVIQY
FT                   ELASSYVMTESLTEEQRQTVSNNITLKTDEQYMLYWIYIGRSQSEEALELARTIEDRDL
FT                   IVYALLKYREQIKGDTDLSGDEKQKKLDEIDQEIKEYERERKESEAQLEEEQQSEQQPP
FT                   ASTPAADSSSETTQSSHEPSVTNNQKSQK"
FT   gene            472272..476711
FT                   /locus_tag="GTNG_0419"
FT   CDS_pept        472272..476711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0419"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65801"
FT                   /db_xref="GOA:A4IKE7"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR022206"
FT                   /db_xref="InterPro:IPR023839"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:4LYA"
FT                   /db_xref="PDB:5FV0"
FT                   /db_xref="PDB:5FWH"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKE7"
FT                   /protein_id="ABO65801.1"
FT                   /translation="MSQLWVLYETYCQLFSLTNEEKVIVIGNQLEHHVTVSSFSFRNGY
FT                   IQIEKKSDGSTLAVLQGGRQIGELKPRCSITIDVDGQQMTIAWSGEEQRKYVYYVGQQS
FT                   EVLVSNDPQADIETTNARFSLRKHRGQWVVIPDDDAPLFLNGVQLSDAVSLRNGDVLLC
FT                   PYMQFVFIEEDLLAVTSSEEVVSSLTETMPPLSEMKKKYPMYRRTPRMIYELPSDKVSI
FT                   SFPSQEGDGDPRGLWLMVLPPVMMLLVIGAVALIQPRGVFIMISIAMFATTIVTSTAQY
FT                   MREKKARQMRKEKRRRIYTNYLEQKREELQALSEKQRNVLYYHFPSFEQMKSFVMQVNS
FT                   RIWERTAESADFLHVRIGTADVPATYEVSVSMGDLANREIDDLLEQAQHIAKVYQTVKH
FT                   VPLPIDVSHGAIGMVGKRSIVNGEIEQLVGQIAFFHSYHDVRFVAIFSEDDYKHWEWMK
FT                   WLPHFQLPNSFAKGLIYNEQTRDQLLSSIYEMLRERALDEEKDKKRFSPHFVFIVADRS
FT                   LIAEHVILEYLEEKNEDIGISVIFASETKESLTENVHTLVQYINEREGEIVIQHRKAAH
FT                   IPFQLDEHSTEGNESFARMLRSLNHQKGMSNSIPEKVTFLEMMQTRRANELQIVQNWLS
FT                   CQTSRSLAVPIGLKGRNDVVELNLHEKAHGPHGLVAGTTGSGKSELLQTYILSLAVHFH
FT                   PHEVAFLIIDYKGGGMAQPFKNMPHLLGTITNIHGSKNFSARALASINSELKKRQRLFD
FT                   RYEVNHINDYMELYKQGKAEQPLPHLFLIADEFAELKSEEPDFIRELVSAARIGRSLGV
FT                   HLILATQKPRGVIDEQIWSNARFRISLKMQDVNDSKEILRNGDAAAITVPGRAYLQVGN
FT                   NEVYELFQSAWSGAPYVEEGVEAEDEIHIVTDLGLVPVSNVATDRKRSRQKPKTEIEMV
FT                   VEQIIETQKQLNIEKLPSPWLPPLPPRLARPASVTAEANAFPIGLKDEPELQSQSDYFY
FT                   QWLEDGNIGIFGSAGYGKSTTMMTLLLSFAGAYNPAQLHYYIFDFGNSALLPLRQLPHT
FT                   ADYFRLDDEKKIEKFIKFMKEEMEQRKQRFMEKEVSTIKLYNALSEEKLPIIIVALDNF
FT                   DVVKEEMPDFETQLIQYARDGQSLGIFFIMTATRVSGIRPPLMNNLKTKIVHYFIDSSE
FT                   KFSLIGRTPYDVDPIPGRALIKKDNAALTQIYLPADGEDDIEVLENVKREMERLKEVYQ
FT                   HIPKPKPIPMLPPRLSMSVFTNTYVQHRASGFIPVGLDEQTVRPVAINMRTDPHCLIVG
FT                   QSRKGKTNVVKVILESLLVQEPESIGLLDGIDRGLAGYANRDDITYIEAKERLAQWLNE
FT                   ADAVLQQREREYIQAVNENRATTLAWPPVVFVVDSLLRLQQETDSIMQGRIANMMKQYS
FT                   HLGFHVFVAGNANEFVKGFDALTAELKQIRQAILVTKKSEQSLFALPFTRNEQEIEPGF
FT                   GYFVVGGKDQKIQIPKVE"
FT   gene            476735..479515
FT                   /locus_tag="GTNG_0420"
FT   CDS_pept        476735..479515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0420"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65802"
FT                   /db_xref="GOA:A4IKE8"
FT                   /db_xref="InterPro:IPR023838"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKE8"
FT                   /protein_id="ABO65802.1"
FT                   /translation="MNGKWKIAKLIGLIIFIVSLPVLFFAFIGQNPMKQTNKATNHIAV
FT                   VNEDMGAKYDQKTYFFGKEIVPALADRSSYHWSVVNRSQAENGLKNNEYDAVVYLPSDF
FT                   SRNILSFNDKQPLKATVQYKIQPNLDAKHRERVQRELEASKNMINQKMSTLYWSYVAQE
FT                   IAAIRKKFNDILEKEIAFQKAMYAFYTPSSAKLAEEIKRQKDMLQELLEASNNAKDSSA
FT                   GTLQGIEEAEAEITAFVDSLSQYREYQQRQNELLQEGIHEYKKRFNERMDLMLGKPWEV
FT                   KPDVRHQEQNLLESITTLRNTVAESHTSLMTFNEQLKQSTVQEQFEQLLTWKKEFVRQY
FT                   QIEVNNQTLDRLQQSLIEFRQKLQSPSPGQTDEEQPAPIEAPPQPADENLLDALQQQLA
FT                   NLKAQWQAFKPQSPQESWEHIEGSISQLETEMEKTKQAWQQQLALQQQWQQKYAQLVEQ
FT                   LNKQLTEGKADSIDDIVQQIKEKEQAVLASPALPESRKQVLSSHFEAVIQNRNTADLLD
FT                   YFAWLSIFDEAVQQTTRFDEELVDQLLMNWNQRDAIFQMLSDVRGYFEELEQHSASSLK
FT                   EVEAAEESTESFIETTLGYIQEYDENVQKMQETITGQLQELSDAVSEVTMQLQEAVNEG
FT                   QQTEEIWRGNDGEFVITIQQNTMQDVQQISDLIASIAEDQDHIVDYTNELHEKIDSVQT
FT                   KADELNDKWAANVNTTKQIRNDVYRLLNNTMIDQQANGYVYDYLTNPVQVRGDLPEEQT
FT                   TYTPPVVVLIIVLLCGMLIGFFLHYYSNSPFMLQLALLLLMNVVVGLIINIYSLKIYPM
FT                   QDVRAIKWSVLTIVLLFFCSSMVRLAFLIGPFTGWILGVGLVLFFITPLLDLVLPNFHF
FT                   EHPIAETYISIQYGDQQIFYSTVVMMGVLSLLMAAVPFLKHRLADQQEEGEMYEG"
FT   gene            479505..479987
FT                   /locus_tag="GTNG_0421"
FT   CDS_pept        479505..479987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0421"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65803"
FT                   /db_xref="GOA:A4IKE9"
FT                   /db_xref="InterPro:IPR018920"
FT                   /db_xref="InterPro:IPR020212"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKE9"
FT                   /protein_id="ABO65803.1"
FT                   /translation="MKDKGRFSFPFLLVLLLLMTVAKEVKADEGPSVEPNQYERNPVEL
FT                   RTDYIREQSLLNGKKELPKEQLTLTFQRSTPSVLERTKAQLFLSSERNTNTITTKAEKL
FT                   KLFSSAKEITTSSRPASNEEEATNSSHLLWVFGILIFALLAAMFAIVVPRMKQFVR"
FT   gene            480034..480381
FT                   /locus_tag="GTNG_0422"
FT   CDS_pept        480034..480381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65804"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKF0"
FT                   /protein_id="ABO65804.1"
FT                   /translation="MSEEHEIGEGIQVSSTLESIEKEIKRRAYETAISILRSYQGQVHE
FT                   AMGEFRDGIRSFHRANDEYIPHWQGEAREAYEWIYADLKQLETRIGTTADELVDEISRE
FT                   IARLRRKIEEL"
FT   gene            480388..481494
FT                   /locus_tag="GTNG_0423"
FT   CDS_pept        480388..481494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65805"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKF1"
FT                   /protein_id="ABO65805.1"
FT                   /translation="MIRLKPDELETVAGHIPEAEDACQRARTTLSWELSSLVMNLPGVS
FT                   TPAIEELRDELVHWLKRYEDKLNEAEELLYRTAAAMRQADQTLADNMKELGLEFLGWYD
FT                   VQRLFGEYDPVTGERLSAGDRLLAGGMLLLSVVPPAKGAGIAGKAAIKGAKALDTASTL
FT                   SKVKHVVHGDKIKGFFQTIYHQVVKAPLTETARLFKKQWDEFVESIASVSWQPAYAGDV
FT                   GLAFQGGMNEAKDVSLNMIKNVEGGAIGKSAKGTGKFSKYDVGLYKEIKGVPGLDAHHV
FT                   GQKVIMKKFIRNYDPNNAPAILVPKAGHTRKGPRGIVSRSSKGIESARQLLARDIMELR
FT                   RVYPDIPNSQLRKLIELNKQLYPEMRRR"
FT   gene            481491..481850
FT                   /locus_tag="GTNG_0424"
FT   CDS_pept        481491..481850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0424"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65806"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKF2"
FT                   /protein_id="ABO65806.1"
FT                   /translation="MRYMNKEEFVKLLHQSIIKENRNFYRDIFNNTDINEVTDPYWKEA
FT                   LMFYSELSDKNKEILFKIIEQVEVDAVSNILGVLDGVVSIGEEDIEFKVTINNNNEPIN
FT                   GDLQDLFLEYDEENR"
FT   gene            482067..483008
FT                   /locus_tag="GTNG_0425"
FT   CDS_pept        482067..483008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65807"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKF3"
FT                   /protein_id="ABO65807.1"
FT                   /translation="MGLEFLGWCAYSASTIRSLGSACRLGIGCWQLGCWLLSVVLPAKG
FT                   AGIAGKAAIKGAKALDTASTLSKVKHVVHGDKIKGFFQTIYHQVVKAPLTETARLFKKQ
FT                   WDEFVESIASVSWQPAYAGVGPASRVWMSGSKNEVKDATFHMIKKAEGEAVGRGTNKLY
FT                   RGDSLLHSSKRPNGIGKPFISDSGNLVPANSKGIYKNRQVTVIEHILGGYRRKAKSNSP
FT                   YISFTGNKLVVGNYGDYLIELDISSLRKAIRSGEVKNVAILSPKQIRKLIERDRSFSDF
FT                   WKKRALNWTERDNEYLIRGEVPSKFIKIYPRE"
FT   gene            483018..483299
FT                   /locus_tag="GTNG_0426"
FT   CDS_pept        483018..483299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0426"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65808"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKF4"
FT                   /protein_id="ABO65808.1"
FT                   /translation="MFLYFQNECLGEIQDINTEGMWVYGKLIANQNMVKFRKFFEDLTN
FT                   EENHFKESEYNEEWLNDDNWFVVDSHGDKKGIYLPAVYEDGEINWRWR"
FT   gene            483824..484384
FT                   /locus_tag="GTNG_0427"
FT   CDS_pept        483824..484384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0427"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65809"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKF5"
FT                   /protein_id="ABO65809.1"
FT                   /translation="MRFYKLLMDDSDDRDVVAHCIDTKGFEQYELSEGKYIHNWNSEIT
FT                   FYFDPKEAEKLTDYLANNLGWFIVSERFKAILEEVDSGIQYLPVNVVNKGENKILKGFS
FT                   VANILNVVDALNLEHSDYSVFELDGERIYSIKKYALCKEAIQSKHIIKLKGDEIPIFIS
FT                   EELRELIEKNNITGFDFLEVKVI"
FT   gene            484781..485260
FT                   /locus_tag="GTNG_0428"
FT   CDS_pept        484781..485260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65810"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKF6"
FT                   /protein_id="ABO65810.1"
FT                   /translation="MVRLFGEYDPVTGERLSFGDRLLAVGMLLLSVVPPAKGAGIAGKA
FT                   AIKGAKALDTASTLLSKVKHVVRSDQIKGFFQTIYHQVVRAPLLETARLFKKQWDEFVE
FT                   SVASVSWQPAYAGVGPASRGWMSGFKNEVKDATFHMIKRVEGETVGKGIISSTTK"
FT   gene            485387..485719
FT                   /locus_tag="GTNG_0429"
FT   CDS_pept        485387..485719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0429"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65811"
FT                   /db_xref="InterPro:IPR026834"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKF7"
FT                   /protein_id="ABO65811.1"
FT                   /translation="MSRRVYQIEIEKNYVPKDPAAAGVTNKELMLKGKSPYVVKDRKES
FT                   KVELHKLIQKEPRGMVEIAESIHNKFSRELHGLVEDGNSFRNDSLLEKQCNNFRSNYWK
FT                   MRANED"
FT   gene            485737..486162
FT                   /locus_tag="GTNG_0430"
FT   CDS_pept        485737..486162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0430"
FT                   /product="Spore coat protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65812"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKF8"
FT                   /protein_id="ABO65812.1"
FT                   /translation="MNEKIKKMIEEYGEERDFFGGASEQEIRKAEEILGLQFPESYRAF
FT                   LKEYGSGGICGVEILGIEGNLGASVVKATERWRKLGLDKKLIVIEDSGEFVRCMYSADV
FT                   RDEKVYSWVRGGKELSVRYDTFDDYIMDMFQEGIDNL"
FT   gene            486490..486999
FT                   /locus_tag="GTNG_0431"
FT   CDS_pept        486490..486999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65813"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKF9"
FT                   /protein_id="ABO65813.1"
FT                   /translation="MLLLSVVPPAKGAGIAGKAAIKGAKALDTASTLSKVKHVVHGDKI
FT                   KGFFQTIYHQVVKAPLTETARLFKKQWDEFVKSVASVSWQPAYAGDVGLALQGGMNEAK
FT                   DVSLNMIKNVEGGAIGKSAKGTGKGLLPGEGKVGTYKQLIKQGKAFDNLTPHHMPSAEK
FT                   SRYKAK"
FT   gene            487010..487255
FT                   /locus_tag="GTNG_0432"
FT   CDS_pept        487010..487255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0432"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65814"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKG0"
FT                   /protein_id="ABO65814.1"
FT                   /translation="MNMEQPHPGTGGRHRRTYTYGLSGEKLNDYLNLSYRDALAHDIWD
FT                   ARRIYMKDGLYTPKIRKSLRDVIQLNKELYPELFKK"
FT   gene            487279..487740
FT                   /locus_tag="GTNG_0433"
FT   CDS_pept        487279..487740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0433"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65815"
FT                   /db_xref="InterPro:IPR029084"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKG1"
FT                   /protein_id="ABO65815.1"
FT                   /translation="MDIKSEIKKVYDNRLLKTEKQVEEFEQALKNIYEYGEVSIIKDLI
FT                   LAFDDNTEHHEVMFNLVHTIEHLYKNKIEEGLKLIATSVPTVISYGREWIEILHYRILN
FT                   HPHVRTIYAKVLENIDIKTRNIIKDLLGDIKKEDPELFGESVDEVLDNI"
FT   gene            488151..488939
FT                   /locus_tag="GTNG_0434"
FT   CDS_pept        488151..488939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0434"
FT                   /product="Site-specific recombinase, resolvase family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65816"
FT                   /db_xref="GOA:A4IKG2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKG2"
FT                   /protein_id="ABO65816.1"
FT                   /translation="MNVVGYIRVSTQGQARDGYSLKYQEEEIKAYCEKNGWNLIHIFRD
FT                   EGISGAKMNEEAFEVDRVGLQEMLAHLSSLQIKYGVVLNTSRLWRSDMVRVLIHRELQK
FT                   YGVDIKSIEQPSYSIYKKDPSDVLVNGLMELLDQYQRLEIALKLKKGQHKKAKEGGYAG
FT                   GRVIFGYTKPKGEKELKVHHEQAKVVKRVFELKRKHPQGSLAHIARVLNDEGYKTAQGK
FT                   PFTKVQVKRILDRKSFYQGMYTYGPIQAHGKHEAILSNVT"
FT   gene            complement(489132..490007)
FT                   /locus_tag="GTNG_0435"
FT   CDS_pept        complement(489132..490007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0435"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65817"
FT                   /db_xref="GOA:A4IKG3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKG3"
FT                   /protein_id="ABO65817.1"
FT                   /translation="MEILEINRSTYYYQQNGKVEKKTVDGGRPTPGCSLTATGEKVPDE
FT                   QIQEWLSELVMGEGFAYGYHKLTIQLRRDHQLVISKKKVYRLCKAMDLLRPQREKRIPY
FT                   PKKHARNRIITGSNQLWEMDVKYGYIEGEERFFLVLSLIDVYDRSVIDYHIGLSCSGSD
FT                   AVKTLQRALFKRQQFEQANKPVIRTDNGPQFISHAFEAACERFGIEHERIPPRTPNMNA
FT                   HMEAFHRLLEEECLGRMAFDSYEEAYQAVMEYMKFYNERRIHSSILDLPPHEFHKKAQT
FT                   ESLIIKEVRV"
FT   gene            complement(490049..490366)
FT                   /locus_tag="GTNG_0436"
FT   CDS_pept        complement(490049..490366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0436"
FT                   /product="IS426 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65818"
FT                   /db_xref="GOA:A4IKG4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKG4"
FT                   /protein_id="ABO65818.1"
FT                   /translation="MYMKRRKHSKEFKLQVVKEALEVGNKALVARRYELSPNLVQRWVK
FT                   AYEEGKLGQEMVSSPSSAEIKRLEEENEQLKKLLGEKDLEIAILRDLIKKKNPHLLKNW
FT                   K"
FT   gene            490745..491263
FT                   /locus_tag="GTNG_0437"
FT   CDS_pept        490745..491263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0437"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65819"
FT                   /db_xref="GOA:A4IKG5"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKG5"
FT                   /protein_id="ABO65819.1"
FT                   /translation="MKKVINIIWNISFIFYLLALVMLLFVGVMFVGARGHVWTDLSLIE
FT                   YLRRSSNFVPFKTISIYIKAMFNGSLNISIPIKNLLGNLIMFLPMGIYLPYYIKKINKV
FT                   GRFTFSMIILLFVIEVTQLVTRRGSFDIDDFILNIVGAWIGFIIWKTKTVQRLLKLDVS
FT                   YSSAKEGFR"
FT   gene            491891..492247
FT                   /locus_tag="GTNG_0438"
FT   CDS_pept        491891..492247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0438"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65820"
FT                   /db_xref="GOA:A4IKG6"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKG6"
FT                   /protein_id="ABO65820.1"
FT                   /translation="MAKKIGLFIAGAAALMVLLFHLGPLVGLAITLAILYYAFKKYLKA
FT                   PSTFGKIAWALIGCAALVISVSNVPALIALVAAYVLYVVYKKWNSAKGERTVPGTDDPF
FT                   VNFEKQWAELQKHH"
FT   gene            492275..492901
FT                   /locus_tag="GTNG_0439"
FT   CDS_pept        492275..492901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0439"
FT                   /product="phage shock protein A-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65821"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKG7"
FT                   /protein_id="ABO65821.1"
FT                   /translation="MMGLFSRLKTIIEADLHEWLDEKEKKNPIALLNHYLRQCEQEVER
FT                   VRQLLERQYVLKEKFAREHHEAEQMAEKRAKQAEVAERAGEEGLAEFARREQAQYTERA
FT                   ARLKQLLEQASHELFELEAKYEDMKHKLKDMQMRRMELMGRENAARAHYRIHRVINGDT
FT                   GPAQAAFADAEVYLDRLERQVQSDYYRNTIDARIAQLEKQLQEGK"
FT   gene            492966..493697
FT                   /locus_tag="GTNG_0440"
FT   CDS_pept        492966..493697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0440"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65822"
FT                   /db_xref="GOA:A4IKG8"
FT                   /db_xref="InterPro:IPR016975"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKG8"
FT                   /protein_id="ABO65822.1"
FT                   /translation="MLDQQKKTDYVSWAVLLIFLLFVVEIAFFHPGLLFSIGLAIALLY
FT                   IGKQSWPRKRGKVLFWIGGISLVFHVFTMVTARLVIVAGLFYVLWKFFQSKQQPTVIRP
FT                   VIIEAKDSQGEVIDRKPLFHNVLFGRQTTPEHVYEWDDVNIQTGIGDTVIDVSNTVLPK
FT                   GEAVIVVRGLIGHVRVLVPYEVETKVVHSAIFGGGTVFGQEARHLLNQTLIYQTPSYQA
FT                   AERKLKIVTSLMIGHLEVKRL"
FT   gene            493694..494719
FT                   /locus_tag="GTNG_0441"
FT   CDS_pept        493694..494719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0441"
FT                   /product="Two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65823"
FT                   /db_xref="GOA:A4IKG9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017202"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKG9"
FT                   /protein_id="ABO65823.1"
FT                   /translation="MSRPLMVSVLSALILFILLSLSFVYVFPPETWAELWDKTVMGVPF
FT                   LLFVSVVSLLIGIASGLVLDFVWRKQRQVVMQALEQIEHGEMGELWREEPSPELQDLWR
FT                   QIEKLQTQWLEQTKRVQKLAAEKVEQEERLVERILSEERTRLARELHDSVSQQLFAASM
FT                   MMSAITETMPPDDERQRKQLKMVEQMIHQSQLEMRALLLHLRPVQLKGKSLQEGMEELL
FT                   TELTGKVPLEMKWKIEDVPLDKGVEDHLFRILQESLSNTLRHAKAKTVEVLLIERDGFA
FT                   ILRVTDDGVGFDVERSKSGSYGLQHMYERAAEIGGTLKVVSLKGQGTRLEVKVPLVYKG
FT                   G"
FT   gene            494722..495354
FT                   /locus_tag="GTNG_0442"
FT   CDS_pept        494722..495354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0442"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65824"
FT                   /db_xref="GOA:A4IKH0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKH0"
FT                   /protein_id="ABO65824.1"
FT                   /translation="MIKVLLVDDHEMVRLGVSAYLSAQPDMEVIGEAEDGQKGVELALT
FT                   LRPDVILMDLVMEPIDGIAATQEIMSAWPEAKIIVVTSFLDDEKVFAALEAGATSYLLK
FT                   TSKASEIADAIRATFHGQSVLEPEVAGKVMQNRRRQRARLPHEQLTSREMEVLLLMAQG
FT                   KTNQEMADELFISLKTVKVHVSNILAKLGVQDRTQAVIYAFRHGLVK"
FT   gene            495729..497186
FT                   /locus_tag="GTNG_0443"
FT   CDS_pept        495729..497186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0443"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65825"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKH1"
FT                   /protein_id="ABO65825.1"
FT                   /translation="MLEARWKFDNSYARLPERLFSNVLPTPVRAPKLVVLNRSLTAELG
FT                   LNEEALRSEEGVEVLAGNRIPDGARPLAQAYAGHQFGYFTMLGDGRAVLLGEHITPSGK
FT                   RVDIQLKGSGRTPYSRGGDGRAALGPMLREYIVSEAMHALGIPTTRSLAVVTTGETIIR
FT                   ETELPGAILTRVASSHLRVGTFQYAAQWGTREELCALADYALERHFPEFEAVANRYLFL
FT                   LEQVIKRQAELIAKWQLVGFVHGVMNTDNMTISGETIDYGPCAFMDTYDLKTVFSSIDT
FT                   EGRYAYGHQPYIGGWNLARFAESLLPLLDDKKEKAVELAEEALGQYSKWYEYYWLGGMR
FT                   AKLGLAEEQEHDAELITELLRLMEEYRADYTNTFRALTLGEYTGMELFDTSEFREWHER
FT                   WQTRLSKESVSREEAYERMRRHNPAVIPRNHRVEEALAAAVNCGDYQVMARLLKALADP
FT                   YAYSPEQAEYAELPPPSDQPYRTFCGT"
FT   gene            497406..498158
FT                   /gene="tipA"
FT                   /locus_tag="GTNG_0444"
FT   CDS_pept        497406..498158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tipA"
FT                   /locus_tag="GTNG_0444"
FT                   /product="Transcriptional activator TipA"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65826"
FT                   /db_xref="GOA:A4IKH2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKH2"
FT                   /protein_id="ABO65826.1"
FT                   /translation="MHELAKLAGVTSRTLRYYDEIGLLKPARLSDAGYRLYGPREVDLL
FT                   QQILFYRELGVDLETIKQIVHSPEFDELEALRQHRQQLLEKRRHLDALIASVEKTIIAK
FT                   EGGITMSDKEKFAAFKERLIEENERKYGEEIRQKYGDEQVDRSNNRLRNMTKEQFDEAE
FT                   RLGKEVLEVLKEAMQDGDPAGEKAQRAADLHRQWLCFWWDHYSKEAHAGLAHMYVEDER
FT                   FKAHYDQVHPGAAEFLKEAILIYTGMKK"
FT   gene            499131..500834
FT                   /locus_tag="GTNG_0445"
FT   CDS_pept        499131..500834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0445"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65827"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKH3"
FT                   /protein_id="ABO65827.1"
FT                   /translation="METLRKQLRAIDQKGYKAYKAIEGTYSFPAFTLAIDHVQGDPFAE
FT                   PSKIRVIVPRAKTVLAAEWTNTTPRRIRCEDVVARRVHYELRQWPSRVRGSGKSGLVLI
FT                   DAPGQKVLERTAVLIGDETITVCLSVGLPANGRRILAKEAESIFFEQIPAVIERAVYGL
FT                   REGDIRPAVELADQQHTIRRYLHEHGLVAFVANGSILPRESGVSDKPLRQGAVPFQSPP
FT                   ELEVAIPVPHRTEPVKGMGIPKGITLIVGGGYHGKSTLLQALEHGVYDHISGDGREFVI
FT                   TDSGAVKIRAEDGRSVAHVDISPFIGMLPYGKETTRFSTENASGSTSQAASMIEMIEAG
FT                   ASAFLIDEDTSATNLFMRDARMQALIAKEAEPITPYIDKARQLFHDYGISTVFVVGGLG
FT                   DYFEIADVVIKMEQYVPSDVTVEAKRIAANMPSGRKAEGGESFGHIRERIPRPESLNSQ
FT                   KGKKAKVTARGRHVIQYGQTDVLLYALEQLVDDSQTRAIAAALFHIERKGWLDGKKTVR
FT                   QLLDAIEEQWDRHGLGSVSFRNGHPGELARPRRFELAAALNRLRTLRCSQ"
FT   gene            501206..501574
FT                   /locus_tag="GTNG_0446"
FT   CDS_pept        501206..501574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0446"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65828"
FT                   /db_xref="InterPro:IPR018745"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKH4"
FT                   /protein_id="ABO65828.1"
FT                   /translation="MNKSKGWIESEISKALTKWEKDFLGRGSLSVKTDILRDMIIVSLH
FT                   GILTPAEYALCESKEGMLAVKRSRTSLVESGVNDLKEMIFEITGEQVKSFHTDLSTQTG
FT                   ERIIVFKLFNNLEKQLVK"
FT   gene            502032..503534
FT                   /locus_tag="GTNG_0447"
FT   CDS_pept        502032..503534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0447"
FT                   /product="NADH dehydrogenase, subunit 5"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65829"
FT                   /db_xref="GOA:A4IKH5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKH5"
FT                   /protein_id="ABO65829.1"
FT                   /translation="MGMEWFVWGWLVAVGIVFASAIIWLFPRMPEQYVCIHVWLLLLPG
FT                   AAALAGWISAGTVEVGMWRFDTVSWLVGIYISLLSWAIQRFALRYLYGDRAYRFYFSLL
FT                   TWTAFAASLTWAGGDLRLMAICWGMPLIGLVALTALKKEWGPARFVARQMALVFGISWL
FT                   AVTVVAVWLGTATGEWQLASALSVDPLARLDAWEKAVMNGLLILAAIIPAGQWPFHRWL
FT                   MESAVTPTPVSAIMHAGIVNAGGLLLWCFSPLFSGTGAHAALFLIAFFSILIGTGISLV
FT                   HVDYKRQLVASTMAQMGVMFVQCALGVYGGAVAHLMLHGLFKATLFLQSGSVVPQVGGA
FT                   GYRKAGGSWRSGMIVGALLGTAFWLFASGEPARLLSALLFGASASVAWGRLADFREGRW
FT                   FGFAVVATLAFVSETVRHQFMVLFNEERAFSFVPSASFEWMVGMIFAAAALAAVWIANR
FT                   RTSMLAVRLYMRFVHFGEPRPAAMETHPHYLTTYMKEGMARE"
FT   gene            503542..506169
FT                   /locus_tag="GTNG_0448"
FT   CDS_pept        503542..506169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0448"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65830"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKH6"
FT                   /protein_id="ABO65830.1"
FT                   /translation="MSLERTVVMLNEDDTQGRPLADLVKEAAKSIAPLWPISSFIARHP
FT                   WMGLEGELFADAADRWQQVYGIDLYPPMTVFYTALKKGEIDPVFVERRLQSWLDKQSLP
FT                   VPRHEAERLCRSFLWNDTVPEEAFSLPEMAQLAEGTQLRPMAVQPISKRLDQIAKRLDQ
FT                   QMIKWCKLFYDESGGTWTLPQREQGFYQAWRQLVVTDPSLSKDERKRFSGWPHDKHEAL
FT                   NYALEKLGIRDEDVVAYLEAHLLALPGWAGMAVWRSHRAGDEVGGLIDYLAVRLSIEWV
FT                   LTAPHLPLHGEENGERRDVLPLLAAWFYWTGMTPEDWRRLRTNEQQARLAFADRFWRID
FT                   RHHLWLEAWEDTDEAKLKEAVSTRHRMSEPEQVAAQLLFCIDVRSEPFRRHLEAAGPFE
FT                   TYGCAGFFGLPIQTRVLDSEDVHPSCPAIVDPRHEIREVAPPEEVEPYRFRRDMFRFVS
FT                   KTFKKMKQHVLAGLLLPEMSGPWLGLHTLARSAAPAWAGQVIRYTKKSVEQKPKTTLSL
FT                   HYHEGDETTGLPIGLTNEEQVEYVKQLLVTIGLTSSFAPLVVVCGHGSETTNNPYASAL
FT                   DCGACGGVAGAFNARVFAALANLPSVRAELAKEGIVIPDETVFVAAEHITTVDELRWLE
FT                   VPPLSEAAQQSFDRLKQALHDVSRQANAERMMKLPHVGGKPRDPVAEAQRRAVDWSEIR
FT                   PEWGLAGNTAFFIGRRALTKGVHLDGRVFLHSYDWRDDPTGEALARIIAGPATVGQWIN
FT                   LQYYASTVAPHYYGSGDKTTQTVTGGIGVMQGNGSDLLAGLPWQSVVSSDRELFHFPLR
FT                   LLVIIEAPSYYIERLLNENSEFRRKVENGWLRLSSIDPNSGAWMKWGDTHSLSVWSREM
FT                   GIGK"
FT   gene            506278..506820
FT                   /locus_tag="GTNG_0449"
FT   CDS_pept        506278..506820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0449"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65831"
FT                   /db_xref="GOA:A4IKH7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKH7"
FT                   /protein_id="ABO65831.1"
FT                   /translation="MERELIERIQHGDEAAFAELYELYGEYALRVAAAVTGSSANAADA
FT                   VQETFIRVYDHIGRFDPAKPFRPWFYRILINECRRLMKKQRAVTILSEEMGAADLLTYE
FT                   DRYTFAQYEELYKAIGRLKEKQRIPVVLKYLQGFTTEEIADILDLNVNTVKSRLFKARN
FT                   QLMKWMEMEGERGATNG"
FT   gene            506813..507556
FT                   /locus_tag="GTNG_0450"
FT   CDS_pept        506813..507556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0450"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65832"
FT                   /db_xref="GOA:A4IKH8"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKH8"
FT                   /protein_id="ABO65832.1"
FT                   /translation="MDERKWDEMIQEALLYGTDKAAEQKEEVWMHIRSRMVKQQRKRRR
FT                   GGKWIWTMASAAAAVMLAFLFTPPGQAAIDQVKQWFVPKKVVTEEIEGQKEQKEVTLKE
FT                   GKAGYVIYIDESMYRLEKGDGYDRIVPLHQGNANIPPVYMEIRQVTDQSPETVAAELEQ
FT                   EVKGKYPIIIQNGKVNEPVAGYVIQGEAGYQWNDEVVRYYVVPNGKGGAFIIEQRYFLE
FT                   ASEGHGARFDHMLKQFHIVDKQQGK"
FT   gene            507667..507984
FT                   /locus_tag="GTNG_0451"
FT   CDS_pept        507667..507984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0451"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65833"
FT                   /db_xref="InterPro:IPR024617"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKH9"
FT                   /protein_id="ABO65833.1"
FT                   /translation="MKTQFIAGHARLPAGMAAKSLYDTLTITAEIDKKYGVIVEASCTL
FT                   ATEHGRDYVARLLRGHSLRDGIDGLLAELDAGYLGKAHSALCAALKDLYKQYCKMDEKE
FT                   Q"
FT   gene            complement(508068..509264)
FT                   /locus_tag="GTNG_0452"
FT   CDS_pept        complement(508068..509264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0452"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65834"
FT                   /db_xref="GOA:A4IKI0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKI0"
FT                   /protein_id="ABO65834.1"
FT                   /translation="MNFDFTPEQEMLRQTVRKFVDKEIMPYIKEWDERGEFDRNIFKRL
FT                   AELNLMGVCIPEQYGGMGMDYNSLAIVCEELERGDTAFRTAVSVHTGLNSLTLLQWGTE
FT                   EQKQKYLIPQARGEKIGAFGLTEPNAGSDVASIQTTAVRDGDDYILNGQKTWISLADIA
FT                   DHFLVFAYTDKSKKHRGISAFIVERTMPGFSSRPIKGKLGIRSGNTGELFFDNVRVPKE
FT                   NLLGEEGEGFKIAMSALDNGRFTVAAGAVGLIMACLEASVKYCHERKTFGKEIGRHQLV
FT                   QQMIARMEAGLQISRLLVYKVGFLKNEGRRCTRETSLAKWIACDYANQAADDAVQVHGA
FT                   YGYSNEYPVERYLRNSKAPVIYEGTREIHTIMQAEYVLGYRKDKPLRKTLPAWRPDEN"
FT   gene            complement(509364..510545)
FT                   /locus_tag="GTNG_0453"
FT   CDS_pept        complement(509364..510545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0453"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65835"
FT                   /db_xref="GOA:A4IKI1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKI1"
FT                   /protein_id="ABO65835.1"
FT                   /translation="MGGALDGVRVLDLSRVLAGPYATMILGDLGADVIKVEAPGGSDDT
FT                   RFWGPPFKNGMSAYYTAVNRNKRSITADLKTEEGRKTVCRLAETADVVIHNFKTGTMEK
FT                   WGLGYEELSRLNPRLIYCSITGFGETGPLAPLAGYDYIIQAMSGWMSINGTPDTGPLKV
FT                   GVAVTDVFTGLYAAIAIEAALLAREKTGCGQKIDLSLFDCAIGALVNVAANYLLSGNIP
FT                   KPLGNEHPNIVPYSTYEASDGPIVIAVGNDRQFQALCSLLSDRSIGTDPRFQTNPGRVA
FT                   HRDELNRRLNEEIKQRTRAEWQRLLAEKGIPCGPVQTLDELFRHPQTAAREMMVIMHHP
FT                   TVGSLPLVASPLKLSETPVSYRLPPPLAGEHNNESDIGWRNEQTLQSDRNESS"
FT   gene            511084..511914
FT                   /locus_tag="GTNG_0454"
FT   CDS_pept        511084..511914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0454"
FT                   /product="Putative lipopolysaccharide glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65836"
FT                   /db_xref="GOA:A4IKI2"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKI2"
FT                   /protein_id="ABO65836.1"
FT                   /translation="MFRILVTTDANYLPPLKVLMHSLFCNNRRPFTFYLLYSRIAEEEI
FT                   RALSDFVRKQGHELVPIYVDPQLFHDAPVFRHYTAEMYYRLAAHMFLPSDVERVLYLDP
FT                   DIVAINPIDELYEMDFEGNWFIAAEHTHSTKVANLFNKLRLKTPNAKGYFNTGVMMMNI
FT                   AMMRQHVQLEEIYQFIRDNRFKLVLPDQDVLNGLYWDKIKPVDGYRYNYDARYYDFLQL
FT                   LPNPKHDLSWIEKNTVFIHYCGKEKPWKQNYKGELGLFYKRYSQMLELEGEAMV"
FT   gene            complement(512121..512303)
FT                   /locus_tag="GTNG_0455"
FT   CDS_pept        complement(512121..512303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0455"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65837"
FT                   /db_xref="InterPro:IPR025435"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKI3"
FT                   /protein_id="ABO65837.1"
FT                   /translation="MGRSRGQRARDKNKATLPQVPKQLKDNIDVEYSEEFADHEDLEAQ
FT                   ARAAAAGIRRQERKR"
FT   gene            complement(512652..513206)
FT                   /locus_tag="GTNG_0456"
FT   CDS_pept        complement(512652..513206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0456"
FT                   /product="ribosomal-protein-alanine acetyltransferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65838"
FT                   /db_xref="GOA:A4IKI4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039135"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKI4"
FT                   /protein_id="ABO65838.1"
FT                   /translation="MLKKRELQDCHALYELMVHPDVFPFVRQKASSYEEFLFMTKQLIE
FT                   AEERGEVISRTILDEWGNSIGTISLFDIQDGAGFLGTWLGKPYHGLGYNRRAKEAFFHE
FT                   LFYELSIETVFLRIRKVNVRSIKAVEKLPYVTSANETRRTLLEQIGADVYNLYEITKDN
FT                   YTLYTMRHPSFTLEEEQRKEA"
FT   gene            complement(513458..514375)
FT                   /locus_tag="GTNG_0457"
FT   CDS_pept        complement(513458..514375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0457"
FT                   /product="Cell division inhibitor-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65839"
FT                   /db_xref="GOA:A4IKI5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKI5"
FT                   /protein_id="ABO65839.1"
FT                   /translation="MRIAINGGTGLIGQALAHSFSKQGHDVYIFTRSPKPSEGNIHYLS
FT                   FNDSQKPTAIDVALNLAGEPLNRKRWTTKQKTVIVDSRLRATEAMVNYIHSLSKRPSLF
FT                   INASAIGVYGTSDSATFTEQTTDYGADFLAKTVRAWEAAAHPIEQSGIRTVYARFGVVF
FT                   ARHGGALPMMVIPYRLFIGGRIGSGHQWLSWIHLEDVTRAIAYIIEHDELAGPVNFTAP
FT                   HPVQMDEFGRTVSRLLRRPHWLPVPAAALRLLLGEMSMLITEGQRVIPEKLLQAGFRFS
FT                   FPTLEDCLKDLVLSQDEQKISKKN"
FT   gene            514511..515320
FT                   /gene="recX"
FT                   /locus_tag="GTNG_0458"
FT   CDS_pept        514511..515320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="GTNG_0458"
FT                   /product="Regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65840"
FT                   /db_xref="GOA:A4IKI6"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKI6"
FT                   /protein_id="ABO65840.1"
FT                   /translation="MGTIVDITVTKENAERFWIVIHRDNESALKLTVDQDVLLKFRLKK
FT                   GMIIDDALLRDIVYADGIKKAYQQALYFLAHRMRSEQEIVEHLRKKGVVDPVIEEVLEK
FT                   LRAERYVDDEAFAAAYVRTQKNTSTKGPRLIQAELERLGVPASVIEQSLVEYSFNEQVI
FT                   AARSLYEKAKKQRRAESARAFLERVKQQLMRKGFSHEVIAIVLADGSGHTEEEEREALH
FT                   VQAEKIRRRYAHHPRPLYEQKMRQALYRKGFSLALIDEWLRRQDDDG"
FT   gene            515389..515724
FT                   /locus_tag="GTNG_0459"
FT   CDS_pept        515389..515724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0459"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65841"
FT                   /db_xref="InterPro:IPR014938"
FT                   /db_xref="InterPro:IPR036289"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKI7"
FT                   /protein_id="ABO65841.1"
FT                   /translation="MLKEEQKRYSEMTKEELQQEIAVLTEKARKAEQMGMVNEYAVYER
FT                   KIAMARAYMMNPADFQPGEIYEIEGAPGEYFKVRYLKGVFAWGWRLKGNGEEEALPISL
FT                   LRKPNLP"
FT   gene            complement(515850..516011)
FT                   /locus_tag="GTNG_0460"
FT   CDS_pept        complement(515850..516011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0460"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65842"
FT                   /db_xref="InterPro:IPR025413"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKI8"
FT                   /protein_id="ABO65842.1"
FT                   /translation="MGHHRRKAFYDNLYSNPFPQPWANRKHAHAQVNGETRQPLNLIIL
FT                   ERETRKRS"
FT   gene            complement(516086..516352)
FT                   /locus_tag="GTNG_0461"
FT   CDS_pept        complement(516086..516352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0461"
FT                   /product="small acid-soluble spore protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65843"
FT                   /db_xref="GOA:A4IKI9"
FT                   /db_xref="InterPro:IPR012611"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKI9"
FT                   /protein_id="ABO65843.1"
FT                   /translation="MFVPTICTHKHTRLSHNKNTCWPSQHEHSIKGECAVRNKEHNFPN
FT                   QNNNKFEGEPRAKSEYASKRADGTTNTHPQERMRASGERSDFF"
FT   gene            complement(516371..517351)
FT                   /locus_tag="GTNG_0462"
FT   CDS_pept        complement(516371..517351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0462"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65844"
FT                   /db_xref="GOA:A4IKJ0"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKJ0"
FT                   /protein_id="ABO65844.1"
FT                   /translation="MDTGTHVLMGVALGSLASLDPAIAHDPLLSRAVLIGTLAGSQAPD
FT                   IDTILKLHNNAKYIRNHRGITHSIPSVILWPLLIVGVMTAVYPETDWFRVWLWTFIAVA
FT                   FHVFVDIFNAYGTQALRPFTKKWIALGVVHTFDPIIFVLHLLGIGGLLLGAHPGYTFFT
FT                   IYVIIAAYYVLRFRQQANIKQLVRSTIDGVTEIITVPTWRPREWHLAISTSDEFYVARI
FT                   KRGRLLILDRFQKRPLPDHPVMNAAKRDENVAAFLSFSPVYRWEMNEYDDHYEVRFTDL
FT                   RYRSKGYYSFVAVVQLDRNLNIVSSYTGWIFSEGRLRKKLELAPN"
FT   gene            complement(517702..518190)
FT                   /locus_tag="GTNG_0463"
FT   CDS_pept        complement(517702..518190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0463"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65845"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKJ1"
FT                   /protein_id="ABO65845.1"
FT                   /translation="MAKPITTIQKHEMTEEEKRAEALAKLKAAVGDSEEAVHELLEFIE
FT                   QLHESGLLEAANALLKAREDVAKIVVGQLNQKPVTTMVNHAFALASLASSLDPERTAKL
FT                   LEHIASGAIEAYEQTSVEPTKVGLFDLFKALNDPDINRAVRFFLSALKAIGQRLGNDS"
FT   gene            complement(518183..521149)
FT                   /locus_tag="GTNG_0464"
FT   CDS_pept        complement(518183..521149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0464"
FT                   /product="Formate dehydrogenase chain A"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65846"
FT                   /db_xref="GOA:A4IKJ2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKJ2"
FT                   /protein_id="ABO65846.1"
FT                   /translation="MMETRTVTVTINGRPYHVKQGMTILETVNEHGLPHPQVCYTPELG
FT                   AIQTCDTCIAEVNGTLLRACSTLVEDGMVVELSSPRAKVVQKEAMDRLLENHLLYCTVC
FT                   DNNNGNCKLHNTTEMMQIEHQTYPYRPKVDPSEVDMSHPFYRYDPNQCIACGQCVEACQ
FT                   NLQVNETLSIDWEAERPRVVWDGGVPINESSCVSCGHCVTVCPCNALMEKSMLGEAGFM
FT                   TGLDQDVLKPMIDFVKEVEPNYTSIFAISEIEAAMRQQRIKKTKTVCTFCGVGCSFEVW
FT                   TKGRKILKIQPVSEAPVNAISTCVKGKFGWDFINSEERLTKPLIRKGDTFVESTWEEAL
FT                   DLVAEKLGAIKQQYGGNAIGFISSSKISNEENYLMQKLARQVFETNNVDNCSRYCQSPA
FT                   TDGLFRTVGMGGDSGTIYDIASAGLVIIIGANPAEGHPVIATRVKRAHKLFGQKLIVAD
FT                   LRRNEMAERADLFIRPKQGTDQVWLMAVTKYIIDQGWHDESFIRERVHFFDEFKQLLEK
FT                   YTLDYAEQITGIAKTDLIRIAEMIHEADGTCVLWGMGVTQNTGGSDTSAAISNLLLATG
FT                   NYGRPGAGAFPLRGHNNVQGACDMGSLPSWLPGYQHVTDDAARTKFEKVYGVRIDAKPG
FT                   LDNIQMIEAAERGDLKAMYIIGEDMALVDCNANHVQDTLAKLDFVVVQDIFLSKTAQFA
FT                   DVILPAAPSLEKEGTFTNTERRIQRFYQALEPLGDSKPDWWIIQEIAKRLGADWNYAGP
FT                   SEIMDEIASLAPLYSQAHYDRLEGWNSLCWGSYDGADTPLLYKERFNFPDGKARFALAD
FT                   WVEPVQYPEEYDLLVNNGRLLEHFHEGNLTYKSKGIQRKFPDIFVEVSPELAKERGISD
FT                   GALVRLISPYGRVKVRVLVTDRVRGNELFLPMHSTANESAINILTGPQTDHRTNTPAYK
FT                   QARVRMEVLERSGETPLPCTNPRFQKRHPQNGVEVERKWRRRDYVPLTEAEKEVKIGG"
FT   gene            521399..521752
FT                   /locus_tag="GTNG_0465"
FT   CDS_pept        521399..521752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0465"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65847"
FT                   /db_xref="InterPro:IPR018745"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKJ3"
FT                   /protein_id="ABO65847.1"
FT                   /translation="MEMSRKEAAFNDIVRKVRKQLFGKGPERIKTYFVDNLAISILHGN
FT                   LTPTEKFIARTPEGRDMVHAARTKMIQDVYAQHVPDGMEELAGSKLLYLFSDIKVEEDM
FT                   AVSVFVFEKPIEL"
FT   gene            522013..522807
FT                   /locus_tag="GTNG_0466"
FT   CDS_pept        522013..522807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0466"
FT                   /product="Required for formate dehydrogenase activity"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65848"
FT                   /db_xref="GOA:A4IKJ4"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKJ4"
FT                   /protein_id="ABO65848.1"
FT                   /translation="MLDGFVAKRRYIVKYRNGQLAEKEDEIALEFPLTVVVNGQEFATI
FT                   VCTPGHIDELVIGFLASEGVIRVIDDIKAMTIDGERGFVYVELTSDELPAKQFYAKRFI
FT                   GSCCGKSRQFYFYNDAKTAKTIVGGITVKADDCVCLMKTLHEQSIDFAATGGLHNAALA
FT                   TPDRIVVIRSDIGRHNALDKLYGYCLRHQVAMKDKLIVFSGRVSSEVLLKAAKMGISIL
FT                   LSKSAPTTLALDLAEELGITVVGFLRGQDFNVYTHEKRIIIE"
FT   gene            522824..524101
FT                   /locus_tag="GTNG_0467"
FT   CDS_pept        522824..524101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0467"
FT                   /product="Oxalate:formate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65849"
FT                   /db_xref="GOA:A4IKJ5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKJ5"
FT                   /protein_id="ABO65849.1"
FT                   /translation="MKNRWLIALSAVGIHISIGSVYAWSNFTNPLKQLFGWSDQEVALT
FT                   FSIAILFLGLSAAFLGHFVEKHGPRKSGLLAAIFFGLGVTGSGLAVALGSKYLLYLLYG
FT                   VLGGIGLGVGYIAPVSTLVKWFPDRRGLATGLAIMGFGFAAAIASPVMNSLIDSVGVQN
FT                   TFFILGITYFVIMTVSSLYLEKPPEGWLPEGFQEKVKAGKAKPSLDLAQLTANEAVKTR
FT                   RFWYLWFMLFINVTCGIAVLAVAKPLAVESIGISQTAAAALVGAIGVFNGLGRIGWASA
FT                   SDYIGRPNTYTTFFVLQILIFFLLPNVSIKWLFVVMLTIVYTCYGGGFACIPAYIGDLF
FT                   GTKQLGAIHGYILTAWAAAGLVGPMFAAYIKDTTGSYEGSLAFFGGLFVIALVLSLLVR
FT                   IDIRQMRAQYEQTAYVSTTKEQSHHV"
FT   gene            524536..525642
FT                   /locus_tag="GTNG_0468"
FT   CDS_pept        524536..525642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0468"
FT                   /product="A/G-specific adenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65850"
FT                   /db_xref="GOA:A4IKJ6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKJ6"
FT                   /protein_id="ABO65850.1"
FT                   /translation="MNMTTWTKRFPAREFQRDLLDWFARERRDLPWRQDRDPYKVWVSE
FT                   VMLQQTRVETVIPYFEKFIRQFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEV
FT                   KERYGGKVPDNPDEFSKLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDI
FT                   AKASTRKRFEQIVREIMAYEQPGAFNEALIELGALVCTPRRPSCLLCPVQAHCRAFAEG
FT                   VPEELPVKTKKTAVKQVPLAVAVLTDQEGRILIRKRDHTGLLANLWEFPSCEMKGEGEK
FT                   ENLERAFLNEQGLDVKLGEPIVSFDHVFSHLVWKLTVFYGRLLDGERLEEPYRLVSERE
FT                   LETYAFPVSHQRVWREYQEHAGEARRLR"
FT   gene            complement(525639..525863)
FT                   /locus_tag="GTNG_0469"
FT   CDS_pept        complement(525639..525863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0469"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65851"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKJ7"
FT                   /protein_id="ABO65851.1"
FT                   /translation="MYVGRDMTELSMIPKTEWTDDELAYFHHSFQQIAPYLNIEGQTIH
FT                   REIIEEIEARGGLGRREATYTHGTMPVPD"
FT   gene            525924..526673
FT                   /gene="fabI"
FT                   /locus_tag="GTNG_0470"
FT   CDS_pept        525924..526673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="GTNG_0470"
FT                   /product="enoyl-acyl carrier protein reductase FabI"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65852"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKJ8"
FT                   /protein_id="ABO65852.1"
FT                   /translation="MSEKVAVVTGSSRGIGKAIALRLAQEGYDIVVNYARSKTAAEETA
FT                   REIEALGRRALVVKANVGDVEKIRDMFAHIDEAFGRIDVLVNNAASGVLRPAMELEETH
FT                   WNWTMNINSKALLFCAQEAAKRMEKVGGGKIVSISSLGSIRYLENYTAVGVSKAALEAL
FT                   TRYLAVELAPKNIAVNAVSGGAVDTDALKHFPNRDELLADAAANTPAGRPVKPEDIVNA
FT                   VLFLLSDAAEMIRGQTIIVDGGRSLLL"
FT   gene            526732..526923
FT                   /locus_tag="GTNG_0471"
FT   CDS_pept        526732..526923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0471"
FT                   /product="Small, acid-soluble spore protein B"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65853"
FT                   /db_xref="GOA:A4IKJ9"
FT                   /db_xref="InterPro:IPR006341"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKJ9"
FT                   /protein_id="ABO65853.1"
FT                   /translation="MAKQPNKTSAGTNIQEVRQQNAQSSQAAQAGQFGTEFAAETNVQH
FT                   VKQQNAQAEARKAQNANQ"
FT   gene            527106..527357
FT                   /locus_tag="GTNG_0472"
FT   CDS_pept        527106..527357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0472"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65854"
FT                   /db_xref="InterPro:IPR025572"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKK0"
FT                   /protein_id="ABO65854.1"
FT                   /translation="MIKQMVGQRGRENRRSMEQIWVDEREETLFLWHEMERCQEITRQL
FT                   EELEREAPTIALREEVRQMKQQVEAIRRVFERQMSSSA"
FT   gene            527488..528021
FT                   /locus_tag="GTNG_0473"
FT   CDS_pept        527488..528021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0473"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65855"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKK1"
FT                   /protein_id="ABO65855.1"
FT                   /translation="MPAYPREGKIIQIHSYKHNGTIHRIWQETVVLKGTSAYVIGGNDK
FT                   TLVMEADGRTWVTREPAICFFHAKHWFNIIAMIREDGVYYYCNLSSPFVWDDEALKYID
FT                   YDLDIKVFPDMTYMLLDEDEYERHRREMNYPDVIDRILKNNVQKLIGWIQERKGPFAPE
FT                   FIDKWYGVFQAYQK"
FT   gene            528087..529829
FT                   /locus_tag="GTNG_0474"
FT   CDS_pept        528087..529829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0474"
FT                   /product="Unidentified transporter-ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65856"
FT                   /db_xref="GOA:A4IKK2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKK2"
FT                   /protein_id="ABO65856.1"
FT                   /translation="MGSIRRYWQFVRPYRWHIAATMVIGIIKFSIPLLIPLLLKFVVDD
FT                   VIANHALSLEEKTNRLWQALAFMLIVFLVIRPFVEYYRQYFAQWTASKVLYDIRQQLFH
FT                   HMQKLSVSYYANHRTGEVISRVINDVEQTKEFIITGLMNLWIDMATILIALVIMVNMDV
FT                   KMTLISVSTLPLYAFAVKYFFGRLRQRTRQRSQALAELQAYLHERVQGMPVVKSFAIED
FT                   EEQRRFSKQNGHFLTKALIHTSWNAKSFAAVNTITDIAPIVVIIYAGYEVITGQMTVGT
FT                   MVAFVGYIERLYTPLRRLVNASTTLTQSFASMDRVFEFLDERYDIDDAPQAIECRCVKG
FT                   DIVFDRVTFAYHDGGPLVLRDVSFSVKAGETVALVGPSGGGKSTLVSLIPRFYDVTDGR
FT                   ILLDGMDIRSFRVRSLRDQIGLVFQDNFLFSDSVKENILLGKPDATDEEVIAAAKAANA
FT                   HEFIMSLPDGYDTKVGERGVKLSGGQKQRIAIARVFLKNPPIFIFDEATSALDLENEQY
FT                   IQEALDRLAKNRTTFVVAHRLSTITHADRILFIENGQIVESGTHEELMAKRGSYYELFM
FT                   VQHL"
FT   gene            529826..530017
FT                   /locus_tag="GTNG_0475"
FT   CDS_pept        529826..530017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65857"
FT                   /db_xref="GOA:A4IKK3"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKK3"
FT                   /protein_id="ABO65857.1"
FT                   /translation="MIVNKNINIIEKHKKSGFALGKAVFYCFISFSIILIFYNIILYYS
FT                   MMHVIILLREKKFHEMGL"
FT   gene            530033..531055
FT                   /locus_tag="GTNG_0476"
FT   CDS_pept        530033..531055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0476"
FT                   /product="Oligopeptide ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65858"
FT                   /db_xref="GOA:A4IKK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKK4"
FT                   /protein_id="ABO65858.1"
FT                   /translation="MEAPLLEVRGLRTSFFTDDGEIPVVDGVDFSAREGEVLGIVGESG
FT                   CGKSVTSLSIMGLLPKGIGKVVGGEIWFKGENLVEASERRMKQIRGNEIAMIFQEPMTS
FT                   LNPLFTIGDQLVEAIRLHTKIRKKEARARAAEMLKLVGLPRAEQMLDEYPHQLSGGMRQ
FT                   RVMIAMAMACQPALLIADEPTTALDVTIQAQILALMKELNRTFGTAIMMITHDLGVVAE
FT                   ICDRVIVMYAGQIVEEGSVQAIFRRPQHPYTAGLIRSIPDIRGKKERLYSIPGQVPKPG
FT                   SVRCGCRFAERCEYVFDRCRQEDPQLYETGEQGHRTRCFLALEKGGGVDERPVARSERA
FT                   "
FT   gene            531021..531989
FT                   /locus_tag="GTNG_0477"
FT   CDS_pept        531021..531989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0477"
FT                   /product="Oligopeptide ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65859"
FT                   /db_xref="GOA:A4IKK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKK5"
FT                   /protein_id="ABO65859.1"
FT                   /translation="MSDLLLEVKGLKKYFPITGGIFGKQIGMVKAVDDVTFTVYRGETL
FT                   GIVGESGCGKSTTGRMLMRLIEPTDGSITFEGKEVTALSKTELRRLRRDMQMIFQDPFA
FT                   SLNPRHTVEKILEEPLIVHGIGSKEERKRRVREMLEVVGLGSYHAKRYPHQFSGGQRQR
FT                   IGIARALMTNPKLIIADEPVSALDVSIQAQVLNLLEDLQKQFGLTYIFIAHDLGVVRHI
FT                   SDRVGVMYLGRMVELADSESLYEAPKHPYTKALLSAVPIPDPDHKAERQLLSGDLPSPA
FT                   NPPQGCAFHTRCSACMDICRAQRPALKEVATGHYVACHLYE"
FT   gene            532037..533641
FT                   /gene="dppA"
FT                   /locus_tag="GTNG_0478"
FT   CDS_pept        532037..533641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA"
FT                   /locus_tag="GTNG_0478"
FT                   /product="Dipeptide transporter protein DppA"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65860"
FT                   /db_xref="GOA:A4IKK6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKK6"
FT                   /protein_id="ABO65860.1"
FT                   /translation="MRRNKWFTWLAMLLAVVLVFAGCSKPKESTGGSSEKPSAQDTLVY
FT                   GRGGDSVSLDPATVTDGESLKVTKNIFDTLLDYNDNDTSVKPALATKWTVSEDGLTYTF
FT                   ELRQGVKFHDGTDFYAEAVVFNFERWANGNEAFFPYYGSMFGGYKTVEGHVIKEVKAID
FT                   DYTVQFVLKRPQAPFLKNIAMPPFAIASPEAVKKYGDKFGEHPVGTGPFIFKEWKRNER
FT                   IMLEKNKEYWEKGYPKLNQLIFVSIPDNSARLNALLKGEIDIMEDLNPTDLKQVEGNKE
FT                   FQIFKRPSMNVAYVGLTATRGPLKNKLVRQALNHAVDKKAIIDAFYAGQAEVAKNPMPP
FT                   SIPGYNDAIQDYPFDLEKAKQLLAEAGYPNGFEIELWAMPVPRPYMPDGQKIAEAIQAN
FT                   FAKIGVKAKIVSYEWATYLEKLAKGEADTFMLGWTGDNGDADNFLYALLDKDSIGSNNY
FT                   TYFANDELHNILVEAQTVSDENKRNELYKQAQEIIKEEAPWIPLVHSTPLLAGKTNIQG
FT                   FHPHPTGSDKFTKVEFQ"
FT   gene            533712..534716
FT                   /gene="dppB"
FT                   /locus_tag="GTNG_0479"
FT   CDS_pept        533712..534716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="GTNG_0479"
FT                   /product="Dipeptide ABC transporter (permease) DppB"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65861"
FT                   /db_xref="GOA:A4IKK7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKK7"
FT                   /protein_id="ABO65861.1"
FT                   /translation="MLSYIVRRVLMIIPVLFGMSLVVFFMIRAIPGNPAQVILGQKATK
FT                   EAVAALTHKLGLDEPWYVQYVKYIGGLLRGDLGESIRTGAPIAEEIWPYLAATLELSLA
FT                   AMLIAVVIGVNAGIISAWFQHSWFDYIAMVLALIGVSMPIFWLGLMEQWLFSIQLDWLP
FT                   TSGREDVRNPIEPITHLYLIDTLLSGNTEQFWQVVQHLVLPSMALATIPMAIIARMTRS
FT                   SMLEVMKSDYIRTARAKGVSMFWVVYKHSLKNAIIPVLTVIGLQTGLLLGGAILTETIF
FT                   SWPGIGRYIYDAIGYRDYPVIQSGILIIAAIFIFINLIVDLLYAAIDPRIKYN"
FT   gene            534736..535635
FT                   /gene="dppC"
FT                   /locus_tag="GTNG_0480"
FT   CDS_pept        534736..535635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="GTNG_0480"
FT                   /product="Dipeptide transporter protein DppC"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65862"
FT                   /db_xref="GOA:A4IKK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKK8"
FT                   /protein_id="ABO65862.1"
FT                   /translation="MAELARTPATPPTAIEEERTVSLWGEAWQRFRKNKIALVGTGIVL
FT                   FFIMIAILAPWLAPYDYKEQQLAERLQPPSSEHWFGTDDFGRDIFSRVIYGARISLWVG
FT                   FFSVLGSIVVGSLLGIIAGYYGRWIDGVISRLFDIMLAFPSILLAIGIVAVLGPSLQNA
FT                   LIAIAVINVPNFGRLIRSRVLSIKQEEYIMAAKAIGMSDWRILFHHILPNSLAPIIVQG
FT                   TLAIATAIIEAAALGFLGLGAQPPNPEWGKMLSDAKDFLTQAPWTMIFPGLAIMLTVLG
FT                   FNLMGDGLRDALDPRMKS"
FT   gene            complement(535649..536728)
FT                   /locus_tag="GTNG_0481"
FT   CDS_pept        complement(535649..536728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0481"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65863"
FT                   /db_xref="GOA:A4IKK9"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKK9"
FT                   /protein_id="ABO65863.1"
FT                   /translation="MKLGARIFKTGIAVTLALFLAALFHFPSPVFAGISAVFAMQPTIY
FT                   RSYLSLIEQVQANVIGALFAITAVLILGRDPLIVGLTLMIVIALCLKMRLESSTISVAL
FT                   VTVIAIMEYTERQFIEFAAIRFLTIMLGIFAAFLVNLIFLPPKYEKKLYEKISGETETI
FT                   LKWIRLHKQQVADHHHLKDEIETLLDEMTKLKHLYFMYKEERTYFRRQRFQKSRKLVLY
FT                   RQMIAAADRALSVLKWLHRLENELGRLPAELHQAISLHLSHLLDYHEQLLLKFIHKAKP
FT                   LPHNKRAEEIYRQRERLAATFYSEGQLPAEYRLFSLIGAIIDYGDRLEHLDKLIDSFHH
FT                   YHYDEELTKQLEKSTGGRS"
FT   gene            complement(536846..537949)
FT                   /locus_tag="GTNG_0482"
FT   CDS_pept        complement(536846..537949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0482"
FT                   /product="Glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65864"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKL0"
FT                   /protein_id="ABO65864.1"
FT                   /translation="MTGADGRTPSRPRLVYMEQHTHRSPNAAEQRGAFLLAAVEKRDIP
FT                   TNEHVQSVLGALAQWGHPAKGNVIIQLDIPRKLWMEKLANAGQNPEIATNDHFIVGHVH
FT                   ISRSADADPIRVHLRQLCKQFGFVLLFESIRPSSDGNTLFLQIAMLPRDVFSLSDRLFR
FT                   LMAAMERDSNVRVASLSHTHVVYQADTLAQLLREPDVSHPFLASTATFAYVRQAGAPLC
FT                   YKRLGSAGMLVHSAKTSISAVETLIYIDGYSLLEAVGLAFMPNKAKQNGLSPLEQPYVL
FT                   FAACSEQEAIWIANTAESLWKMDTPSRVFITSKPYGDTAKSLTPGQPLALIRSAAGQTQ
FT                   WLDGTRFYQEMNTRLSNRRTANSKTAF"
FT   gene            complement(538305..539591)
FT                   /locus_tag="GTNG_0483"
FT   CDS_pept        complement(538305..539591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0483"
FT                   /product="Glutamate-1-semialdehyde aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65865"
FT                   /db_xref="GOA:A4IKL1"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKL1"
FT                   /protein_id="ABO65865.1"
FT                   /translation="MQWTKSEQLYEEALRHIVGGVNSPSRSYKAVGGGAPVVMERAQGA
FT                   YFWDVDGNKYIDYLAAYGPIITGHAHPHITAAIQRAAETGVLYGTPTPHEITFAKMLKE
FT                   AIPSLEKVRFVNSGTEAVMTTIRVARAYTGRSKIVKFAGCYHGHSDLVLVAAGSGPSTL
FT                   GTPDSAGVPQSIAHEVITVPYNDVESFREAMNVWGEHVAAVLVEPIVGNFGIVLPKPGF
FT                   LEAVNDIAHEAGALVIYDEVITAFRFMYGGAQNLLGIEPDMTAMGKIIGGGLPIGAYGG
FT                   RQDIMEQVAPLGPAYQAGTMAGNPASMLAGIACLEVLKQEGVYEHLDRLGAMLEEGIMT
FT                   HARQCGLPVTINRLKGALTVFFTEEKVENYEQAQRSDGELFAKFFKLMLKQGVNLAPSK
FT                   YEAWFITLAHTEDDIAYTIDAVGRAFRQL"
FT   gene            539902..540906
FT                   /locus_tag="GTNG_0484"
FT   CDS_pept        539902..540906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0484"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65866"
FT                   /db_xref="GOA:A4IKL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKL2"
FT                   /protein_id="ABO65866.1"
FT                   /translation="MNAIEVEELRKEFKVHKSRSGLVGAFRDLWTRRYMTVRAVDGISF
FT                   TVKQGEMVGYIGENGAGKSTTIKMLTGILTPTSGRIIVNGMNPHKEREKFVRTIGVVFG
FT                   QRSQLWWDIAVQESFRLLKKVYRVPDEQYDRHMSEVIEMLEIGPLLDKPVRKLSLGQRM
FT                   RCELAAALIHNPPLLFLDEPTIGLDVLVKLNIRQFLKQLNERYGTTILLTTHDMSDIEA
FT                   LCERVIMLDEGKIIYDGSLEQLKEKWGQGKRVAFTFAEGKDASILQELTAGLDVVWKKG
FT                   EQSNVWVAHVPSGGVPEVVSRVAARYALQDIRIHEVSTEEIVRNIYEEGAVHG"
FT   gene            540899..541690
FT                   /locus_tag="GTNG_0485"
FT   CDS_pept        540899..541690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0485"
FT                   /product="Daunorubicin resistance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65867"
FT                   /db_xref="GOA:A4IKL3"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKL3"
FT                   /protein_id="ABO65867.1"
FT                   /translation="MDKYVEMIRIRFLMMLAYRTNYYTGILIYAINIAAYYFLWAAIYG
FT                   DKPSMQGMSLGQMTTYVAISWLSRAFYFNNIDREIAMEIRDGKVATELIRPYSYLGMKA
FT                   VQGLGEGLFRLFFLSLPGLLVVSLFLPLQFPENAHTWLSFSLSLLLSFVIYSELNLLAG
FT                   VVTFFTFRNEGLLRAKRFIIDLFSGLILPVSFYPDWAQRLMDYFPFQAISYIPSMIITE
FT                   SFQGADVRDGLIVQVAWCALLLLPIGLLWRMAKKRLVVQGG"
FT   gene            541695..542480
FT                   /locus_tag="GTNG_0486"
FT   CDS_pept        541695..542480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0486"
FT                   /product="ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65868"
FT                   /db_xref="GOA:A4IKL4"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKL4"
FT                   /protein_id="ABO65868.1"
FT                   /translation="MFYISVFFQYMAQYMKTKLQYRTDLLIEWLSDFMAQAVNLVFLLV
FT                   VFGHTPLLHGWTRDEILFIYGFFLVPYAVFGAFFNLWDFNERYIVQGEMDRVLTRPVHS
FT                   LFQIILERMELESLLGAIPGLIIMAYASVRLSLTFHWYDFFIFILLVIGGAFIYAGIFI
FT                   SLATISFFADARTSIMPMMYNISSYGRYPIDIYHRVIRYILTWVLPFAFVGVYPASYFL
FT                   NKQEWYDYAFMTPVVGALFFAIAIMLWNAGVRRYRGTGS"
FT   gene            542632..543585
FT                   /gene="ldh"
FT                   /locus_tag="GTNG_0487"
FT   CDS_pept        542632..543585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh"
FT                   /locus_tag="GTNG_0487"
FT                   /product="L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65869"
FT                   /db_xref="GOA:A4IKL5"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKL5"
FT                   /protein_id="ABO65869.1"
FT                   /translation="MKNGGGNRVAVVGTGFVGSSYAFALMNQGIADEIVLIDANENKAK
FT                   GDAMDLNHGKVFAPNPTNIWYGDYHDCRDADLVVICAGANQKPGETRLDLVDKNIAIFR
FT                   SIVESVMASGFQGLFLVATNPVDILTYATWKFSGLPYERVIGSGTILDTARFRFLLGEY
FT                   FDIAPTNVHAYIIGEHGDTELPVWSQADIGGVPIRKLIESKGEQAREELERIFVNVRDA
FT                   AYQIIEKKGATYYGIAMGLARVTRAILHNENAILTVSAYLDGLYGERDVYIGVPAVINR
FT                   HGIREVIELELDDNEQKWFQHSAATLKGVLARSFAQ"
FT   gene            543771..544175
FT                   /locus_tag="GTNG_0488"
FT   CDS_pept        543771..544175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0488"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65870"
FT                   /db_xref="GOA:A4IKL6"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKL6"
FT                   /protein_id="ABO65870.1"
FT                   /translation="MDYAFLGVVTAVLLGSITSIWTARVQVTHRLSLDSLWVLVQWYVT
FT                   MLLGFAMIYMILQVNGHAVFTPSSNSDVDNRLSLLGDSLYLSGITLLSVGYGDVTPIGI
FT                   GRWIAITEALLGYIMPAVIVARTVFDWDRR"
FT   gene            544239..544715
FT                   /locus_tag="GTNG_0489"
FT   CDS_pept        544239..544715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0489"
FT                   /product="Bacterioferritin comigratory protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65871"
FT                   /db_xref="GOA:A4IKL7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKL7"
FT                   /protein_id="ABO65871.1"
FT                   /translation="MIIAIGQPAPDFTLPASNGKMVSLSDFRGQYVVLYFYPKDMTPGC
FT                   TTEACDFRDRYEQFTGLNAVILGVSTDPVKRHETFIEKYQLPFLLLSDEQHHVAELYGV
FT                   WKKKRNFGKEYMGIERSTFIIAPDGTLVKEWRGVKVKGHVDEALAEVAQLASSR"
FT   gene            544941..545393
FT                   /locus_tag="GTNG_0490"
FT   CDS_pept        544941..545393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0490"
FT                   /product="Transcriptional regulator Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65872"
FT                   /db_xref="GOA:A4IKL8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKL8"
FT                   /protein_id="ABO65872.1"
FT                   /translation="MTVSVNEQLKEALDMLKKTGIRITPQRHAILEYLISSMSHPTADE
FT                   IYKALEGKFPNMSVATVYNNLRVFKEVGLVKELTYGDSSSRFDFVTSNHYHVICEQCGK
FT                   IVDFHYPALDEVEQLAAHVTGFKVDHHRMEVYGVCPDCQNEKGRTH"
FT   gene            complement(545420..545773)
FT                   /locus_tag="GTNG_0491"
FT   CDS_pept        complement(545420..545773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0491"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65873"
FT                   /db_xref="GOA:A4IKL9"
FT                   /db_xref="InterPro:IPR020912"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKL9"
FT                   /protein_id="ABO65873.1"
FT                   /translation="MGIKYSSKINKIRTFALSLIFVGVIVMYLGLFFRTSPIIMTLFMV
FT                   LGLLFLVASGIVYFWIGTLSTRAVQVVCPSCGKVTKMLGRVDLCMFCREPLTLDRELEG
FT                   KEFDEKYNKKRKN"
FT   gene            546182..547060
FT                   /locus_tag="GTNG_0492"
FT   CDS_pept        546182..547060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0492"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65874"
FT                   /db_xref="InterPro:IPR029348"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKM0"
FT                   /protein_id="ABO65874.1"
FT                   /translation="MEELLRPIYQEWASRCNTLGILLIEKNEGHETVTDTFDALLLVIV
FT                   DLQSEPLFLKHYSINGEKAALYAVNEQKLNEWFVLGSHRKAVDWVFNGKIVFDRNDYVW
FT                   QLRQRLEQFPPRERQLKMGLEFAKLIRRYTDGKALFSARHWLDSYNHMMHALHHLARLT
FT                   VIEHGLYPEVTVWNQVKQMDGQIYKLYEELVGSEEPLPKRLELLLLASEFLIHSFVAPG
FT                   SSHLCEVLKQKEGAWSIEEMTHHPQFAPYSVDLTIMLEYLVERKVLSAVEVPTNGEKMF
FT                   ERYYTLQEEKN"
FT   gene            547532..549082
FT                   /locus_tag="GTNG_16s007"
FT   rRNA            547532..549082
FT                   /locus_tag="GTNG_16s007"
FT                   /product="16S ribosomal RNA"
FT   gene            549474..552403
FT                   /locus_tag="GTNG_23s007"
FT   rRNA            549474..552403
FT                   /locus_tag="GTNG_23s007"
FT                   /product="23S ribosomal RNA"
FT   gene            552631..552747
FT                   /locus_tag="GTNG_5s008"
FT   rRNA            552631..552747
FT                   /locus_tag="GTNG_5s008"
FT                   /product="5S ribosomal RNA"
FT   gene            552753..552828
FT                   /locus_tag="GTNG_t033"
FT   tRNA            552753..552828
FT                   /locus_tag="GTNG_t033"
FT                   /product="tRNA-Val"
FT   gene            552840..552916
FT                   /locus_tag="GTNG_t034"
FT   tRNA            552840..552916
FT                   /locus_tag="GTNG_t034"
FT                   /product="tRNA-Met"
FT   gene            552921..552996
FT                   /locus_tag="GTNG_t035"
FT   tRNA            552921..552996
FT                   /locus_tag="GTNG_t035"
FT                   /product="tRNA-Asp"
FT   gene            553174..553249
FT                   /locus_tag="GTNG_t036"
FT   tRNA            553174..553249
FT                   /locus_tag="GTNG_t036"
FT                   /product="tRNA-Phe"
FT   gene            553263..553335
FT                   /locus_tag="GTNG_t037"
FT   tRNA            553263..553335
FT                   /locus_tag="GTNG_t037"
FT                   /product="tRNA-Thr"
FT   gene            553346..553421
FT                   /locus_tag="GTNG_t038"
FT   tRNA            553346..553421
FT                   /locus_tag="GTNG_t038"
FT                   /product="tRNA-Lys"
FT   gene            553426..553500
FT                   /locus_tag="GTNG_t039"
FT   tRNA            553426..553500
FT                   /locus_tag="GTNG_t039"
FT                   /product="tRNA-Gly"
FT   gene            553508..553593
FT                   /locus_tag="GTNG_t040"
FT   tRNA            553508..553593
FT                   /locus_tag="GTNG_t040"
FT                   /product="tRNA-Leu"
FT   gene            553597..553670
FT                   /locus_tag="GTNG_t041"
FT   tRNA            553597..553670
FT                   /locus_tag="GTNG_t041"
FT                   /product="tRNA-Arg"
FT   gene            553675..553748
FT                   /locus_tag="GTNG_t042"
FT   tRNA            553675..553748
FT                   /locus_tag="GTNG_t042"
FT                   /product="tRNA-Pro"
FT   gene            553758..553833
FT                   /locus_tag="GTNG_t043"
FT   tRNA            553758..553833
FT                   /locus_tag="GTNG_t043"
FT                   /product="tRNA-Ala"
FT   gene            553851..553924
FT                   /locus_tag="GTNG_t044"
FT   tRNA            553851..553924
FT                   /locus_tag="GTNG_t044"
FT                   /product="tRNA-Met"
FT   gene            553933..554009
FT                   /locus_tag="GTNG_t045"
FT   tRNA            553933..554009
FT                   /locus_tag="GTNG_t045"
FT                   /product="tRNA-Met"
FT   gene            554027..554117
FT                   /locus_tag="GTNG_t046"
FT   tRNA            554027..554117
FT                   /locus_tag="GTNG_t046"
FT                   /product="tRNA-Ser"
FT   gene            554148..554223
FT                   /locus_tag="GTNG_t047"
FT   tRNA            554148..554223
FT                   /locus_tag="GTNG_t047"
FT                   /product="tRNA-Thr"
FT   gene            554232..554304
FT                   /locus_tag="GTNG_t048"
FT   tRNA            554232..554304
FT                   /locus_tag="GTNG_t048"
FT                   /product="tRNA-His"
FT   gene            554335..554405
FT                   /locus_tag="GTNG_t049"
FT   tRNA            554335..554405
FT                   /locus_tag="GTNG_t049"
FT                   /product="tRNA-Gly"
FT   gene            554411..554487
FT                   /locus_tag="GTNG_t050"
FT   tRNA            554411..554487
FT                   /locus_tag="GTNG_t050"
FT                   /product="tRNA-Ile"
FT   gene            554730..554804
FT                   /locus_tag="GTNG_t051"
FT   tRNA            554730..554804
FT                   /locus_tag="GTNG_t051"
FT                   /product="tRNA-Asn"
FT   gene            554809..554901
FT                   /locus_tag="GTNG_t052"
FT   tRNA            554809..554901
FT                   /locus_tag="GTNG_t052"
FT                   /product="tRNA-Ser"
FT   gene            554907..554978
FT                   /locus_tag="GTNG_t053"
FT   tRNA            554907..554978
FT                   /locus_tag="GTNG_t053"
FT                   /product="tRNA-Glu"
FT   gene            complement(555159..555884)
FT                   /locus_tag="GTNG_0493"
FT   CDS_pept        complement(555159..555884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0493"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65875"
FT                   /db_xref="GOA:A4IKM1"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKM1"
FT                   /protein_id="ABO65875.1"
FT                   /translation="MSIIFPPFEVYGKMKHGVIHMKCIISEELKQRLPSGKFGVIRYHH
FT                   IEIGDSPQMLKGRLELFQESIYFELQEKAIADIPELAEWRQAFKQIGTDPGRYRPSSES
FT                   LYRRIQKKNFVPSIHSAVDVNNFFSLYYKIPLGIYDLDCIQGSVMITVGTEQDEYIALN
FT                   GRSVNFANKLVSKDEHGPFGSPIVDSKRTAVTKGTKNALQIVYFLPSIPEDVANRQLQA
FT                   IQTMFTQIHGGEADAQLLV"
FT   gene            555877..557019
FT                   /locus_tag="GTNG_0494"
FT   CDS_pept        555877..557019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0494"
FT                   /product="Iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65876"
FT                   /db_xref="GOA:A4IKM2"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKM2"
FT                   /protein_id="ABO65876.1"
FT                   /translation="MDIVSLKQEVIEYSRSIGIDKIGFASADPFVELKERLRRQQELGY
FT                   QSGFEEPDIEKRTNPSLLLPEAKSIIAIALAYPSKMKDAPRGTKNERRGLFCRASWGKD
FT                   YHDVLRERLRQLEEFLLAKVPHARVRSMVDTGELADRAVAERAGIGWSGKNCSIITPEF
FT                   GSYVYLGEMITTIPFPPDEPIENRCGTCTKCIDACPTGALVQGGQLNAQRCISFLTQTK
FT                   GFLADEFREKIGNRLYGCDTCQLVCPENKKKDFHLHPEFEPDPEAAKPKLIPLLQVSNR
FT                   EFKEKFGAMAGSWRGKKPIQRNAILALAHYKDRTAVPHLLRLLKEDSRPVIRGTAAWAL
FT                   GKIGDVSAKPYLEEARQTETDSDVVAEIEKGLKLLTEVKE"
FT   gene            557078..557944
FT                   /locus_tag="GTNG_0495"
FT   CDS_pept        557078..557944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0495"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65877"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKM3"
FT                   /protein_id="ABO65877.1"
FT                   /translation="MKKRLHDWLDKRAHSFVSESNIQGDEEITRKQQLCQRRGAEIVRC
FT                   TIRGQIIGRQTVERETKMVYIAHHQFLIKHGATLYIEEQVEERCARFLGTELVDDKRVS
FT                   RMGEYVEAPRVEREQWTGERLSYQYDRAQAVRYAETWWNRHNPAFPSFSVDCTNFVSQC
FT                   LYAGGAPMTGYPNRARGWWCQNGSWSYSWAVAHSLRWYLSGSRIGLQAVEVPEPEQLMA
FT                   GDVICYDFQGDGRFDHSTIVVAKDQDGMPLVNAHTTNSRMRYWSYEDSSAYTPNIRYKF
FT                   FHIIDRK"
FT   gene            557968..558441
FT                   /locus_tag="GTNG_0496"
FT   CDS_pept        557968..558441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0496"
FT                   /product="rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65878"
FT                   /db_xref="GOA:A4IKM4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKM4"
FT                   /protein_id="ABO65878.1"
FT                   /translation="MPLHVVLYQPEIPANTGNIARTCAATDTALHLIRPLGFSTDDKML
FT                   KRAGLDYWPYVNISYYDSIDELFARFPGGEFYFITKFGQQYYDSFDFSDQEKDIFFVFG
FT                   RETTGLPKELLEANKDRCLRIPMNDKVRSLNLSNTAAILVYEALRQQRFQGLS"
FT   gene            558766..560661
FT                   /locus_tag="GTNG_0497"
FT   CDS_pept        558766..560661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0497"
FT                   /product="Serine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65879"
FT                   /db_xref="GOA:A4IKM5"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKM5"
FT                   /protein_id="ABO65879.1"
FT                   /translation="MDILRKIARYREEEERLRWEGTFAEYLEILKEKPWVAQSAHSRVY
FT                   NMIKDAGVEEVNGRKRYKFFSQHLFGLEEALERLVEEYFHPAAKRLDVRKRILLLMGPV
FT                   GGGKSTLVTLLKRGLEEYSKTERGAVYAIKGCPMHEDPLHLIPHHLRDDFYREYGIRIE
FT                   GELSPLNMMRLEKEYGGRIEDVMVERIFFSENRRVGIGTFSPSDPKSQDIADLTGSIDF
FT                   STIAEYGSESDPRAYRFDGELNKANRGIMEFQEMLKCDEKFLWHLLSLTQEGNFKAGRF
FT                   ALISADELIVAHTNETEYRSFISNKKNEALHSRIIVMPIPYNLRVSEEERIYEKMIRES
FT                   DVADVHIAPHTLRIAAMFTILTRLKESKRPDVDLLKKMRLYDGEMIEGFNEVDVEELKK
FT                   EHPDEGMSGIDPRYVINRISACIIRKEVPSINALDVLRSLKEGLDQHPSISKEDRERYL
FT                   NFISLVRKEYDEIAKQEVQKAFVYSYEESAKTLMDNYLDNVEAYCNKTKLRDPLTGEEM
FT                   NPDEKLMRSIEEQIGISENAKKAFREEILIRISAYARKGQKFDYNSHERLREAIQKKLF
FT                   ADLKDIVKITTSTKTPDEQQLKKINEVVARLIDEYGYNSTSANELLRYVGSLLNR"
FT   gene            560887..562044
FT                   /locus_tag="GTNG_0498"
FT   CDS_pept        560887..562044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0498"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65880"
FT                   /db_xref="GOA:A4IKM6"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKM6"
FT                   /protein_id="ABO65880.1"
FT                   /translation="MKGNFIVSKEDWSLHRKGYDDQKRHQEKVKEAIKNNLPDLITEES
FT                   IIMSNGRDVIKIPIRSLDEYKIRYNYEKNKHVGQGNGDSQVGDVVARDGSGEGKGPGKG
FT                   QGAGDLPGQDYYEAEVSLMEIEEAFFSQLELPNLKQKERDQNVVQHIEFNDIRRTGLMG
FT                   NIDKKRTMLAAFKRNAMSGKPGFYPIYREDLKFKTWNEVVKPESKAVVLAMMDTSGSMG
FT                   MWEKYMARSFFFWMTRFLRTKYETVDIAFIAHHTEAKVVSEEEFFTKGESGGTICSSAY
FT                   RKALELIETKYSPSRYNIYPFHFSDGDNLTSDNARCVKLVQELMKVSNMFGYGEVNQYN
FT                   RHSTLMSAYRNIKDEKFRYYILKQKSDVFHAMRTFFRKEESEQPV"
FT   gene            complement(562117..562806)
FT                   /locus_tag="GTNG_0499"
FT   CDS_pept        complement(562117..562806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0499"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65881"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKM7"
FT                   /protein_id="ABO65881.1"
FT                   /translation="MVPYWKSLFLIAVTAAFLAGCGTETPSSKEEEAKGKQTVSLDETS
FT                   TNMQPSEPTGQEIPPVDEQKQAGGGQNGSKGDETDFSRPTTSLSYQIGNQTVTGTATLT
FT                   TSDNQHFSLYVLEGWTLDAEEPHADVLLHGDTFARIRLLPNEETNYEQLAKEHAQAIDA
FT                   NAARQQTNQLPKPFTDALWYIAQADGVTVHVIASTQPAPMLLTVHAPKGKDVLGAVLAM
FT                   VATLQKQ"
FT   gene            563084..564061
FT                   /locus_tag="GTNG_0500"
FT   CDS_pept        563084..564061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0500"
FT                   /product="Sugar-binding transcriptional regulator LacI
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65882"
FT                   /db_xref="GOA:A4IKM8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKM8"
FT                   /protein_id="ABO65882.1"
FT                   /translation="MANIRDLAKEAGVSVSTVSRVLNGYPYVSEEKRKAVWEAVEKLNY
FT                   TKNIQAVHLAKGRTMIVGVMLPYIHHPYFSAVIEGISKEALRYGYQLLLFQTNYDVERE
FT                   LEVLERLRMKQMDGLIVCSHEVGWEIFDAYQEEAPIVLCEQVTEYDFFTVYIDHYQAFA
FT                   KALHYLVKKGHRRIGYCIGRRTGPNSQAREAAYQDVLRDVGVTPQRQWIFDGCLFLEDG
FT                   KRVIEQWMAMEERPSALLVTSDQVAAGIVLEARRIGVRIPEELTIIGFDNDPLAEMLGI
FT                   TTVALPHFTLGEKAFRLLHHWLETGNVPRKQEELPTRLVVRATG"
FT   gene            complement(564063..564743)
FT                   /locus_tag="GTNG_0501"
FT   CDS_pept        complement(564063..564743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0501"
FT                   /product="Two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65883"
FT                   /db_xref="GOA:A4IKM9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR006793"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKM9"
FT                   /protein_id="ABO65883.1"
FT                   /translation="MYRVLLIEDDPMVQEVNRQMIEQVNGFAVVGLAGNGEEGLRLIEE
FT                   LHPDVAVIDIYMPQLDGLETLKEIRARGHEVDILAITAASDIETVRRVLQNGAFDYIVK
FT                   PFKFERLKQALENYRAFRQSLAEKQSLTQAELDALRQTAERYVDPLPELPKGLNEVTLE
FT                   KVVTYLRQQCSPVSAEEVAEGVGIARVTARRYLEYLEKSGKVVLDVQYGSIGRPVNRYQ
FT                   LKRI"
FT   gene            complement(564809..566386)
FT                   /locus_tag="GTNG_0502"
FT   CDS_pept        complement(564809..566386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0502"
FT                   /product="Two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65884"
FT                   /db_xref="GOA:A4IKN0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKN0"
FT                   /protein_id="ABO65884.1"
FT                   /translation="MNRLPIRWKITILIFVIVSFSMLLSGVFIISDFFHTKEEELSQRA
FT                   LLTARTVSELPEVKQHIVGPKENRALVNPIVERVRIIHSADYIVVLDMNKIRLSHPLPS
FT                   MIGTVSRGADEGPAFAEHTYTSKARGEIGTVVRAFVPIMNRHHEQIGVVIAAYRLPTFL
FT                   EAIDTLKEEIAMAVILSLLAGGSGAWLLASHIKRQMFELEPHEIAKLLVERTEAFNAMH
FT                   EGVIAIDSNENITIFNDRAKQMLGIEGDVIGQPIRSVIPDTYLPEILKVNKPIYNKELQ
FT                   LGNLTIWSNRIPIKVNGKTVGAIGIFQDRTEVKRLAEELTGVKAFVHALRVQNHEYMNK
FT                   LHTIAGLIQLGHIEKALEYVFQVTEEQEELTQFLSRNIKDESISGLLLSKIRRGKELGI
FT                   LVTIDRHSHLYRFPPRLDHHDFVVLLGNLIENAFDAFQGVTGREKEIYVSIEQNEDICS
FT                   LSIEDNGQGIAREHIDRIFDEGFSTKGQNGRGIGLYLVKQIVEKGNGHIDVQSEEGKGT
FT                   VFTITFDM"
FT   gene            566493..567539
FT                   /locus_tag="GTNG_0503"
FT   CDS_pept        566493..567539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0503"
FT                   /product="Possible C4-dicarboxylate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65885"
FT                   /db_xref="GOA:A4IKN1"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKN1"
FT                   /protein_id="ABO65885.1"
FT                   /translation="MGKLWKLWVLLLMIGIGLVAWNVSRQADQERIVYDDEQKGLQKQI
FT                   IIYFSHVVAENTPKGLAAQKFAELVEQKTNGRVKVEVFANGSLYSDGEELDALLRGDVQ
FT                   MIAPSFSKVTELIPEWQVLDLPFLFRDDDDVRRVFTGKVGAELLGMLEEKGIKGLAFWS
FT                   NGFKQMMGTTRPLIEPDDFRGLRFRIMPSEVIDKQFRLLGGEPVAVSFDHVYRALEQHE
FT                   FDGQENTISNIYSKGFYKFQPYITISNHGYLGYAVMMNRSFWDSLPKEIQQKIAEAMTE
FT                   ATQWNLRQSKAQNERELQQLKQQKSVQLYLLSEEERKRWEQKFAPLYKEFTRQFGSRML
FT                   NEIKGFRE"
FT   gene            567719..568984
FT                   /locus_tag="GTNG_0504"
FT   CDS_pept        567719..568984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0504"
FT                   /product="C4-dicarboxylate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65886"
FT                   /db_xref="GOA:A4IKN2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKN2"
FT                   /protein_id="ABO65886.1"
FT                   /translation="MRGKFKNLTVQVIIGIVLGIIVGFLFPEFGSKLKVLADGFIKLIK
FT                   MVIAPIIFFTVVIGIGNMGDLKKIGRIGGKALLYFEIVTTFALAIGIVVVNLIKPGVGF
FT                   NTDAAKGGDISQYTKQAEETSHGFVDFVLSIIPDNVVAAMASGELLPVLFFAVLFGLAA
FT                   AGLGEKAKPVLSLFERIAEIFFGVVNMVMKVSPIAAFGAMAYTIGTFGLGSLVSLGKLM
FT                   GSVYITMALFIFIVLGGIAKFYGFNIFKFLAYIKEELLLVLGTSSSESALPRLMERLEK
FT                   YGCSKSVVGLVVPTGYSFNLDGTSIYLSMAAIFIAQAYGIDLSIWQELTLLGVLMLTSK
FT                   GAAGVTGSGFITLAATLAAFPMIPVEGIALLLGVDRFMSEARAITNIIGNAVATVVVSK
FT                   MENEFHPSAEQKLAEGNMTIAK"
FT   gene            569294..570121
FT                   /locus_tag="GTNG_0505"
FT   CDS_pept        569294..570121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0505"
FT                   /product="Oxidoreductase, AldO/KetO reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65887"
FT                   /db_xref="GOA:A4IKN3"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKN3"
FT                   /protein_id="ABO65887.1"
FT                   /translation="MNSLQDCTVLHNGVKMPWVGLGVYKVKEGEEVKGAVRTALEVGYR
FT                   HIDTAAFYENEEGVGQAIRESGIPREQVFVTTKVWNTDQGYETTLKAFNTSLKKLGFDY
FT                   VDLYLVHWPVKGKYKETYKALEKLYKDGYVRAIGVSNFQIHHLQDVLADCEIKPMVNQV
FT                   EYHPRLTQKELHAFCRENGIQLEAWSPLMRGEILNEPTIVEIGKKYGKTPAQVVLRWDL
FT                   QNGVVTIPKSVTPARIKENATIFDFSLTDEEMRQIDALNLNKRIGADPDNFNF"
FT   gene            570248..570967
FT                   /locus_tag="GTNG_0506"
FT   CDS_pept        570248..570967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0506"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65888"
FT                   /db_xref="GOA:A4IKN4"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKN4"
FT                   /protein_id="ABO65888.1"
FT                   /translation="MIIRKTEGAAMLFHPMDIFIFIAFLISLWAQWKVSSNFKTWSEVP
FT                   ASSGLTGAEVARMILDRHGLHHVPVEVVPGRLSDHYDPISRVVRLSEPVFYGRSIASIS
FT                   VAAHEVGHAVQHQQGYAALVLRHRMFPIVNFASGVAPFLLLVGFLLQQFSLLGLGILFF
FT                   SLAVAFQIITLPVEFNASARAKRFMLAEGVIAPDETRGVNKVLGAAALTYVAATLIAVL
FT                   ELLKYVLIFTQANNSEE"
FT   gene            571098..572450
FT                   /locus_tag="GTNG_0507"
FT   CDS_pept        571098..572450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0507"
FT                   /product="Magnesium and cobalt efflux protein CorC"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65889"
FT                   /db_xref="GOA:A4IKN5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKN5"
FT                   /protein_id="ABO65889.1"
FT                   /translation="MDIASLLLVALLIACTAFFVASEFAIVKVRSSRIDQLVNEGNKQA
FT                   VAAKKVISNLDGYLSANQLGITLTSLGLGWLGEPTVARMLLPLFERLHLSESVSHFLAF
FT                   IISFSLITFLHVVVGELAPKTFAIHKAEAITLWTAKPLIWFYKIMYPFIWTLNNSARLV
FT                   TRLFGLRPVAEHEIAHSEEELRLILSESYKSGEINQSEYRYVNNIFRFDDRVAKEIMVP
FT                   RKEIVALDINKSVKENLAIIQEEKYTRYPVIDGDKDHVLGLINVKEVFTDFVANPSNEK
FT                   QMKDYIRPIIQVIESIAIHDLLVKMQKERIHMAILVDEYGGTSGLVTVEDILEEIVGEI
FT                   QDEFDIDETPLIQKIDDRFILDGKVLIGEVNDLLGLELDDDDVDTIGGWVLTKYYDIQT
FT                   GDSVEIDGYLFTVKEMDGHHVKTLEVVKKEPKPDEEESEPADAGEEEQLRL"
FT   gene            complement(572527..573426)
FT                   /locus_tag="GTNG_0508"
FT   CDS_pept        complement(572527..573426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0508"
FT                   /product="Ribosomal large subunit pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65890"
FT                   /db_xref="GOA:A4IKN6"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKN6"
FT                   /protein_id="ABO65890.1"
FT                   /translation="MWTRKGDWLECIIPSLWSGLTIEQLLKEVWAASKKLAHRWRMEQG
FT                   VKLNGQAVSWQTTLRERDRLQLYAYEPEPSLIIPEYRELSVLWEDEHLLILNKEAGIDI
FT                   HPSEPEQTGTLANAVAFYLQSQAILTKVRHIHRLDRDTSGTILFAKHPLAGATLDRMLA
FT                   HRTIKRTYVALVHGRLSPKSGTISAPIGRDRHHPTRRRVSKTGARAVTHYRVLETFPSA
FT                   SLVELNLDTGRTHQIRVHLAHLGHPLVGDMLYGGQPTFHRHALHAVKLTFRHPFTNEEI
FT                   VCLAPTNDFPVDLSHIYH"
FT   gene            573574..573963
FT                   /locus_tag="GTNG_0509"
FT   CDS_pept        573574..573963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0509"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65891"
FT                   /db_xref="InterPro:IPR020355"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKN7"
FT                   /protein_id="ABO65891.1"
FT                   /translation="MYAVTPEQENYMHYLLNYFYTDIFPYYFDDEQIHQFEELGILSLE
FT                   HEHVTYNGTMKEAFQIISALQSLITVIEHIGEQGECEQYEWLFVRNQNILARHGISFPF
FT                   QAKQFTHKKALRCSVYFPATSQWVM"
FT   gene            complement(574000..574476)
FT                   /locus_tag="GTNG_0510"
FT   CDS_pept        complement(574000..574476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0510"
FT                   /product="thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65892"
FT                   /db_xref="GOA:A4IKN8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKN8"
FT                   /protein_id="ABO65892.1"
FT                   /translation="MKKLLIFGGVIVVLFAAIAFVTLYEQKEAAKNNPYQKSELHPATI
FT                   DQLDDPNYQNIILPDELKQQLADGKSLTVYFYSPTCPHCRRTTPIVVPLTKQLGIDLKL
FT                   FNLLEFENGWDTYGIESTPTIVHYENGKETKRIEGYHDKQTFRQWFSSLSEQKN"
FT   gene            complement(574473..574910)
FT                   /gene="bdbC"
FT                   /locus_tag="GTNG_0511"
FT   CDS_pept        complement(574473..574910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdbC"
FT                   /locus_tag="GTNG_0511"
FT                   /product="Thiol-disulfide oxdoreductase BdbC"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65893"
FT                   /db_xref="GOA:A4IKN9"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR012187"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKN9"
FT                   /protein_id="ABO65893.1"
FT                   /translation="MEEEKRREHLLLFAWATAFVATLGSLYFSEVLRFIPCDLCWFQRI
FT                   FMYPQVIILGIAIVRKDFTAARYSLALSIIGGMISLYHYSLQKIPFFQDYAISCGRVLC
FT                   TGQYINWLGFITIPFLALTAFTIIIFLSLAVMRQQKEENER"
FT   gene            575188..575598
FT                   /locus_tag="GTNG_0512"
FT   CDS_pept        575188..575598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0512"
FT                   /product="Inosine-5-monophosphate dehydrogenase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65894"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKP0"
FT                   /protein_id="ABO65894.1"
FT                   /translation="MTKNVATVSPNQTVQEAAQIMSQKNIGALPVVESGQVKGMITDRD
FT                   ITLRVTSQGKDPAAVKVSDVMTNQVVTGTPNMSVQDAANVMAQHQVRRLPIVENNQLQG
FT                   IVALGDIATNSASNEAAEQALTNISEPSQPQG"
FT   gene            575712..577469
FT                   /locus_tag="GTNG_0513"
FT   CDS_pept        575712..577469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0513"
FT                   /product="Phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65895"
FT                   /db_xref="GOA:A4IKP1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKP1"
FT                   /protein_id="ABO65895.1"
FT                   /translation="MEWRQKYEQWLREPQLDPELKQLLEQHRDDERWLEDCFYKNLEFG
FT                   TGGMRGEIGPGTNRMNIYTVRKASEGLARYIQSFGNEAKQRGVVIAYDSRHKSPEFAME
FT                   AAKTLATNGIQTYVFDELRPTPELSFAVRHLGAFSGIVITASHNPPEYNGYKVYGEDGG
FT                   QLPPDTADEVIRYVNEVENELAIHVEDEETLKEKGLIRIIGQEIDEAYVNAVKTISLHP
FT                   ELAQETDIRIVFTPLHGTSNKPVRRVLAELGYQNVFVVQEQEQPDPNFSTVASPNPEEH
FT                   AAFALAIELGKQVNADLLIATDPDADRLGIAVKNEQGEYVVLTGNQTGGLLLHYLLSQR
FT                   KEKGLLPQNGVVLKTIVTSEFGRAIADSFGLETIDTLTGFKFIGEKIKEYEQTGQYTFQ
FT                   FGYEESYGYLIGDFARDKDAVQAAVLAAEVCAFYKQQGLSLYEALLQLFDKYGYYREGQ
FT                   QSLTLKGKEGAETIAAILSSFREQPPVEAAGKKVTVIEDYKTKERTNTLTGEKTAITLP
FT                   TSNVLKYVLEDGSWFCLRPSGTEPKMKAYFGVKGTSLQDSEEKLANLTDAVMQRVHDVL
FT                   RTVSPSYAQ"
FT   gene            complement(577522..577779)
FT                   /locus_tag="GTNG_0514"
FT   CDS_pept        complement(577522..577779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0514"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65896"
FT                   /db_xref="InterPro:IPR025431"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKP2"
FT                   /protein_id="ABO65896.1"
FT                   /translation="MNTIDYDRALYYTHRSEWDNLLILMVRTPDDMLSKKIEKFLHAYN
FT                   FEHDYSVIQERLTALLRYIDHALEVSEQKMGVEQYAYFYS"
FT   gene            577957..578208
FT                   /locus_tag="GTNG_0515"
FT   CDS_pept        577957..578208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0515"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65897"
FT                   /db_xref="GOA:A4IKP3"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKP3"
FT                   /protein_id="ABO65897.1"
FT                   /translation="MMRMNKRHEGQEMIKMCKWMASVGLIVGIALFLLSFIANAYNKDF
FT                   FLTIVSLGIIGASMVMFGFGLFMGLLIETYQRDSTENV"
FT   gene            complement(578239..578937)
FT                   /locus_tag="GTNG_0516"
FT   CDS_pept        complement(578239..578937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0516"
FT                   /product="Alkaline phosphatase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65898"
FT                   /db_xref="GOA:A4IKP4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKP4"
FT                   /protein_id="ABO65898.1"
FT                   /translation="MIRSIVCHRSPAATHFHYNGHIKIAAKRGDDLQHYLHHLIDHFGY
FT                   VGIMIALMLGIVGLPIPDELLLIYTGYRVSTGAFSYPLAFLVCLFGATTGISLGYILGI
FT                   TLGLPFLHKFGPKLHITEKRLQQTKTLFSKLGPAVLFICYFIPGVRHLAAFWAGVNAYD
FT                   WRKFALFAYSGAVVWVAVFLTIGTYFESRWMAFRQYIDAYRPFLFSVFLAVFIFTVFYW
FT                   HAQQKQKPPD"
FT   gene            578987..580408
FT                   /locus_tag="GTNG_0517"
FT   CDS_pept        578987..580408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0517"
FT                   /product="Stage V sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65899"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKP5"
FT                   /protein_id="ABO65899.1"
FT                   /translation="MRQDELKELERAIAEITEIAEGFGLDFYPMRYEICPADIIYTFGA
FT                   YGMPTRFSHWSFGKQFYKMKLHYDLGLSKIYELVINSDPCYAFLLDTNTLIQNKLIVAH
FT                   VLAHSDFFKNNIRFSNTKRDMVESMAATAERIKRYEHQYGKLEVEKFLDAVLAIQEHID
FT                   PSLLRPKLSWTWEDTEVYEEEEQPKTSTPYDDLWSLDERNKPKTPPRKKRRKFPPQPEK
FT                   DVLLFIEEYSRELEDWQRDILTMMREEMLYFWPQLETKIMNEGWATYWHQRILREMDLT
FT                   SDEAIEFAKLNANVVQPSRTGINPYYLGLKIFEDIEERWNNPTEEMKKYGVKPGSGRAK
FT                   LFEVRELESDISFLRNYLTKELVMREDMYLFQKQGKDYKIVDKNWENIRDQLVSMRVNG
FT                   GFPYITVNDGDYMRNGELYLKHWYEGIELDLKYLEKVLPYIYQLWGRPVHMETVVEEKP
FT                   MLFTYDGKTVHRKYL"
FT   gene            580693..582039
FT                   /locus_tag="GTNG_0518"
FT   CDS_pept        580693..582039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0518"
FT                   /product="Bd-type quinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65900"
FT                   /db_xref="GOA:A4IKP6"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="PDB:5DOQ"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKP6"
FT                   /protein_id="ABO65900.1"
FT                   /translation="MNGYDPVLLSRILTELTLTVHIIYATIGVGVPLMIAIAQWVGIRK
FT                   NDMHYILLARRWTRGFVITVAVGVVTGTAIGLQLSLLWPNFMQLAGQVISLPLFMETFA
FT                   FFFEAIFLGIYLYTWDRFKNQKKHLLLLIPVAIGSSASAMFITMVNAFMNTPQGFELKN
FT                   GELVNIDPIVAMFNPAMPTKVAHVLATSYMTSAFVLASIAAWHLWKGNRHIYHRKALHL
FT                   TMKTAFIFSVASALVGDLSGKFLAEYQPEKLAAAEWHFETSSHAPLILFGTLEEDNEVK
FT                   YALEIPYALSILAHNHPAAVVTGLNDIPEDERPPLYIHYLFDVMVTIGVFLMVVAAVYW
FT                   LGSIFRWKWTAKNWFFGLLVAGGPLAMIAIEAGWYLAEVGRQPWILRGYMKTAEGATTS
FT                   AHVDTMLVLFCLLYIVLVIASATVLIRMFRRNPVERELEERANRGEVAP"
FT   gene            582036..583064
FT                   /locus_tag="GTNG_0519"
FT   CDS_pept        582036..583064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0519"
FT                   /product="Bd-type quinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65901"
FT                   /db_xref="GOA:A4IKP7"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="PDB:5DOQ"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKP7"
FT                   /protein_id="ABO65901.1"
FT                   /translation="MTLEVIGISVLWLFLFGYIIVASIDFGAGFFSVYSHWANQQHILH
FT                   RIIQRYLSPVWEVTNVFLVFFFVGIVGFFPKTAYYYGSILLVPASIAIVLLAIRGSYYA
FT                   FHTYGETERNWYLLAYGLTGLFIPASLSIVLTISEGGFVEESAAGVALDYGKLFASPLS
FT                   WSVVLLSVTSVLYISAVFLTYYADAAGDEQARALLRRYALLWSGPTMLSALLIIYQLRY
FT                   HNPEHYDNLWNVAWMLVISFLFFVITVWLLGRQRRFGWAFIALLFQYAFAFYAYGISHY
FT                   PYLLYPYLTIYDGFTNETMAMALIVAFIAGLLLLIPSLYLLMRLFLFNKAYVKGKWEGG
FT                   KG"
FT   gene            583251..583541
FT                   /locus_tag="GTNG_0520"
FT   CDS_pept        583251..583541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0520"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65902"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKP8"
FT                   /protein_id="ABO65902.1"
FT                   /translation="MKETLQRVKEQLEQSFNEPHSTSLDGAIHELEQLKANAGDKQKMI
FT                   EDVIRAVTHARNARIELAEAGDESATNAFAEAYRALDQAIESYSDVDNDPV"
FT   gene            583808..584128
FT                   /locus_tag="GTNG_0521"
FT   CDS_pept        583808..584128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0521"
FT                   /product="Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65903"
FT                   /db_xref="GOA:A4IKP9"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKP9"
FT                   /protein_id="ABO65903.1"
FT                   /translation="MAWVYLVVAGIFEVVWAISLKYTDGFTRLWPSVMTVAGMAASFYF
FT                   LSMAIKTLPIGTAYAVWTGIGAFGAVVIGMLFLNEPVNAPRIVFLLFILVGIIGLKFTA
FT                   GQ"
FT   gene            584541..584813
FT                   /locus_tag="GTNG_0522"
FT   CDS_pept        584541..584813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0522"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65904"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016941"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKQ0"
FT                   /protein_id="ABO65904.1"
FT                   /translation="MRKWLRWLRFVVNVRRFLPFLFEFFVSSEVSVWKKTFFVGLLLLY
FT                   IALPFDLIPDWFALFGFIDDFTVFMFILQQIIKMAPASLKEKYNL"
FT   gene            584820..585518
FT                   /locus_tag="GTNG_0523"
FT   CDS_pept        584820..585518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0523"
FT                   /product="Membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65905"
FT                   /db_xref="GOA:A4IKQ1"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKQ1"
FT                   /protein_id="ABO65905.1"
FT                   /translation="MSVDLFSPEFWTALLSIVIIDLVLAGDNAIVIGLAARNLPKHQQK
FT                   KAVIWGTVGAVVIRAMATIFVVWLLKIPGLLLVGGLLLVWIAYKLLVEEKGHDDIEAGG
FT                   SLWEAVRTIIIADALMGLDNVLAVAGAAHGHFLLVILGLLISVPIMVWGSTLILKWIER
FT                   FPIIITIGAGILAWTASKMIVDEPFLKGYFANPVIKYGFELLLVAAVIAIGTQKKRKAA
FT                   KKPHLKVANE"
FT   gene            complement(585557..586006)
FT                   /locus_tag="GTNG_0524"
FT   CDS_pept        complement(585557..586006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0524"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65906"
FT                   /db_xref="GOA:A4IKQ2"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKQ2"
FT                   /protein_id="ABO65906.1"
FT                   /translation="MKAMETLLWSIALPGFGQLLNRKYIKGIVFIFLELLINTQSQFNE
FT                   AIWLSFLGRTYEAANIVKINWLMFYPCLYFFTLWDAFKDAGGGQTPYSFLPFVCSAYSV
FT                   TVGLIYSFDVTIAGIFFGPIWLPILSVIPGVAIGRLLQILLLKWK"
FT   gene            586293..588371
FT                   /locus_tag="GTNG_0525"
FT   CDS_pept        586293..588371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0525"
FT                   /product="Carbon starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65907"
FT                   /db_xref="GOA:A4IKQ3"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKQ3"
FT                   /protein_id="ABO65907.1"
FT                   /translation="MKGLKSILLWGLISVLGAAGFAILALSRGESINAIWLIVAAVCTY
FT                   AVAYRFYSRFIARKVFGLDDNRKTPAEVFNDGKDYVPTNKWVLFGHHFAAIAGAGPLVG
FT                   PILAAQMGYLPGTLWIIIGVVLGGAVQDFIILFASMRRNGKSLGEMIKEEMGPVTGFIA
FT                   ALGILGIMIILLAVLALVVVKALVGSPWGMFTIAATIPIAILMGIYMRFIRPGRVAEAS
FT                   LGGVILLILSIVAGQYVSEHPTLSAMFTLKGETIAILMIIYGFVASALPVWLLLAPRDY
FT                   LSTFLKIGTIVGLALGILVVMPDLQMPAVTKFIDGTGPVFAGNLFPFLFITIACGAVSG
FT                   FHALVSSGTTPKMIELESHSRPIGYGAMLMESFVAVMAMIAACILTPGAYFAINSPAAV
FT                   IGTDVAQAAKVVSSWGFTITPDMLTELAKDVGEQTVLSRTGGAPTLAIGMAVILSDIIG
FT                   GKALMAFWYHFAILFEALFILTTIDAGTRVGRFMIQDIMGTFYKPLGKTDSLVSNLIAT
FT                   TLCVLAWGYFLYQGVVDPLGGINTLWPLFGIANQMLAGIALLFATTVLFKMGKKAYVWV
FT                   TLVPTTWLLVVTLTAGYQKLFHEDVKIGFLSHAKLFKEHLSQGKVLAPAANEAQMRQII
FT                   MNDYIDAVLCAIFMLVVIAMLISALNIWIKVLQNKHVPLKEAPYVPRDSEEGAKNYA"
FT   gene            588364..588567
FT                   /locus_tag="GTNG_0526"
FT   CDS_pept        588364..588567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0526"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65908"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKQ4"
FT                   /protein_id="ABO65908.1"
FT                   /translation="MPKWLQTILSYRRQFLDLLVGVPNYEKYVEHMKTHHPGEPIKSRK
FT                   EFFCEAQEARYNAKGGKVSRCC"
FT   gene            588770..589696
FT                   /locus_tag="GTNG_0527"
FT   CDS_pept        588770..589696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0527"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65909"
FT                   /db_xref="GOA:A4IKQ5"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKQ5"
FT                   /protein_id="ABO65909.1"
FT                   /translation="MRILVVGAGAVGGYFGGRLLEKGGDVTFLVRERRKRELEEHGLVI
FT                   HSVHGDAVLKPKLMVAGEPSEPFDVVIFSSKAYHLAGAIADAKPYIGQETMILPLLNGM
FT                   AHMDTLWETFGRRNVLGGLCFIETTLNEKGEIVQTSSAHDVRFGEWSGERTERTEALES
FT                   LFAGANARFRLSERIAADMWNKYLFIATMSGVTTLFRAPIGPIRSGEYGGAIIDRLLGE
FT                   IKEIMQAHGAPLTDEMAERQRIQLEQIAPTMKSSMQRDMEKGQLIEADHLQGYLLLLAK
FT                   RYGIQAPLLETVYHNLKIYEASRAAGE"
FT   gene            589834..591459
FT                   /locus_tag="GTNG_0528"
FT   CDS_pept        589834..591459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0528"
FT                   /product="Exo-alpha-1,4-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65910"
FT                   /db_xref="GOA:A4IKQ6"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKQ6"
FT                   /protein_id="ABO65910.1"
FT                   /translation="MKKTWWKEGIAYQIYPRSFMDANGDGIGDLRGIMEKLDYLVELGV
FT                   DIIWICPIYRSPNADNGYDISDYHAIMDEFGTMDDFDELLAEAHRRGLKVILDLVINHT
FT                   SDEHPWFIESRSSRDNPKRDWYIWRDGKDGREPNNWESIFGGSAWQYDEQTGQYYLHIF
FT                   DVKQPDLNWENDEVRQALYEMINWWLDKGIDGFRVDAISHIKKKPGLPDLPNPKGLKYV
FT                   PSFAGHMNQPGIMDYLKELKEQTFARYDIMTVGEANGVTVDDAEQWVGEEDGIFNMIFQ
FT                   FEHLGLWQRRTDGSIDVRRLKRTLTKWQKGLENRGWNALFLENHDLPRSVSTWGDDRDY
FT                   WLESAKALGALYFFMQGTPFIYQGQEIGMTNVQFSDINDYRDVAILRLYELERAKGRNH
FT                   DDIMRIIWQTGRDNSRTPMQWSDAPNAGFTSGTPWIKVNENYRTINVEAEQRDPNSIWS
FT                   FYKRMIQLRKTNELFVYGTYDLLLENHPSIYAYTRTLGHERALIIVNLSNRPSLYRYDG
FT                   IRLQSDDLALGNYPVRPHKKRDPL"
FT   gene            591559..592095
FT                   /locus_tag="GTNG_0529"
FT   CDS_pept        591559..592095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0529"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65911"
FT                   /db_xref="GOA:A4IKQ7"
FT                   /db_xref="InterPro:IPR023774"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKQ7"
FT                   /protein_id="ABO65911.1"
FT                   /translation="MSTIDPIRYPIGTFQAPAQFRAEDVKEWIAAIRELPDALRAAVAG
FT                   LNDEQLNTPYRDGGWTVAQVVHHLADASMNAFLRTKWGLTEDKPAIKPFEESEWAKTAD
FT                   ARSLPIEPSLMLLEGLHVRWATLLESMTEADFQRLICPEGAKQAMPLYVLTALYTWHGK
FT                   HHTAQIMSLRKRKGW"
FT   gene            592236..593441
FT                   /locus_tag="GTNG_0530"
FT   CDS_pept        592236..593441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0530"
FT                   /product="Antibiotic resistance protein (antibiotic
FT                   effluxprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65912"
FT                   /db_xref="GOA:A4IKQ8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKQ8"
FT                   /protein_id="ABO65912.1"
FT                   /translation="MNAQQKHVVAEQKEKIWTRNFVLICLANFFIFLGFQMTLPTLPLF
FT                   VEYLGGNDQLIGLVVGVFTFSALIVRPFAGHALETRGRRFVFLFGLLIFVISVGSYSFI
FT                   SSIFLLFLMRVVQGIGWGFSTTASGTVATDIIPANRRGEGMGYYGLSGNIALAFGPSLG
FT                   LVLAAAIPFSHLFMICAALGVASLLFAAAITYKKAEAGHDKGEKKWDLYEKTALIPSVL
FT                   LFFLTVTFGGIASFLPLYTAQKQIGGLQLYFLLYALALMVTRTFAGQLYDRKGHRAVFL
FT                   PGAGLVLLAMLMLAWLPGEWALLTAAVLYGFGFGMVQPGLQAWSVERAPVHRKGMANAT
FT                   FFSFFDLGVGIGAIVFGQISHWFGYPSIYLAAAGSVLISMLVYLSVLRKEQPLRSGQKR
FT                   NA"
FT   gene            complement(593465..594664)
FT                   /locus_tag="GTNG_0531"
FT   CDS_pept        complement(593465..594664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0531"
FT                   /product="Predicted SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65913"
FT                   /db_xref="GOA:A4IKQ9"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKQ9"
FT                   /protein_id="ABO65913.1"
FT                   /translation="MGVELMAKVILKRQRKKRLEQGHPWIFQSEVDRIEGDITPGDFVD
FT                   VYNHQGYWLAKGYINPASQIIVRILTQNPDDELNEEFFIERIRQAWAYRERMIPGIRSC
FT                   RAIYGEADFLPGLIVDKYEDVLSVQILALGMEKRKDWILRGLLDVFAPRAIYLRNDVYV
FT                   RELEGLKQEKGFWYGEAETEIEIEENGVKYIVDIEGGQKTGFFFDQRQNRAALRPLIGP
FT                   ETTVLDCFTHTGSFMLNACLYGAKHVTAVDISEHAIETAKRNAALNGFTNVDFVVANAF
FT                   DYLRESVRAGKQWDVVIIDPPAFAKSAHAVPKALRGYKDINLNGLKLVKDGGFFVTSSC
FT                   SYHVRPHMFQEMVADAAFDAKKVLRQVYWSGAGYDHPKLLAADEGDYLKFAIYEVHSRR
FT                   "
FT   gene            595162..595752
FT                   /locus_tag="GTNG_0532"
FT   CDS_pept        595162..595752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0532"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65914"
FT                   /db_xref="GOA:A4IKR0"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKR0"
FT                   /protein_id="ABO65914.1"
FT                   /translation="MVKTARGLKLADILTTIVIAIVFGVIYKVWSPVYEVVKVFGVHAD
FT                   QLVYGMWFIASSLTYLLIRKPGVALLAEIAASSGELIMGSQWGLEVLIYGVVQGLFAEL
FT                   VFAAFRYRRFDVFVVSLSAVSATVGSLIMDFYKGYIEALAPWNMALFLLARFVGAILIS
FT                   GVFAVSLAKALEKAGVTQMWRPASKEDYDALNR"
FT   gene            595768..597222
FT                   /locus_tag="GTNG_0533"
FT   CDS_pept        595768..597222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0533"
FT                   /product="Cation ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65915"
FT                   /db_xref="GOA:A4IKR1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKR1"
FT                   /protein_id="ABO65915.1"
FT                   /translation="MGHGITIDRLRLKFPGHRELLFHDLSLSITAGEKVLFLGPSGCGK
FT                   STLLQVMAGIIPNSVDVPMKAEHLELPKRWGYVFQDPDAQFCMPYADEEIAFALENRGV
FT                   PREEMPARIRALLDQVGLTIEPHTDIHTLSGGMKQRLALASVLALEPEVLFLDEPTALL
FT                   DEEGTKAVWQTVKKVSRDKTVIIVEHKIDHVLDFVDRIVLLGRDGRVMADGKARTVFSQ
FT                   YKDVISAEGIWHPGVWDEYDRRVQRRKWREGEELLCLRDFRGFRKREVKISVSEAVVRA
FT                   GEWIAVTGRNGAGKSTLLHALMQLIRTQGDYRLLGDDVKQRQPLHRHIAFVFQNPEFQF
FT                   VTHSVRDELAYSLRLEGRSSEETEETVARLLREFDLVGQQDTHPYQLSVGQKRRLSVAA
FT                   SVVAGQRLFLLDEPTFGQDAKNTFALLEMLESYREQGAAIVMVTHDEQIVRRFATRRWV
FT                   IEGGALVQDERLGIRELAFAEGGAGQ"
FT   gene            597219..598001
FT                   /locus_tag="GTNG_0534"
FT   CDS_pept        597219..598001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0534"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65916"
FT                   /db_xref="GOA:A4IKR2"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKR2"
FT                   /protein_id="ABO65916.1"
FT                   /translation="MKWEIHRRETWLHETNPSLKLIVLVILFFAVLFIHNPNVLINFSL
FT                   ALFVLFCFGTGYSANALVWMFLPFFLIFVSTASSMMMFGEGKTTWFRWGLIHVTEESFW
FT                   RGVHLGFRALALGLLGLIFSLTTRPVHLFYSLMQQLKLKPKYAYSFLAAVRLLPMMIEE
FT                   FQNVHYALKVRGVPNRGGFSKVKRYAIPLLSQSIRRAQRIAVAMEAKQFSGSGPRTFYY
FT                   EIGFGKYDVLFVILFVVLLFVSYHVGIHYPYISINDVR"
FT   gene            598018..598629
FT                   /gene="tenI"
FT                   /locus_tag="GTNG_0535"
FT   CDS_pept        598018..598629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tenI"
FT                   /locus_tag="GTNG_0535"
FT                   /product="Regulatory protein TenI"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65917"
FT                   /db_xref="GOA:A4IKR3"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKR3"
FT                   /protein_id="ABO65917.1"
FT                   /translation="MGTLHFVSTGRQTADEFAAICQHIHPYADCIHIREKEKTAREVAA
FT                   FVTALLRVGVPPQKIIVNDRVDVAAVYGVHGVQLAYHSLPVRAVRRSFPSLTVGCSVHG
FT                   LAEAKQAEEDGAHFCLFGHIFPTASKPGVLPRGVDLLKEIAAAVHIPVIAIGGIHAGNA
FT                   RRVLEAGAAGVAVLSAIFFAADPVSEAKRLAEIVKGERIK"
FT   gene            598626..599765
FT                   /locus_tag="GTNG_0536"
FT   CDS_pept        598626..599765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0536"
FT                   /product="Glycine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65918"
FT                   /db_xref="GOA:A4IKR4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKR4"
FT                   /protein_id="ABO65918.1"
FT                   /translation="MTIHYYDVAIVGGGVIGAAVAFELAKRKYRVAILEKGTMAGESSS
FT                   AAAGMLGAQAEFSTPSPLVPLALKSRTLMPSLAEELKERTGIDIGLVEKGMIKIATTEE
FT                   EAEDLRRHYTFWSATDQPVRWLTKEEVLEIEPRLAMEAIVGAMYIEGDGQVSAPDLAAA
FT                   LVHAAVSAGARLYEYTEVLNIRSDAGGHHLDTTDGTFSAEAVVIASGAWASQLGNLLGL
FT                   PLSVSPVKGECVMVRTPVPLLQATVFAKNGCYIVPKRGNQLLIGATSTPGTYDRHVCAG
FT                   GVMNLLHRAARLLPDVKQAEWVRAWSGIRPQTKDGLPYIGEHPERHGVFVAAGHYRNGI
FT                   LLSAITGQLMADLIERKEPEVDLSPFSLTRHSEEKVGIE"
FT   gene            599762..599965
FT                   /gene="thiS"
FT                   /locus_tag="GTNG_0537"
FT   CDS_pept        599762..599965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="GTNG_0537"
FT                   /product="ThiS protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65919"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKR5"
FT                   /protein_id="ABO65919.1"
FT                   /translation="MTLIVNGETITVPDEVKTVSDLLSHFRLDNKLAIVEVNVRIIQKH
FT                   EYGITTLANGDRVEIVHFVGGG"
FT   gene            599967..600734
FT                   /gene="thiG"
FT                   /locus_tag="GTNG_0538"
FT   CDS_pept        599967..600734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="GTNG_0538"
FT                   /product="Thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65920"
FT                   /db_xref="GOA:A4IKR6"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKR6"
FT                   /protein_id="ABO65920.1"
FT                   /translation="MLKIGPYEFSSRLLLGTGKYPSLDVQKEAVEASGAEILTFAVRRM
FT                   NIFSPEQPNFLEQLDLSKYKLLPNTAGAKTAEEAVRIARLAKASGLCDMIKVEVIGCDK
FT                   TLLPDPVETLKAAEMLLEEGFIVLPYTSDDVVLARRLQELGCHAVMPGASPIGSGQGII
FT                   NPLNLSFIIEQATVPVIVDAGIGGPADAVLAMELGADGVLLNTAVSGAADPVKMAKAMK
FT                   LAIEAGRLGYEAGRIPKKRYASASSPMEGMSVV"
FT   gene            600731..601756
FT                   /gene="moeB"
FT                   /locus_tag="GTNG_0539"
FT   CDS_pept        600731..601756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeB"
FT                   /locus_tag="GTNG_0539"
FT                   /product="Molybdopterin biosynthesis MoeB protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65921"
FT                   /db_xref="GOA:A4IKR7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKR7"
FT                   /protein_id="ABO65921.1"
FT                   /translation="MNERYSRQQLFAPIGEAGQKKIREKHVVLIGAGALGTGNAEALVR
FT                   AGIGKLTIIDRDYVEWSNLQRQQLYSEADAKERLPKAIAAKRRLEQVNSDVQIEAIVGD
FT                   AGPEELEALVAEQRPHLLIDATDNFDARMVINDVAYKYSIPWIYGACVGSYGLSYAFIP
FT                   GRTPCLYCLLETVPQGGLTCDTAGIISPTVQMVVSYQTAEALKILVEDREALRGKLVSF
FT                   DLWTNEYAAIRIDAVKRDNCPTCGHDPSYPFLSYEQQTKTAVLCGRDSVQIRPSARRQY
FT                   DLNELAALFRRQGLQAEANPYLVSVSIGGKRLVVFGDGRALVHGTKDVQEAKTIYYRYL
FT                   G"
FT   gene            602266..603516
FT                   /locus_tag="GTNG_0540"
FT   CDS_pept        602266..603516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0540"
FT                   /product="Hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65922"
FT                   /db_xref="GOA:A4IKR8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKR8"
FT                   /protein_id="ABO65922.1"
FT                   /translation="MFGWFFLFLLVNALFASAEAAFSSASKARLKHYAEEHPHNQRLQA
FT                   VIEQLDRALLALAIANRLTSITAVALFIYIAASLLGEQTGLFVSIAVMTILSIVFSDIL
FT                   PKSMAKEQAETLAIRYVSLAYGLMKLMAPVTALFQAMRERISRRFTNGAAAPAVTEEDI
FT                   KVMVELSEEEGVIDNKEKELIQRSLDFDEILVEEIFTPRADMVAVEVNQPIEEIRDVFL
FT                   EERYSRIPVYEGDIDNVIGILSESDFFSELVQNHDVRIRELLRQPLFVVESMKVSDLLP
FT                   ELQKSKVHMAIVVDEFGGTAGLITLEDIIEQIVGEIWDEHDEAVKTVRQIDEHSFEFSA
FT                   ELPLDEFCEVMKIDVPESESRTLGGWIFEMFERIPAVGETLQYGPLTLTVRQVDNRRIR
FT                   KVLVSLNQPLAGQAGGM"
FT   gene            complement(603590..603802)
FT                   /locus_tag="GTNG_0541"
FT   CDS_pept        complement(603590..603802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0541"
FT                   /product="Small acid-soluble spore protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65923"
FT                   /db_xref="GOA:A4IKR9"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKR9"
FT                   /protein_id="ABO65923.1"
FT                   /translation="MARNNNNNQLLVAGAQQAIDQMKFEIAQEFGVNLGADTTSRANGS
FT                   VGGEITKRLVAMAQQQLGGQFGNVQ"
FT   gene            604089..604331
FT                   /locus_tag="GTNG_0542"
FT   CDS_pept        604089..604331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0542"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65924"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKS0"
FT                   /protein_id="ABO65924.1"
FT                   /translation="MNVCPLCNGLRQITVYCSYCQQPMEDQGKITDYFDDYSPYMDGDL
FT                   MKLVDGYPYTYTNHECVHLFYCPHCQEEEVRFIKE"
FT   gene            complement(604384..605496)
FT                   /locus_tag="GTNG_0543"
FT   CDS_pept        complement(604384..605496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0543"
FT                   /product="Sugar ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65925"
FT                   /db_xref="GOA:A4IKS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKS1"
FT                   /protein_id="ABO65925.1"
FT                   /translation="MAELILDHIYKIYDNNVTAVKDFNLHIQDKEFIVFVGPSGCGKST
FT                   TLRMVAGLEEISKGDLYIDGKRMNDVPPKDRDIAMVFQNYALYPHMSVYDNMAFGLKLR
FT                   KFPKAEIDKRVREAARILGLEQYLDRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLS
FT                   NLDAKLRVQMRSEIAKLHQRLETTTIYVTHDQTEAMTMATRLVVMKDGVIQQVGTPREV
FT                   YERPENVFVGGFIGSPAMNFIKGTLQDGKFVVGNTSFGIPEGKMKVLRDQGYIGKEVIL
FT                   GIRPEDIHDEPLFLEASPATKITAHVEVAELLGAESMIYSNIDGQEFVARIDARTEIKP
FT                   GHRLDLALDMNKAHFFDIETERRIRSADEK"
FT   gene            complement(605631..606518)
FT                   /locus_tag="GTNG_0544"
FT   CDS_pept        complement(605631..606518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0544"
FT                   /product="Leucine-rich protein transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65926"
FT                   /db_xref="GOA:A4IKS2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKS2"
FT                   /protein_id="ABO65926.1"
FT                   /translation="MLKELESLYEGDIVINGQPEHPEAYEWFYTADGDEIGIAKQRLTK
FT                   REQRLLALFLTPTEHRRERESEEERVWKRWMENGDPSAPAMLTTPYCRLIHFTVNQPIT
FT                   NKTEFAETIHNLFESPITIVWDKDKNGLIIEAKQKRTAELPLLAEMADALAADFYTTIH
FT                   LFIGPVRPVDDRLHESFLLEKECFSAARRFWPKQTVYEWEDAIPLPLLSAESDDKTDRI
FT                   LSFLDQFDEDEIRAMETFLQCNLNVSMAAKKLYMHRNSLQYRIDKWTEQTGIDIKRFKG
FT                   AVAIYLAILHRRLT"
FT   gene            complement(606601..606789)
FT                   /locus_tag="GTNG_0545"
FT   CDS_pept        complement(606601..606789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0545"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65927"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKS3"
FT                   /protein_id="ABO65927.1"
FT                   /translation="MERKEAGRQDALYEGRNEYYMDIDRMINEGMAGGNVYGHDDEVNI
FT                   EEARDLVKEEPPYEAGD"
FT   gene            complement(607261..608427)
FT                   /locus_tag="GTNG_0546"
FT   CDS_pept        complement(607261..608427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0546"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65928"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKS4"
FT                   /protein_id="ABO65928.1"
FT                   /translation="MITIGFRRDTGEWVCKERKGLYRFGNGQLAFAASLPDLTFAVRTK
FT                   GRRVGPLVGILVSESSIPALLSRKKRWLETVIRSIHADGGIAIVSAATSIGEKTVSGYV
FT                   FVPSLERFVEALTPLPDVVYNRIKSWKEEQTEPFQTAVARLAAHNIPLVNRSFFRKSDV
FT                   YDALRTDRRLWPYLLPTALVDKVDDVRAWLDQYGCIYVKQDNGSRGSGLFRLTALPGAA
FT                   VVCESPRSQKRLESLDELAPLVQSCRYIVQAAADADTWNGCRYDLRVLAHWQHDRYTIT
FT                   GIGVRLARTQSVTTHVFHGGTVLPYTEVKERIDEQELEQLIALSGKRLSERFGFVGEFS
FT                   ADIGVSRERQLYIYEINAKPMVFDEPEIEMHRLRRLNQLFAELAHLAP"
FT   gene            complement(608424..609773)
FT                   /locus_tag="GTNG_0547"
FT   CDS_pept        complement(608424..609773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0547"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65929"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKS5"
FT                   /protein_id="ABO65929.1"
FT                   /translation="MTYTLMIDETGENTVTLPASVQASGQTAAAFGSLLVPCRIVSSST
FT                   LTDCVIITSDVARRLSIPFAANVHVFLTAEAVHFGPLVGILTAGFTKSLHRPVGSRSFF
FT                   FAKLLAQEKQVGGFAFLFGTPHIDWENGTVNGYFYTERGWERHTVPLPTVIYNRLPNRR
FT                   IENSEMFQTVTETLQTAYGIPVFNGHFFNKWDIYRRLAAHPEAQPYLPATSAHITKQTI
FT                   EQFLTRYTEAYVKPADGSLGRGIYHLTKKNNVYECRSRDEQGETKTAVFPTAMALWHHL
FT                   LTDAPLHRYVIQQAVPLMTVNGRPTDFRVHTNKNEYGQWQVSAIAAKIAGRQSITTHMN
FT                   SGGIVKTLEEIFPDTAQRNNMLTRLNHVALTLSRCLDETSETLIGEIGFDLGVDKQGEI
FT                   WMFEANSKPGRSIFQHPGLKEADERTVLLPLAYAVHLSKTAITEPEALWS"
FT   gene            complement(609770..610840)
FT                   /locus_tag="GTNG_0548"
FT   CDS_pept        complement(609770..610840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0548"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65930"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKS6"
FT                   /protein_id="ABO65930.1"
FT                   /translation="MLISLGFVTLDEQQELTYFTEVAKRANHYGISVYRFSPLNIDPQT
FT                   EHVHGFVFQPETNEWMDAVFTIPPFLYDRCFYGHDDRSKKAKPIMHWLKQRPDLVFLGY
FT                   GLPGKWDVFESLSTHPLLSAYVPPTVRLEHTDDILELLRHEQAVVAKPMHGSSGRGIYV
FT                   IQKQGKTLSVQDGLGQERAVIARRRELEKLVTSLNRRDSYMLQPLLSLSTPAHEPFDLR
FT                   FLLQKDEGGRWVERVRAVRVGRPGTWVANIRSGADIRPFADWLDYLPSPKRVLVLDGIE
FT                   TIIRTLPTYIDNEFGSLFEIGLDLGVADNGAVWILDVNSKPGRKVINILPPEQQNAIYE
FT                   APLRYCLFLASGVNSR"
FT   gene            complement(610844..611920)
FT                   /locus_tag="GTNG_0549"
FT   CDS_pept        complement(610844..611920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0549"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65931"
FT                   /db_xref="GOA:A4IKS7"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKS7"
FT                   /protein_id="ABO65931.1"
FT                   /translation="MSEQRTVAVLTEITETTEQPSFGSIHCFCEELAQCAKERGLFFYV
FT                   TSPSLYLQRIGYQWIGGEWMKRDVPPADVIYNRLHSRQSEHSPLFAELLTRLAVEGGSM
FT                   FNHRFLHKWEVYRYFEQHEYLHPYLPKTALWSNEDTLEAFLTAFPSVFLKPIHGSQGRG
FT                   IFRLERSDGTIRLRHSTSASTTTYSSIDTLVSALRRRTKAPMIIQQGLEIHTIDGRPVD
FT                   FRLLCHRVRNNHWRVTSAVARVAPPDQFVANLARGGELMAINTVLREWYTASDAFQQKQ
FT                   LLKEIAMEAATVLALEAEGLYGELGIDLAIDVHDQPWIIEVNTKPSKQTDMTSAPQTVR
FT                   PSAKAIIEYCLTLMEEKE"
FT   gene            612046..613179
FT                   /locus_tag="GTNG_0550"
FT   CDS_pept        612046..613179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0550"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65932"
FT                   /db_xref="GOA:A4IKS8"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="InterPro:IPR016991"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKS8"
FT                   /protein_id="ABO65932.1"
FT                   /translation="MNTFVYLLFMMAVGALIGGMTNFIAIVMLFRPYEPIYIFGKRLPL
FT                   TPGLIPKRRRELAEQLGKTVVEHLVTPEGLRRKLTDPVFVAEVADWGREWLKRWLSRRE
FT                   TPAQLLERLGVHAPDEWLSELAAKQAGRAYEQWSETWRLRPIRDLLSPELKETMESRIE
FT                   SLADYLADRVIDYFSSEEGKRQIAGMIDRFFQERGMVGGMMQMLLGNVNFVDKVQSELG
FT                   KFLRHAGTRAMLARLLWTEWNKWISYPLAAVEEMIGRQRIKETVSAAARGLVRNNDWLD
FT                   RPLAELIAPYERELFDRFVPQAANAAIHALSDKIEGIVGKLGLADIVRNQVESFSLRRL
FT                   EVIILSIARRELKMITYLGALLGAMIGAVQGIIGLWL"
FT   gene            613252..613611
FT                   /locus_tag="GTNG_0551"
FT   CDS_pept        613252..613611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0551"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65933"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKS9"
FT                   /protein_id="ABO65933.1"
FT                   /translation="MSESLHALARQLEQAIRASQPFQQLKQAYEDVRRDETAYQMFANF
FT                   RDIQLRLHEKQMRGAAILPDEIEQAQKAMALAQQNAKLARLMALEQQMSMTIAEVQQIA
FT                   MKPLEELHRSLMEEK"
FT   gene            613756..614622
FT                   /locus_tag="GTNG_0552"
FT   CDS_pept        613756..614622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0552"
FT                   /product="Hydrolase, haloacid dehalogenase-like family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65934"
FT                   /db_xref="GOA:A4IKT0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKT0"
FT                   /protein_id="ABO65934.1"
FT                   /translation="MYYKLLALNIDGTILKNNGRLPRETKEAVAYVKRKGVYVTLMTSR
FT                   NLLSARKVAKALRLDGMLITFQGAMIGKTLDDKLFEAVIPEERTFNIVQILENFNCNIR
FT                   LMHERYSLGNRKKVKKNLVVQTVLSSSDPFFYPTQFVDSLGDVLIDEPVAVPKIDVYFA
FT                   EDEERDEAAAVLAKSVPSIDMIMHPNGKMEIVPQGVSKLTGLRRLAQHIGVSLKETVVI
FT                   GDGVDDLPAIEAAGLGVAMGNAPVEVKRAADWVTRSNEQLGVAYMVKEHFRKQQRIEFL
FT                   QKLKTKQ"
FT   gene            614845..616350
FT                   /locus_tag="GTNG_0553"
FT   CDS_pept        614845..616350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0553"
FT                   /product="Coproporphyrinogen oxidase, anaerobic"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65935"
FT                   /db_xref="GOA:A4IKT1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023995"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKT1"
FT                   /protein_id="ABO65935.1"
FT                   /translation="MNVRIEIQGLPNPERFQRPLEVITELFFESPVLSFASLLEADASV
FT                   SFTVNENGRITVSGTLVDKATGRVEEATYEYDAPIGADGKAREKRLKNAIFHVYVTLLE
FT                   RYTNIIQPWGILTGVRPVKLLHQLLRSGMTKEEAHQKLAEEYLVTKEKIELMQAIVDRQ
FT                   LTVVPDLYDLSHEVSIYIGIPFCPTKCAYCTFPAYAINGRQGSVDAFLAGLHYEMEAVG
FT                   RFLRERGIRITTIYYGGGTPTSITAEEMDQLYAHMYKVFPDVDRVREITVEAGRPDTIT
FT                   PEKLDVLKKWQIDRISINPQSYIQETLKAIGRHHTVEETINKFHLARKMGMNNINMDLI
FT                   IGLPGEGLREFTHTLAETEQLMPESLTVHTLSFKRASEMTKNKQKYKVADREEIQAMMK
FT                   AAEEWTSKHGYVPYYLYRQKNILGNLENVGYALPGHESIYNIMIMEEQQSIIGLGCGAS
FT                   SKFVDPKTRKITRQANPKEPKVYNEHFMEYTEEKLKIMEAIFG"
FT   gene            complement(616385..616603)
FT                   /locus_tag="GTNG_0554"
FT   CDS_pept        complement(616385..616603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0554"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65936"
FT                   /db_xref="InterPro:IPR025544"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKT2"
FT                   /protein_id="ABO65936.1"
FT                   /translation="MNHDSAKGDVHMPTYTLTAFERNGEKLLDETFEAANDEEAKKIGE
FT                   QKLRERGCFDKTHRCVNASGKLILFHR"
FT   gene            616718..617617
FT                   /locus_tag="GTNG_0555"
FT   CDS_pept        616718..617617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0555"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65937"
FT                   /db_xref="GOA:A4IKT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKT3"
FT                   /protein_id="ABO65937.1"
FT                   /translation="MSLEIIDVTKRFGQTTAVDHLTLTVPEGKMFGLLGANGAGKTTTF
FT                   RMILGLLLPTEGTIRWQGESIDYSKSHLIGYLPEERGLYPKLKVQEQLLYLGRLRGMKK
FT                   ADIVPEINRWLERFHIRDYANKRVEELSKGNQQKIQFIAAVLHRPNLLILDEPFSGLDP
FT                   VNVELLKEAVLDLKRNGTTIVFSSHRMEHVEELCEHVCILRSGQAIVSGALRELKRSFG
FT                   RKNLLIRGEGAFEELKDFPGVLRYNQTAEGVRLQIANEETAQAIFRHIADRVTVRLFAL
FT                   EEPSLHDIFIEKVGAAYE"
FT   gene            617610..618839
FT                   /locus_tag="GTNG_0556"
FT   CDS_pept        617610..618839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0556"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65938"
FT                   /db_xref="GOA:A4IKT4"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKT4"
FT                   /protein_id="ABO65938.1"
FT                   /translation="MNKFWLVLGHTYVTKLKAKAFLITTAITCLLIIGLANIKTIIEFF
FT                   TSDEQEHVAVIDRTESLYKALEKQVNREEITLTKITDMEDEAKKAVKEGEWDGLLILSM
FT                   DAEGLPEAAYYANTIADNRTPEELERVLNELKTALSAAKIGLTEEQMAVLYQPVPFQKV
FT                   ALEENAKTEEELNQARSLVYVLLFAMYMFVLMYGGMMATEVATEKSSRVMEILVSSVSP
FT                   VQHLFGKIIGVALVSLTQFFVFFAVGFTALKMNGQELWRFLGFDNVSMSIWVYALIFFL
FT                   LGYLLYAVLFAVLGSLVSRVEDVQSAITPAMILVIVAFMIAMSGLNMPESAFIIGASFI
FT                   PFFTPMLMFLRVGLVSVPMWEVALSFALLLATIAVLIYIGAKVYRGGVLMYGRMNIFKD
FT                   MKQAVQLTKK"
FT   gene            618958..619938
FT                   /locus_tag="GTNG_0557"
FT   CDS_pept        618958..619938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0557"
FT                   /product="CMP-binding factor"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65939"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKT5"
FT                   /protein_id="ABO65939.1"
FT                   /translation="MAKGIIHYEVGEQVDLFLLIKSATKGIASNGKPFLTLILQDKSGD
FT                   IEAKLWDVSPDDEERYAPECIVKVVGDIHNYRGKLQLRIRSIRPAHPSEAVRVDDFLET
FT                   APLTREEMKAKVMDYIFSMENPNIQRITRYLLKKYETPFFEYPAATKNHHEFISGLAYH
FT                   VVSMLELAEALVRLYPSLNKDLLYAGIILHDLGKVIELSGPVSAVYTLEGNLLGHISIM
FT                   GQAKLARAAEQLGIQGEEVVILQHLVLSHHGKAEWGSPKPPLVKEAEVLHYIDNLDAKM
FT                   NMIDRALEKVKPGEFTERIFALDNRSFYKPAFLAVSAPKTAGNEK"
FT   gene            620185..620376
FT                   /locus_tag="GTNG_0558"
FT   CDS_pept        620185..620376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0558"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65940"
FT                   /db_xref="GOA:A4IKT6"
FT                   /db_xref="InterPro:IPR025428"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKT6"
FT                   /protein_id="ABO65940.1"
FT                   /translation="MEMLTLPWWIYLVVAGIIFSGYMTVKTAAREREIDEAFIEKEGEI
FT                   YMERIRQERERRKQAKSL"
FT   gene            620499..621587
FT                   /locus_tag="GTNG_0559"
FT   CDS_pept        620499..621587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0559"
FT                   /product="Phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65941"
FT                   /db_xref="GOA:A4IKT7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKT7"
FT                   /protein_id="ABO65941.1"
FT                   /translation="MTVERVYNFNAGPSALPLPVLERAQKELLNFQNTGMSVMELSHRS
FT                   KEYDAVHNAAKERLKRLLNVPDGYDILFLQGGASLQFSMVPMNFLTEGKIGCYVLTGAW
FT                   SEKALKEAQKIGLTTVVASSKEANYTYIPSLDDVKWPKDASYVHITSNNTIFGTQWNEF
FT                   PDVPVDLVADMSSDILSRPFDVSKFALIYAGAQKNLGPSGVTVVIIRNDLLERIPDGLP
FT                   TMLDYRTHQKSNSLYNTPPTFAIYMLSLVLEWVEEQGGVAAIEARNQQKAAVLYEAIDE
FT                   SGGFYKPHAEKGSRSLMNVTFTLPSEELTKAFLAEAKERNFVGLGGHRSVGGCRASIYN
FT                   AVPLEACEALAAFMNDFRRRFA"
FT   gene            621682..622206
FT                   /locus_tag="GTNG_0560"
FT   CDS_pept        621682..622206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0560"
FT                   /product="Putative tryptophan transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65942"
FT                   /db_xref="GOA:A4IKT8"
FT                   /db_xref="InterPro:IPR031360"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKT8"
FT                   /protein_id="ABO65942.1"
FT                   /translation="MNVRTLVSMALLVGIGAVLHAVIPGLFAGMKPDMMLAMMFLAILL
FT                   FPSAKAAGIVGVATGLISAMTTTFPGGQLPNVIDKIITAFVVFALVTLLKKYSQTVIGA
FT                   AVLTAVGTVISGVVFLTAVLLIVGLPGEAAFSTLFVTVVLPAAALNTVAMVIVYPIVAS
FT                   IFRRMNVTAHV"
FT   gene            622668..623270
FT                   /locus_tag="GTNG_0561"
FT   CDS_pept        622668..623270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0561"
FT                   /product="Protease production regulatory protein hpr"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65943"
FT                   /db_xref="GOA:A4IKT9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR023488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKT9"
FT                   /protein_id="ABO65943.1"
FT                   /translation="MKSTEQHYSIKEAMLFSQRIAQLSKALWKSIEKDWQQWIKPFNLN
FT                   INEHHILWIAYHFKGASISEIAKFGVMHVSTAFNFSKKLEEKGLLSFSKKQDDKRNTYI
FT                   ELTEKGEEVLMKLMETYDPTRNAVFNGALPLRELYGKFPEILEMMCIVRNIYGDDFMEI
FT                   FERAFENIKEDFVEQDGKLVKRAPKAEEHEKELASPG"
FT   gene            complement(623267..623608)
FT                   /locus_tag="GTNG_0562"
FT   CDS_pept        complement(623267..623608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0562"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65944"
FT                   /db_xref="InterPro:IPR015058"
FT                   /db_xref="InterPro:IPR035945"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKU0"
FT                   /protein_id="ABO65944.1"
FT                   /translation="MESLEKRVAKLEFHQSLLMEMVDEAKKPFYSLIIRADLTKEEVDA
FT                   FLSFCQELAEQYEQQKAEGLTIFTPLLVQFAGMLHPNLPLEQTVDAMLAQQMFVPLMTE
FT                   LKTLIRTVS"
FT   gene            623783..624070
FT                   /locus_tag="GTNG_0563"
FT   CDS_pept        623783..624070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0563"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65945"
FT                   /db_xref="GOA:A4IKU1"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKU1"
FT                   /protein_id="ABO65945.1"
FT                   /translation="MGRRGTALALYFIPLAGMILFLVNKLTHSLCAQRDIPEEQQPAVF
FT                   RTINGLITILLISSYLRSIVYIKSCPPCSQVKMGTMKKKGAPGVGAPSFI"
FT   gene            624435..625271
FT                   /gene="prsA"
FT                   /locus_tag="GTNG_0564"
FT   CDS_pept        624435..625271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="GTNG_0564"
FT                   /product="Protein export protein prsA"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65946"
FT                   /db_xref="GOA:A4IKU2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR023059"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKU2"
FT                   /protein_id="ABO65946.1"
FT                   /translation="MKKWMMATAVVSLMALSACNNGDSEAVVETKNGAITKDEFYNEMK
FT                   ERVGKTVLRDLIDEKVLSKKYKVTDEEIDREIERIKEAYGTQYDLAVQQNGEKVIREMI
FT                   KLDLLRAKAAIEDIKVTDKELKEYYDNYKPKVRASHILVEDEKTAKEVKAKLDKGEDFA
FT                   KLAKEYSQDPGSASNGGDLGWFGAGKMVKEFEEAAYKLKVGEVSDPIKTDYGYHIIKVT
FT                   DKEKKKTFDKMKEEITFEVKRSKLDPSTMQSKVDKLVKDANVKIKDKDLQDVLEQQ"
FT   gene            complement(625306..625740)
FT                   /locus_tag="GTNG_0565"
FT   CDS_pept        complement(625306..625740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0565"
FT                   /product="Bis(5'-nucleosyl)-tetraphosphatase
FT                   (asymmetrical)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65947"
FT                   /db_xref="GOA:A4IKU3"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKU3"
FT                   /protein_id="ABO65947.1"
FT                   /translation="MTVSVSDCIFCKIIKGELPAAKVYEDEHVLAFLDISQVTKGHTLV
FT                   IPKVHTENVFTLTPDMASRLFSVVPTIANALNKTFSPAGLNLLNNNGEAAGQTVFHYHL
FT                   HLIPRYGKGDGFGAVWKSHASDYTPADLQAIAATIREQLN"
FT   gene            626202..626939
FT                   /locus_tag="GTNG_0566"
FT   CDS_pept        626202..626939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0566"
FT                   /product="Putative ATP-binding protein of ABC-type"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65948"
FT                   /db_xref="GOA:A4IKU4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKU4"
FT                   /protein_id="ABO65948.1"
FT                   /translation="MTLLQVEHLYGGYTSQNVLEDVTFTVERGEMVALIGLNGAGKSTT
FT                   IKHIIGLMEPRRGTISVNGYTLAAKPETYRKQFAFIPETPVLYEELTLEEHLRLAAMAY
FT                   GLSEEEYERRLPPLLREFRLERRLSSFPAHFSKGMKQKVMIVCAFLLEPPLYVIDEPFL
FT                   GLDPLAIHALLERMNEQKAKGAGILLSTHILATAERYCDSFIILHQGRVKAKGTLDDIR
FT                   RQFGLKAATLDEVYIELTKDDAP"
FT   gene            626936..628150
FT                   /gene="escB"
FT                   /locus_tag="GTNG_0567"
FT   CDS_pept        626936..628150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="escB"
FT                   /locus_tag="GTNG_0567"
FT                   /product="ABC transporter (permease) EscB"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65949"
FT                   /db_xref="GOA:A4IKU5"
FT                   /db_xref="InterPro:IPR010288"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKU5"
FT                   /protein_id="ABO65949.1"
FT                   /translation="MIDARKLWWQRLRAEGKKRARYLRYMLNDHLLVGLIIVLSGVAVT
FT                   YKRWVETLPDSFPYAAIAAVAFGWAAAAGTVRTLFREADTVFLLAAEWQLRPYIRRAFL
FT                   FSAMWHVYGLCLLLLLAGPLHSRFSSVPWPLFLLGLVGLKFWNLWAAWKGSYIAEPSFH
FT                   RQSALARFGLAALAVYFWLADAPWLFLVTIVALMVALSIYLARLTKDKMWKWDRLIAEE
FT                   QRAARAFYRLANLFTDVPEWKEEAKRRRWLDPLLRLIPHGQGNAFFYLYVRTFLRAGGY
FT                   AGLYIRLTMIGSVLLVVVDHEYAQAAILFLFLYATAIQLSVLPSRHRYLLWTQLYPLPR
FT                   TQPAAAAIRLFSILLIGQNTVFHLVLFAVSPHFLWLVTWVGGIVWGVWTAKRYVRPRHE
FT                   RKAGR"
FT   gene            628397..629854
FT                   /locus_tag="GTNG_0568"
FT   CDS_pept        628397..629854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0568"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65950"
FT                   /db_xref="GOA:A4IKU6"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKU6"
FT                   /protein_id="ABO65950.1"
FT                   /translation="MGVELVALHWIYLLFIVLIIGFMVARKDTSLVCIAGIFLLAAVAT
FT                   HSLSAAVSGVFNSFIYAITELLPTILVISIIVAMSKVLSVTGINDVMVSPFVRFIRTPA
FT                   WAYWTIGMLMMVISWFFWPSPAVALMGAVLLPAAVRVGLPALGVAMAMNLFGHGIALSG
FT                   DFIIQAAPKLTADAAGLPVSEVIAASVPLVFVMGVVTTVTAFYLLRRDMKRGRLTSGDA
FT                   EIAAATDSTLEKTGGLLAEPTKKWLAFLIPVLFALDVVAMFYLHLQGGEATALVGGTAI
FT                   FILILISILAHRQESFEEVTNYFIEGFQFGFKVFGPVIPIAAFFYLGDAGFAKIIGDYL
FT                   PQASQGIVNDLGVALAHAVPLSNEIGAVTLTIVGAITGLDGSGFSGISLAGSVAHLFAV
FT                   AIGGGAATLTALGQIAAIWVGGGTLVPWALIPAAAICGVDPFELARRNLIPVAVGLAVT
FT                   TVVAMFLIKENAVPCGRGGFFVIISMC"
FT   gene            630000..631037
FT                   /locus_tag="GTNG_0569"
FT   CDS_pept        630000..631037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0569"
FT                   /product="Uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65951"
FT                   /db_xref="GOA:A4IKU7"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKU7"
FT                   /protein_id="ABO65951.1"
FT                   /translation="MTRRINDTFLRACRGEKTAYVPVWYMRQAGRSQPEYRALKEKYSL
FT                   FEITHQPELCAYVTRLPVEQYGVDAAILYKDIMTPLPAIGVDVEIRGGVGPVIANPIRS
FT                   LHDVERLGEIDPEHDVPYVLETIRLLVNEQLDVPLIGFAGAPFTLASYMIEGGPSKNYH
FT                   KTKAFMYAEPKAWFALMDKLAEMTIRYVKAQIQAGASAVQIFDSWVGAVNADDYRTFIK
FT                   PAMARIFAALREEGAPLIMFGVGASHLAHEWNDLPLDVIGLDWRLSIREARRRGITKAI
FT                   QGNLDPAVLLAPWDVIEERVKRILDEGMEQPGYIFNLGHGIFPDVQPATLKRLTAFIHD
FT                   YTSTK"
FT   gene            631053..632003
FT                   /locus_tag="GTNG_0570"
FT   CDS_pept        631053..632003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0570"
FT                   /product="Ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65952"
FT                   /db_xref="GOA:A4IKU8"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKU8"
FT                   /protein_id="ABO65952.1"
FT                   /translation="MAKKTVGLLVMAYGTPYKEDDIERYYTHIRHGRKPPQEQIDDLKA
FT                   RYRAIGGLSPLAKITEAQAKQLEKRLNEMQDEVEFCMYLGLKHIEPFIEDAVERMHADG
FT                   VKEAVAIVLAPHYSTFSICSYNERAKAAAEKLGGPVIYTIDQWYDEPKFLQYWSEKVKA
FT                   IFDAMKEREREQAVLIVSAHSLPEKIIQAGDPYPAQLEDTAKRIAEQAGVTHYAVGWQS
FT                   AGNTPEPWLGPDVQDLTRQLHDEQGYTSFVYAPVGFVADHLEVLYDNDIECKQVTEEIG
FT                   ARYYRPEMPNTDPLFIDALATVVLKRLAKEGDEHE"
FT   gene            631996..633438
FT                   /locus_tag="GTNG_0571"
FT   CDS_pept        631996..633438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0571"
FT                   /product="Protoporphyrinogen IX oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65953"
FT                   /db_xref="GOA:A4IKU9"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKU9"
FT                   /protein_id="ABO65953.1"
FT                   /translation="MSEEKRTVVIIGGGITGLTAAYYLQKAIKEQRLPLTCKLVEATHR
FT                   LGGKVQTVIRDGYVIERGPDSFLARKTSAFRLVKEVGLEHEIVHNATGKSYILVNGQLY
FT                   PIPGGAVMGIPTRIAPFLTTGLFSPVGKLRAALDFVLPPVKTNGDMPLGQFFRRRLGDE
FT                   VVDNLIEPLLSGIYAGDIDEMSLMATFPQFFQLEQKYGSLVRGAKRTTPKEQKERKGAF
FT                   QTLKTGLQSLVEEVEKRLEPGSVIKGTRVERITRAGSVYRLQLSTGETWEADSVIITVP
FT                   HHIVPDMLADYPFFAPFRSVPLTSVATVALAFPEKAIRQDIDGTGFVVSRRSDYTMTAC
FT                   TWTHKKWPHTTPPGKALLRGYVGRPGDEDIVDQPDDEIVRIVLDDLNKVMKIDGHPEFA
FT                   VISRWKRAMPQYTVGHRERLAAIKQHMAAELPGVFLAGSSYEGLGLPDCIDQGEKAVRD
FT                   VLDYLRQGESNRSAEAVYSSAQ"
FT   gene            633638..634210
FT                   /locus_tag="GTNG_0572"
FT   CDS_pept        633638..634210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0572"
FT                   /product="Transcriptional regulator TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65954"
FT                   /db_xref="GOA:A4IKV0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKV0"
FT                   /protein_id="ABO65954.1"
FT                   /translation="MASDRKRQIIEAAAQSFAAFGYKATTMEQIAKLANVGKGTIYTFF
FT                   KSKEELLDEIVSSLIAEIKVEAEQAMDSSLPFSENVHRALYRILEFRQRHQLTAKLLQE
FT                   MRSIGTIAVQEVLTKFDRAMVEFIRQKIEAAVEKGEIRPCNAEITAFLMLKMYIALIVD
FT                   WEKDHQPLTKEQIAELFALYFLQGLSK"
FT   gene            634285..636669
FT                   /locus_tag="GTNG_0573"
FT   CDS_pept        634285..636669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0573"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65955"
FT                   /db_xref="GOA:A4IKV1"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKV1"
FT                   /protein_id="ABO65955.1"
FT                   /translation="MLIKELRTIIFRPKVLIPILAILLIPLLYSGSFLWAFWDPYGHVD
FT                   QLPVAVVNEDKGAVLDGKKINLGDDVVKRLKENGTFDWQFVSRKQVDDGLKNQRYYMAV
FT                   IIPSDFSANATTVQSGNPKPLRLVYIPNEGANYLAGKIGDSAIEAIKEEISKNVTKTYA
FT                   ETMLTNMKAAADGLDKASQGANQLHDGLRTAGQGSRSLSDGMEAAERGSASLAAGAEKV
FT                   KDGASDLSHYLTELAEKSLTFENGLQEASDGAKQLQTGATALQDGLGKLAVGSQKLASG
FT                   AVEAQNGASSLANGLHTSLHSMKELQSQLPSLTSGANELRDGAAELGEGIQAWQQKAGE
FT                   AADGASEVNIGLQQYAAQLERLIEQTDDPQQKATLQTLYEQLQPLVKGSESVATGIRGL
FT                   ADQAGRIKNGASQLADGAAAFASGQQAVQEGIGKLVNGQQQLVDGADRLVAGQQTLVDG
FT                   AKELENQLQSAYQGAQTVAVGSSKLADGVNQLATGSSQLVSGTSELADGANKLSDGVSA
FT                   VAEGATSLHQGFDSLLRGGRSLSTGLVRLEQGAGELADRLSEGAEKADSIQANERVSEM
FT                   IADPVQNDKRPLHHVPNYGTGFAPYFLSLGLFVGALLLTIVFPLREPVERPSSGVAWFF
FT                   GKWGVLAIVSAAQTLLADAWVLYGLDLHVQSVWRFLLFTWIISMAFMMIVQFLVTLFDN
FT                   PGRFLAILLLIAQLIGSAGTYPLELIPDALQSLHPWLPMTHAIHGLRTVISGGDFVLMW
FT                   KEAAILAIVATVFALGTLAYFCLLYRRRYAVWTETETTVEA"
FT   gene            637291..638025
FT                   /locus_tag="GTNG_0574"
FT   CDS_pept        637291..638025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0574"
FT                   /product="Metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65956"
FT                   /db_xref="GOA:A4IKV2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKV2"
FT                   /protein_id="ABO65956.1"
FT                   /translation="MKVTVIGYWGGFPAVNEATSAYLFEHDGFRLLVDCGSGALAKLQN
FT                   YTTVEDLDAVILSHYHYDHIADIGPLQYARLIHKTLGADLPVLPIYGHTEDEEAFERLT
FT                   HNGITEGIAYDPKGELAVGPFSITFLKTVHPVPCYAMRITAGDNTIVYTADSSYIPEFV
FT                   PFAKGADLLICECNFYAGQNAAPAGHMTSEEAATIAEGAGVGELWLTHLPHIGRHEQLI
FT                   EEAGRTFRGVIRLARTGLVWER"
FT   gene            638152..639702
FT                   /locus_tag="GTNG_0575"
FT   CDS_pept        638152..639702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0575"
FT                   /product="Long-chain-fatty-acid-CoA ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65957"
FT                   /db_xref="GOA:A4IKV3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKV3"
FT                   /protein_id="ABO65957.1"
FT                   /translation="MMMNLTARLAQMAKQLPDKDAYVFMGERCTYRQLNAAISQFADGL
FT                   AQLGIRQGDHVALLLGNSPQFVVSLYGALRLGATVIPINPIYTPEEISYILHNGDVKAA
FT                   IGLDLLAPLFAEAKKRLPLLKYAIVCETPQGKEKGISLSGEMKSFAEVLAAGSPDFTGP
FT                   ELKDDDVAVILYTSGTTGKPKGAMLTHKNLYSNAQDTADYLGINENDRVIAALPMFHVF
FT                   CLTVALNAPLMNGGTVLIMPKFSPSQLFALAREEKATIFAGVPTMYNFLYQHEEGSADD
FT                   LRTLRLCISGGASMPVALLENFEKKFNVIVSEGYGLSEASPVTCFNPLDRPRKPGSIGT
FT                   SIKNVENKVVNEYGEEVPIGEVGELVVRGPNVMKGYYKMPEETAAALRDGWLHTGDLAR
FT                   MDEDGYFYIVDRKKEMIIVGGYNVYPREVEEVLYSHPDVVEAAVIGVPDPDYGEMVRAF
FT                   VVTKNPELTEEQLLAYCRERLAKYKVPGEIDFLEELPKNATGKILRRALKERLTASHT"
FT   gene            639839..640849
FT                   /locus_tag="GTNG_0576"
FT   CDS_pept        639839..640849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0576"
FT                   /product="ABC transporter periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65958"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKV4"
FT                   /protein_id="ABO65958.1"
FT                   /translation="MGKHMQRLVALCAASILALSGCTGAKETGNSQGNDDGQEAKEKTY
FT                   KIGVTQIVEHPSLDAAREGFEQALKDKGLSVKYDVQIAQGDQSNNQTIATNFASDGVDL
FT                   IFANSTPSAQAALNATKDIPIIFTSVTDPVGAQLVQSMEQPGGNVTGTTDTHPEAIPKT
FT                   VEFITKYIKGNRVGMVYNAGEQNSVAQVDQVKKAMEGTDLKIVSASVSTSAEVKQATES
FT                   LVGKVDCLYIITDNTVVSALESVIQVANEHDIPLFVGELDSVKRGGFAAYGFDYYDIGY
FT                   EAGEMAAQILQDGKKPADLPVQYPQKLKLVINKKAAQEMGIELNPEWDSIAEYIE"
FT   gene            640919..641911
FT                   /locus_tag="GTNG_0577"
FT   CDS_pept        640919..641911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0577"
FT                   /product="Branched-chain amino acid ABC-type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65959"
FT                   /db_xref="GOA:A4IKV5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKV5"
FT                   /protein_id="ABO65959.1"
FT                   /translation="MFGSVEVGLIYAIMALGVYLSFRILDFPDLTVDGSFVTGASVAAV
FT                   MIVGGANPFAASAAALLAGFAAGTLTGLLHTKGKINPLLSGILMMIALYSINLRIMGKS
FT                   NVPLLQQETVITKITAAWQQTGFDAVLNQLLSFTGFAPRTWAILCSMAVLTLVVKGVLD
FT                   WLMKTEVGIALRAAGDNKPMVASFSANTDWLIVFGLGLSNALVAFSGALIAQYGGFSDV
FT                   NMGVGMIVIGLASVIIGEALFGAHSVVRATWAVIGGAIVYRLILALALRVEFLETGDVK
FT                   LITALIVISALIVPNVWAAQKEKRRKRRKAQQLERGEPVAGAKTNYKSI"
FT   gene            641877..642674
FT                   /locus_tag="GTNG_0578"
FT   CDS_pept        641877..642674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0578"
FT                   /product="ABC-type transporter, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65960"
FT                   /db_xref="GOA:A4IKV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKV6"
FT                   /protein_id="ABO65960.1"
FT                   /translation="MLELKRITKVFNEGTADEKIALRGIDLTLSPGDFVTVIGSNGAGK
FT                   STLMNIIAGRLSPDTGEVWINGRNVTTLKEHVRARYIGRVFQDPMAGTAPHMTIEENLV
FT                   LAYNRTKRRTLRLGVTRQKREWFRETLQSLHLGLENRLTAKVGLLSGGERQALSLLMAT
FT                   FTKPDVLLLDEHTAALDPARAELVTELTKQIVAQHNLTTLMVTHNMEQAIRLGNRLIMM
FT                   DGGQVIFSAEGKEKEELTVERLLEEFQRIRGSQFASDRAVLSS"
FT   gene            complement(642734..643597)
FT                   /locus_tag="GTNG_0579"
FT   CDS_pept        complement(642734..643597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0579"
FT                   /product="D-alanine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65961"
FT                   /db_xref="GOA:A4IKV7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005784"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKV7"
FT                   /protein_id="ABO65961.1"
FT                   /translation="MSVKPYVLTERGVLRCEQVTYPMEERGLQFGDGVYEVVSLYNGAY
FT                   IWLQEHLDRLYRSAAAIRLSVPFAPEELSERLEQLRRMNDVHEDAILYLQVTRGSFPRN
FT                   HAFPTENRPNLYAYIQPMARKTDEMTHGVRAILTKDVRWEYCYIKSLNLLPNVLAKQEA
FT                   VERGAFEAILHRDGVVTEGSSSNMFLVKGETVYTHPATERILNGIVRTKVKQFCADLGI
FT                   PLIEKAFSVHDIAEADELFLTSTTSAIIPIIQVDDTTIGNGQPGTVTKSLQAAYQKATQ
FT                   PATSNA"
FT   gene            643802..644518
FT                   /locus_tag="GTNG_0580"
FT   CDS_pept        643802..644518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0580"
FT                   /product="Branched-chain amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65962"
FT                   /db_xref="GOA:A4IKV8"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKV8"
FT                   /protein_id="ABO65962.1"
FT                   /translation="METTWTASKMAPFRQGMQAGVAIAIGYMPIALTFGLLAKTTGLTL
FT                   AETVLMSVIVFAGASQYIALSLLSVGTGIFEIILTTFILNIRHFLMSASLSEKAEPDEL
FT                   WKKALYAFGITDETFSVAAMKEGTVNASYMFGLIMMAYGSWVVNSGIGYAVGKSLPESL
FT                   QDSMSVALYAMFIGLLVPALKKQRKTVWLAGLAAVFNSLGTFVFHLSKGWSIVLATLLS
FT                   AVVVQWLAKEGGNKDE"
FT   gene            644511..644816
FT                   /locus_tag="GTNG_0581"
FT   CDS_pept        644511..644816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0581"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65963"
FT                   /db_xref="GOA:A4IKV9"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKV9"
FT                   /protein_id="ABO65963.1"
FT                   /translation="MNNAIIWMIIGMGLVTYLPRMLPLVLFGRVELSPFWQGVLKNVPY
FT                   AALGALVIPDIFFIQDDILFGIIGFAAAVIAAWLGANVIIVVLASVAVLSCYSMLI"
FT   gene            complement(644908..645498)
FT                   /locus_tag="GTNG_0582"
FT   CDS_pept        complement(644908..645498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0582"
FT                   /product="SCO1/SenC family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65964"
FT                   /db_xref="GOA:A4IKW0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKW0"
FT                   /protein_id="ABO65964.1"
FT                   /translation="MKKWYMIVAALVLVGISIGIFYFAVYKPSAMRLPDDVTMETAWGA
FT                   PYSFDDLPPKVRLVEFIYTNCPDICPNTTMQMAKLRDRLQKAGVFGRDVEFVTITIDPA
FT                   RDTKEKLQTYANTFGVTADGQGWVFLRGSEAETKKTADAFNFQYRDPGNGMMVHTSLAY
FT                   LLNRDGRVIEQIGMGESRFRVDEVYEVIMDELS"
FT   gene            645691..646977
FT                   /locus_tag="GTNG_0583"
FT   CDS_pept        645691..646977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0583"
FT                   /product="Isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65965"
FT                   /db_xref="GOA:A4IKW1"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKW1"
FT                   /protein_id="ABO65965.1"
FT                   /translation="MASFAERVRQLEESWKNEERWKGVVRPYSAEDVIKLRGSLDIEHT
FT                   LARRGAEKLWKLLNTEDYVHALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLAGHMY
FT                   PDQSLYPSNSVPHVVKRINQALQRADQIQYLEGSGDVDYFVPIVADAEAGFGGQLNVFE
FT                   LMKAMIEAGAAGVHFEDQLSSEKKCGHLGGKVLLPTQTAVRNLIAARLAADVMGVPTVL
FT                   IARTDANAADLITSDIDPRDQQFITGERTTEGFYRTRAGLDQAIARGLAYAPYADLIWC
FT                   ETSEPNLDEARRFAEAIHEQFPGKLLAYNCSPSFNWKKKLDDETIAKFQQELGKMGYKF
FT                   QFVTLAGFHALNYSMFELARGYKDRGMAAYAELQQAEFAAEKYGYTATRHQREVGTGYF
FT                   DEVAQVISGGQSSTVALKGSTEEEQFTTA"
FT   gene            647083..647277
FT                   /locus_tag="GTNG_0584"
FT   CDS_pept        647083..647277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0584"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65966"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKW2"
FT                   /protein_id="ABO65966.1"
FT                   /translation="MEKRTNDLPELMPAEFRVSTDLHFEQWTMNEETYAGDSVGEHTAL
FT                   EQANEYLAAKEIGQIFENS"
FT   gene            647409..647957
FT                   /locus_tag="GTNG_0585"
FT   CDS_pept        647409..647957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0585"
FT                   /product="Competence transcription factor CTF"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65967"
FT                   /db_xref="GOA:A4IKW3"
FT                   /db_xref="InterPro:IPR010461"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKW3"
FT                   /protein_id="ABO65967.1"
FT                   /translation="MKVNEFIVLEHFVVSRYTMAILPYLLNSDIYAKVIEEDGEYIVKK
FT                   TPTDIIKQSCDYYGCSFQGRKEGTKALIGITHKAPIAVEPSNGIYVFPTSSPRDSGCVW
FT                   LSHMHVYRYEPAKYERTVVYFRNGKSVFLDVSYKSFINQLYRTAQLRTKLSDRMEARER
FT                   KLQYIFRMQQKKEKDVPEH"
FT   gene            648051..648674
FT                   /locus_tag="GTNG_0586"
FT   CDS_pept        648051..648674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0586"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65968"
FT                   /db_xref="GOA:A4IKW4"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKW4"
FT                   /protein_id="ABO65968.1"
FT                   /translation="MNMETFEQWFTLDYVLSLLEHYRSFGVFPGIAATLLESFFPILPM
FT                   VVFVMANAAAFGLWKGFFISWLGASLGSLIVFWLTRRIGRQRFFHFVRRHQKVRRFMHW
FT                   IERHGFGPLFLLYCFPFTPSALINIVAGLSGISRQQFVLAVLLGKMVMIFMISFIGYDI
FT                   VALVRQPLRTAGIALVVLLLWYAGKRVEARFSLTEKQHGEGGGE"
FT   gene            648671..649225
FT                   /locus_tag="GTNG_0587"
FT   CDS_pept        648671..649225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0587"
FT                   /product="Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65969"
FT                   /db_xref="GOA:A4IKW5"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKW5"
FT                   /protein_id="ABO65969.1"
FT                   /translation="MTKEKKKEKRRYHWPWLTVVCFIVALRFFVFSSYMVEGKSMMPTL
FT                   QSGNLLIVNKLSYEIGSIRRFDIVVFHANQKEDYVKRVIGLPGDRIEYKNDILYVNGKK
FT                   VDEPYLRPYKKKLISGKLTGDFTLEEVTGERRVPAGCIFVLGDNRLGSWDSRHFGFVKI
FT                   DQVVGKVDLRYWPFEQFAFRF"
FT   gene            649473..652991
FT                   /locus_tag="GTNG_0588"
FT   CDS_pept        649473..652991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0588"
FT                   /product="ATP-dependent deoxyribonuclease, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65970"
FT                   /db_xref="GOA:A4IKW6"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKW6"
FT                   /protein_id="ABO65970.1"
FT                   /translation="MVVIAMSLRFLLGRSGSGKTTACLEEIRRQLQEDPKGRTIVYLVP
FT                   EQMTFQCEYALIHTEGTEGMIRAQVFSFPRLAWRVLQETGGMNRYHVHDVGVQMMIRKI
FT                   IEQRKQELKLFGRAADKSGFVEQLHEMIAECKRYCLTPDELRRHAGVLESGSGQPGRRL
FT                   LADKLSDVALVYEELERSLLGHYLDSEDYLRLLVEHIPRSSYLHGADIYIDGFHHFSPQ
FT                   EYMVIEQLLHRCRRVTVCLTADRPYDVGMPDELDLFYLPAQTYRQLRELALANDIMIES
FT                   PVVLSVNRRHQDKALAHLEEQFHRRPLLPYEAETDAICLYEAANRRAEIEAVAREIIRL
FT                   VRDEGARYRDIALIIRQTEAYRDLVKTVFFDFDIPYFMDEKEPMHYHPLIELVRAALET
FT                   VVTRWRYEAVFRAVKTDLLFPVDGDLAMWREAADKLENYVLAHGVKGEKWTSDERWTYR
FT                   RYQALDGLNVPQTDEERQFEDKLNEWREALAAPLRRLERRLRRAADGRGLCTALYLFLE
FT                   ELQIPKKLEQMSAQAEADGRLVEARQHEQAWNAVVDLLDQYVEMLGAEPLPLAEFAKII
FT                   EAGLDRLEFALVPPAIDQVIVAQLDRSRLIDVKYAFIIGVNDGVIPAKVKDEGLVAEVE
FT                   REQLRELGVALAPGGREQLFYDPFFVYLALACPSRRLYVTYPLADGEGKALMPSPLIKQ
FT                   LVQLFPRVSVHLCGNDPFDAPEEKPETFVTVPRATQTYLISQLRAWKRNYGIDPLWWDV
FT                   YNVLISHPEWRARVEQAVSGLFYTNQAVLKREWSRRLYGKKIQASVSRMEQFQKCPYAH
FT                   FASHGLRLKERNVFRLEAPDVGQLFHAAIKQIADRVREQHLDWKQLSRSECERLSAEAV
FT                   ERIAPLIQQQVLSSSNRYEYMKRKLKNVVARTTHVLSEHARASGFAPVGFELSFGPGGD
FT                   LPPLRFQLRDGTVMELVGRIDRVDKAESSQGVLLRIIDYKSSAKTLDLTEVYYGLALQM
FT                   FTYLDIVLTYAEQLVGEPALPAGVLYFHIHNPIIQAKQWLDNEMEVARKLLEPFRMRGL
FT                   LLADAETIRLMDSQTENGQWSLIVPAQLTRTGAIHSRSSVASASDFAALRQHVRRLFVD
FT                   IGGQIADGVVSIAPYKLKNKTACEFCAFKPVCQFDEALSGNGYRKLTPQTKDAVIETLG
FT                   KREEES"
FT   gene            652988..656716
FT                   /locus_tag="GTNG_0589"
FT   CDS_pept        652988..656716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0589"
FT                   /product="ATP-dependent nuclease, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65971"
FT                   /db_xref="GOA:A4IKW7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKW7"
FT                   /protein_id="ABO65971.1"
FT                   /translation="MNATFRPKPAGSRWTDEQWKAIAAGGRDILVAAAAGSGKTAVLVE
FT                   RIIQKVTAEEGAVDIDRLLVVTFTNAAAAEMKARIGEALERELANRPHSLHLRRQLSLL
FT                   NRASISTLHSFCLDVIRKYYYLLDLDPSFRIADETEIELLKEDVLEELLEEEYGKADNE
FT                   RFFAVVDAYTGDRSDAELQEMILALYEFSRSHPAPDEWLADLVSMYDVDEQTNVETLPP
FT                   ARYIAQHAAMELAAAKRFIGLALALAEKESGPKPYEKRLREDMDLIADLERRLSGSWDE
FT                   LYHALQSLSFGRLPPCRGDGFDAELIDEAKSLRDQAKKKIEALRDNVFSLHPSAWLRHM
FT                   REMKPVVETIAALVRRFSAMFEAAKREKGIVDFSDLEHYCLRILRQYDPETGEWQPSSA
FT                   ALEYQAQFDEVLVDEYQDTNLVQETILQLVKKGSERTGNLFMVGDVKQSIYRFRLAEPM
FT                   LFLDKYKRFTADGEAGGMKIDLASNFRSRAEVLDGTNFLFAQIMGEAVGEMVYDEAAQL
FT                   KYGADYPEGTDAVPEVMIIDRQRTSEEDEEETAELEAAELESRLMAEKIKEIVSRPFYV
FT                   YDRSSGQQRRAMYRDIVVLVRSMTNAPQMIEQLQAQGIPAAADLSSGYFQATEISVMLS
FT                   LLKVIDNPYQDIPLAAVLRSPLFRFDENELAMIRLSDPKGTFFEALQAFCQKTAETGEE
FT                   ENAKEKAISFLNKLEEWRTMARRRSLADLIWQLYRDTQFYDFVGALPGGKQRQANLRAL
FT                   YDRARQYESTSFRGLFRFLRFIERLQERGDDLGAARPLGDQEDVVRVMTIHSSKGLEFP
FT                   IVFLVGLARPFYTRDLHSPYLLDKELGFAARFVHPRLRISYPTLPLLAIQVKKRLELLA
FT                   EEMRILYVALTRAKEKLYLLASVNDADKEIEKWKGVAAESGWLLPDDVRASARSYLDWI
FT                   GRALIRHRDGRSLVEVNRPDEIASHPSVWRFEIVSAAKLRNAEVSTDREDGGALVALEQ
FT                   GRPVPTQGEWEEEARRRLLWRYRYGKETVVRAKQSVSELKEQQALFGEQADEWLPRKGT
FT                   APLFSRPRFMQEKTLTPAEKGTALHVVMRHLDLHAPMDESSIRSQIIRLVEKELLSAEQ
FT                   AETVDAAAIVAFFATDIGRRLCAAREVYREVPFSLGLPADELYGSEGMESGRRLLVQGV
FT                   VDCVFADERGYVVIDYKTDEVTGRFAGQKEEATRFLLGRYGGQMRLYRRAIEQIWRVPV
FT                   AECYLYSFDGEYFLAVE"
FT   gene            656734..657912
FT                   /gene="sbcD"
FT                   /locus_tag="GTNG_0590"
FT   CDS_pept        656734..657912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="GTNG_0590"
FT                   /product="Exonuclease SbcD-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65972"
FT                   /db_xref="GOA:A4IKW8"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKW8"
FT                   /protein_id="ABO65972.1"
FT                   /translation="MRILHTADWHLGRTLEGRSRLAEQEAFIDELIEIVEKEQIDAILM
FT                   AGDVFDSVNPPAAAEQLFYESLARLSDKGRRPVAVISGNHDHPDRISAARTLLSDYHIF
FT                   LFGRPEASVCRIDVPSCGETMMLAPLAYPSESRLAELLSSDHREAVLRDRYDDRIRALL
FT                   EMMAASFTEKTVNIVMSHLYVAGGRTSDSERPIEVGGAYTVAATSLPKAAQYVALGHLH
FT                   RPQDVKRAETAARYSGSPLAYSFSEAGHAKSVTVVDVHPGGAASVTEIPLAAGKPLVRW
FT                   KATEGLAQVYRWCEEGKDQSCWVDLELHVTEPLTMEEIYRLRKLHPGFVYIRPVFPQRV
FT                   EEEAEVSREALSLEEMFCRFYKRQTGGQTPDEELVRLFLELAAEEEQEGGEE"
FT   gene            657909..661253
FT                   /gene="yirY"
FT                   /locus_tag="GTNG_0591"
FT   CDS_pept        657909..661253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yirY"
FT                   /locus_tag="GTNG_0591"
FT                   /product="YirY"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65973"
FT                   /db_xref="GOA:A4IKW9"
FT                   /db_xref="InterPro:IPR027050"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKW9"
FT                   /protein_id="ABO65973.1"
FT                   /translation="MKPISLTIAGLHSFREKQTIDFTVLCDGGVFGIFGPTGSGKSTIL
FT                   DAITLALFGSVERAANRTQAIINHAEQELFVSFTFELENAAGAKRYTVERSLKKVDEWR
FT                   TRSAVCRLIEHQPEPVVLADKLSDVDKAIGQLLGLTMEDFTRAVVLPQGKFAEFLSLKG
FT                   AERRQMLQRLFHLERYGDQLNKKLKDRLIAAEQEEEKIEAEKAGLGDASKAALEQAETE
FT                   ERELAALLAKRKKELEEVEANVERTKQLWVWQQEKETIERELAELRRHEPDIRALEVKK
FT                   ERAEQAERIWPYWEQYEQARRSQIAALKRYEELARKLETAKASHEEAVRRYEQARLEKA
FT                   RREPELLAQTERLRQAEQLERQMETIKRELAALDEEHNRLAVREKAAQRQFEEASAWYE
FT                   RGMKRQQELKEELQRYTEALARKDEVERAHGEKRQIEQAASAVARVDAQLRQKEEVWRQ
FT                   AEEERIKRERQAAVAGARLHQLFRLVEKTYHSVCERQQDIEKRLYALQQDIEAERERIE
FT                   EARTAELAAVLAERLRPGEPCPVCGSREHPHPSTKPYSTGQGRLPDLEQERRQCEQDLQ
FT                   TLFSLKAQLEQLAGLAAGHGVPPVFTEGRPTEEVSDVFVEVRALQQDIIEQKESVYRAL
FT                   AQWNEAEAARREAENACRWAAADMEALQAERRRLEEERQRLEQHWRQTYPSFSLETIDI
FT                   VYEQLREQEKKWRDVQKRLEDSVPFLEEKQRAKEKAAEEQRRIETERVRLDSLISTKQQ
FT                   LWEEYERQRREKAGPNPAAQQLREAESEWRRLQNDEQQAYDEWQRVQKVYQTLESETKV
FT                   AKQAVEEGARREEEALARWRLVLADTTFADAEEAERAKATKEQCSEWDEAIRRYWRQVE
FT                   QAEHRRAQLSAALGEEAVSAEQWEMLQRVYAELKAEMETMTQQLGAVQGKVAELRKKHA
FT                   RFVELEAKQTQLSRQIERYKQLQTLLRGNSFVEFMAEEQLEQVTAIAAERLQRLTRHRY
FT                   SLELDSQGGFLIRDDANGGVRRPVATLSGGETFLTSLSLALALSAQIQLRGEYPLRFFF
FT                   LDEGFGTLDAELLDMVISALEKLHTQQLAVGVISHVQEIRTRLPRRLIVEPAEPSGRGT
FT                   RVRLETM"
FT   gene            complement(661343..661564)
FT                   /gene="gerPF"
FT                   /locus_tag="GTNG_0592"
FT   CDS_pept        complement(661343..661564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerPF"
FT                   /locus_tag="GTNG_0592"
FT                   /product="Spore germination protein GerPF"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65974"
FT                   /db_xref="InterPro:IPR019618"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKX0"
FT                   /protein_id="ABO65974.1"
FT                   /translation="MPSFVGPIKINSVEGGAVVQMGDCLYIAPKVATKALGGSGGFNTG
FT                   DLIMTNNVISFTNTIDSDVFDQNVTANN"
FT   gene            complement(661564..661953)
FT                   /gene="gerPE"
FT                   /locus_tag="GTNG_0593"
FT   CDS_pept        complement(661564..661953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerPE"
FT                   /locus_tag="GTNG_0593"
FT                   /product="Spore germination protein GerPE"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65975"
FT                   /db_xref="InterPro:IPR024496"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKX1"
FT                   /protein_id="ABO65975.1"
FT                   /translation="MKRTSVVQAFHSETVVISSVLQIGDSERISARTCDLAVQRQHELF
FT                   FGSEGEQTFPVFTKPIPRWSFPSPITSKQTLHQSPVISARSVRVLGISSSSIVHIGSTS
FT                   TVEAESRIKHIRHLDGPAPTRGRDS"
FT   gene            complement(661950..662141)
FT                   /gene="gerpD"
FT                   /locus_tag="GTNG_0594"
FT   CDS_pept        complement(661950..662141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerpD"
FT                   /locus_tag="GTNG_0594"
FT                   /product="Spore germination protein GerPD"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65976"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKX2"
FT                   /protein_id="ABO65976.1"
FT                   /translation="MNYTVINRDVHVSDIHLVAVASASLFLIGDADVINLSSAFDTPPE
FT                   SLIIGPFVPLVQVRGEES"
FT   gene            complement(662144..662740)
FT                   /gene="gerpC"
FT                   /locus_tag="GTNG_0595"
FT   CDS_pept        complement(662144..662740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerpC"
FT                   /locus_tag="GTNG_0595"
FT                   /product="Spore germination protein GerPC"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65977"
FT                   /db_xref="InterPro:IPR019673"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKX3"
FT                   /protein_id="ABO65977.1"
FT                   /translation="MSLYEYFVKLHRYLSWQTKKIRVLERRLRILEAQLQEIEAQPRTS
FT                   IERIEYKFDQLKIETLEGTLNIGITPPGTGETIEDFAVDPEKTVISKPEPVLMRPIQEK
FT                   VASYLNKEAPETLKQLERQYGRSLDDTYRQFILQDIARQTDERIRFYLQEKANNGYVPP
FT                   GDRDETVENEIFQKVKADIEQSLDAFLKHLPSGGG"
FT   gene            complement(662824..663048)
FT                   /gene="gerpB"
FT                   /locus_tag="GTNG_0596"
FT   CDS_pept        complement(662824..663048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerpB"
FT                   /locus_tag="GTNG_0596"
FT                   /product="Spore germination protein GerPB"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65978"
FT                   /db_xref="InterPro:IPR024255"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKX4"
FT                   /protein_id="ABO65978.1"
FT                   /translation="MNFYISQSICIHQLRIGSVTNSSVLQIGSAGSIQALSTLSNTGGF
FT                   TGPAPQATVPLGPQAQPVGPLVPLHSANL"
FT   gene            complement(663064..663285)
FT                   /gene="gerPA"
FT                   /locus_tag="GTNG_0597"
FT   CDS_pept        complement(663064..663285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerPA"
FT                   /locus_tag="GTNG_0597"
FT                   /product="Spore germination protein GerPA"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65979"
FT                   /db_xref="InterPro:IPR019618"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKX5"
FT                   /protein_id="ABO65979.1"
FT                   /translation="MPAFVGIVKLNSVGSSGVFHIGDVFAISPQSVSKTFAGAGSFNTG
FT                   DGLYIYNYYSNTNTNDADVADENVVGNV"
FT   gene            complement(663354..663578)
FT                   /locus_tag="GTNG_0598"
FT   CDS_pept        complement(663354..663578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0598"
FT                   /product="Spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65980"
FT                   /db_xref="InterPro:IPR019618"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKX6"
FT                   /protein_id="ABO65980.1"
FT                   /translation="MPSFISGPIKITHVSGDGTVNFGDVLQIAPKSTGKSHAGAGGSNC
FT                   GDFLQTNTFVSFTNTGDPDFSDSNNTANN"
FT   gene            663725..663949
FT                   /locus_tag="GTNG_0599"
FT   CDS_pept        663725..663949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0599"
FT                   /product="Spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65981"
FT                   /db_xref="InterPro:IPR019618"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKX7"
FT                   /protein_id="ABO65981.1"
FT                   /translation="MPAIVIGGIKVTSVDGNGTVNMGDVLQIAPKSTLKANSGAGGGNT
FT                   AEFLQTNTFCSVTNTIDSDVFDSGVKGNN"
FT   gene            complement(663946..664434)
FT                   /locus_tag="GTNG_0600"
FT   CDS_pept        complement(663946..664434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65982"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKX8"
FT                   /protein_id="ABO65982.1"
FT                   /translation="MHTAFPHFSCDTAITNDRFEHSWMSIKRSFDFNRGNVFFSTNNIL
FT                   FSADDIIMSCRHISCMQPTVASSFFQSPLAAGNHLTDYPSTLQHFLSVIVDDFHFASDH
FT                   RIAGFCFLPLLLFSRHSDGYAQSGTFISPTIYFRKFPITLYSEDRKKRKRRSFSLSTV"
FT   gene            664833..666002
FT                   /locus_tag="GTNG_0601"
FT   CDS_pept        664833..666002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0601"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65983"
FT                   /db_xref="GOA:A4IKX9"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKX9"
FT                   /protein_id="ABO65983.1"
FT                   /translation="MTPLSADRIAAVDVLRGFALFGILLVNMRYFSSPALYVEDVDGNT
FT                   FNRVVAAAIDLLFEASAYPLFAFLFGFGTIVLCHRLHQRGERPFPILLRRFLLLLVIGI
FT                   IHAFGLWFGDILIPYALAGLILLLFMNAPSHWWRMAALTGFFFFHILVILLLFMSMLAG
FT                   GTETAEGQAAEAAAALHHYQSGTFREVFWQRWHDWSYLNGDGGLLFTLLAVLPFCFLGG
FT                   YAAKEHWLEAGRYPTAALRRLMSGALCLGLALKTIPYWAGANTLTMYIQDNFGGAVLAV
FT                   FYAIAAMLVCRKTNWQPVWRWLQDAGRMSLTHYLTQSLICTSLFYSYGLGWYGQLNEWQ
FT                   GALLAIGIYVASLWASHCWFTRFRFGPAEWLWRWGTYGMRPPFRRQPGQ"
FT   gene            complement(666015..666185)
FT                   /locus_tag="GTNG_0602"
FT   CDS_pept        complement(666015..666185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0602"
FT                   /product="Stage 0 sporulation regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65984"
FT                   /db_xref="GOA:A4IKY0"
FT                   /db_xref="InterPro:IPR018540"
FT                   /db_xref="InterPro:IPR037208"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKY0"
FT                   /protein_id="ABO65984.1"
FT                   /translation="MVLLLIEEKRQQMIELALTYGFTAKETIQCSQELDRLINQYLQQT
FT                   TVFEPPVPSVQ"
FT   gene            666507..667415
FT                   /locus_tag="GTNG_0603"
FT   CDS_pept        666507..667415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0603"
FT                   /product="Fumarylacetoacetate hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65985"
FT                   /db_xref="GOA:A4IKY1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKY1"
FT                   /protein_id="ABO65985.1"
FT                   /translation="MKLITAIFNGGEPAIGVVPEGEETAIHLRRAERAMDGKETIPSSM
FT                   LEAIAQGDAFLARAREVADWALRYSGANYVYRLGDIRLLAPIPRPAKNVFCIGKNYVDH
FT                   ALELGDAADVPKHLIVFSKTPTTVIGHEETILRHADVTDEVDYEGELALIIGKKGQAIR
FT                   REEALDYVFGYTIINDVTARDLQERHQQYLLGKSLDTFCPMGPWIVPSKFVTNPNDLRI
FT                   ETRVNGEVRQQASTKQFIFPIESIIETISKGMTLEPGDIIATGTPAGVGKGMNPPRFLQ
FT                   AGDVVEVTIEGIGTLRNKVGE"
FT   gene            667556..667909
FT                   /locus_tag="GTNG_0604"
FT   CDS_pept        667556..667909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0604"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65986"
FT                   /db_xref="GOA:A4IKY2"
FT                   /db_xref="InterPro:IPR010899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IKY2"
FT                   /protein_id="ABO65986.1"
FT                   /translation="MTHAHITSWFIMIILFLIAVSMQRSGAAKANIIKMVLRLFYIITI
FT                   ITGLLLLHSIASISGLYWLKALAGLWVIGAMEMVLVAGKKGKSMAAGWTQWVIALVVTL
FT                   FLGLLLPLGFDLF"
FT   gene            668032..670872
FT                   /locus_tag="GTNG_0605"
FT   CDS_pept        668032..670872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0605"
FT                   /product="Sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65987"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKY3"
FT                   /protein_id="ABO65987.1"
FT                   /translation="MRSLRCRHAEELYRLVEDDFSALPGSLFIQVAADDEEQVRHTVEL
FT                   AARRWPSAHLVGVAGSLPIIGETTFLASVMSMAQSSVSSLALSAVDSAHPTELAAQIAE
FT                   AVIHEETALLLLFTDCRAALLPLLRHLPLANERMTIVGCTLPDGCALFSRDGRLDKGVV
FT                   AVSFSGASLRVRCFSPFLWEPVGLAFLVTKSSDQQIGELDGQKASLYLERYLGKEFIDR
FT                   LPFSGMEFPFVVERNGYYDCLPIIGMGENGTITVNGHVSEGEKVRFAYMHAPSFYSSMH
FT                   DLTIQTAKQPVGDMIFYYSTALEGYTRPMLEGMVSAFGKATSFPAMEVMVKDAYTTGRL
FT                   GAFAAVSLMEGAVSTQDRPTLDIPQPPEGITTLAQLMSTSSRDMERLHARLQMSEQRYK
FT                   SLFEHNTDIVYSTDLHGHFTSVNPAFERVLGYRKEEILYTNSLKYVHSSDIPRVTRYFY
FT                   RALRGNVQTYDLEIPTKSGERLLFQMKNIPIIVDGKKVGIYGIGHNITEQKKAEEKISY
FT                   LAYYDPDTNLPNRTKWMELFSKQLKRAKQKQQKVVIALIDLDRFKWINDSVGHYAGDDI
FT                   LRQLVERMKRVLPAGAQLGRFHGDKFCLLFPLKTSAGAATETALQLVREVSKPTVYSQK
FT                   EFFITASIGLAVFPDDGADEHTLLRHADMAMNSAKKSGGNRVERYCAQMNEEAVHRLEM
FT                   DSYLRKAVEKNELFLCYQPIVNVRTGAVIATEALIRWRNPQLGLVRPDEFIPLAEETGW
FT                   IHEIGRWVLQTACQQTKRWQEMTGNDKLAIFVNVSAVQFQHERFVDDVKRALKQSNLSP
FT                   SCLHLELTEHSMLRHLSSTMRTLDELRRLGVGIAVDDFGSGYSSFHYLKQLPATILKID
FT                   RAFIEHLHANASDAAIVSAMITMGRGLGLETVAEGVETLEQLERLRDLQCSYAQGYALC
FT                   PPLMAEEVTPYVAGQQ"
FT   gene            complement(671003..671560)
FT                   /locus_tag="GTNG_0606"
FT   CDS_pept        complement(671003..671560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0606"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65988"
FT                   /db_xref="InterPro:IPR024488"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKY4"
FT                   /protein_id="ABO65988.1"
FT                   /translation="MKKLDIEERLQCIAEQPRAYVQGTVEFVNDEWIFFDEEAEEASLV
FT                   EEMAEQGIELFRYGHWLSGQWQETGMIATDLGIFPLTNGDRIRFRKRLTYAYRQWLASL
FT                   PDPSFFQFVQWLNSLGFSLYDCLYCYNGLLFAKSTGVNFIIYDNTEQIGSVHHYYERGQ
FT                   ASSDRFEITLNNGERAICTQIG"
FT   gene            671821..673668
FT                   /locus_tag="GTNG_0607"
FT   CDS_pept        671821..673668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0607"
FT                   /product="Asparagine synthetase, glutamine-hydrolyzing"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65989"
FT                   /db_xref="GOA:A4IKY5"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKY5"
FT                   /protein_id="ABO65989.1"
FT                   /translation="MCGITGWVHFGRDLRRKQEVITRMTETLAKRGPDDTNTWLDTHAA
FT                   FGHKRLVVIDPAGGKQPMIRNKNGHRYTIVYNGELYNTEDIRKELLHKGYRFDGHSDTE
FT                   VLLAAYIEWKEQCVDRLNGIFAFAVWDEERELLFMARDRLGVKPLFYRQQAEELLFGSE
FT                   VKAILAHPDVKAEVSYEGLAEVFGLGPSRTPGHGVFYGVQELRPAHALTFSRTGLRVWR
FT                   YWNVESDVHRDSLGETIEKLRFLLTDAVTRQLVSDVPVCTFLSGGVDSSAITAIAANAF
FT                   AANGKGPLHTYSIDYEGNDQYFQANDFQPNTDAPFIEQVSNKFQTIHHRCVITQEELFQ
FT                   HLRDAVIVRDVPGMADVDSSLLWFCKQIREQFVVSLSGECADEIFGGYPWFHRPDDLAR
FT                   KGFPWMRSIEARIGLLKEEWRKKLRLDDYVQMRYEETLVEVPRLEGESAEAAKRRELFY
FT                   LNMIWFMTTLLDRKDRMSMGASLEVRVPFADHRLVEYVWNIPWEMKMYGGREKGILRKA
FT                   LEGLLPQDVLYRKKSPYPKTHHPLYTKLVKQWLKQLLRDRSSILHEFFDQEKLTALVES
FT                   GGKSFQVPWFGQLMTGPQLLAYLGQVHVWFDHYGIHIKE"
FT   gene            complement(673721..675073)
FT                   /locus_tag="GTNG_0608"
FT   CDS_pept        complement(673721..675073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0608"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65990"
FT                   /db_xref="GOA:A4IKY6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKY6"
FT                   /protein_id="ABO65990.1"
FT                   /translation="MRREAKTWSLFSLTWPIFIETMLYMVMGNADTLMLSQYSDHAVAA
FT                   VGVANQIIALTIVLFNFVALATAVLVAQYLGAKREQEAIEVSLVSIAANLLFGLLLSAG
FT                   LAAFSSSILRMMDLPAELLDEGNRYLTIVGGFSFIQALMMTVGAILKSYGFTRDTMYVT
FT                   IGMNVLNIIGNYFLIFGSFGLPPLGAEGAAISTAVSRLIGFAVLVALLSKRAGISLAPR
FT                   AFRTLPFRHLRSLLKIGVPAAGEHLSYNTAQMVITYFITWLGAEALTVRVYTQNIIMFV
FT                   FLFGIAVSQGTQILVGHFVGAGRYKEAYDRCLKSLYSAIAISVLMAAVTYWFAEPLLSL
FT                   FTDDRSMIDLGRKLLLLTIILEPGRSFNLVIVSSLRAAGDVQFPVYMGILSMWGVGVTV
FT                   AYVFGIALEFGLVGIWLSFIADEWLRGLLMLWRWRSRIWMKKAVAPQAKMA"
FT   gene            675200..676060
FT                   /locus_tag="GTNG_0609"
FT   CDS_pept        675200..676060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0609"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65991"
FT                   /db_xref="GOA:A4IKY7"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKY7"
FT                   /protein_id="ABO65991.1"
FT                   /translation="MDYVTFSLPPLPVFIKGAESVFPEGKRHFRRTFSVFDLLYVKQGC
FT                   LYMTEDGREFAVGSGQYLLLIPGREHYGHRPCSERTEYVWLHFLLTDYEVVADHPVSRQ
FT                   TVMEKEATYTEPIQYRLAIRQYGELKQRERAEQLLNQIVEPNVDRDIERPLRQLLLFVE
FT                   FLWHLQKQELSVPNASEQVSAAAVAYIENHFCEPVTLERVARELRFHPDYVTRCMQRTL
FT                   GMGFSHYLAYYRLSKAKQWLAETNETVEAIAKRVGIDDSAYFSRLFKKMEGMTPTEYRR
FT                   IAQRV"
FT   gene            complement(676127..677893)
FT                   /locus_tag="GTNG_0610"
FT   CDS_pept        complement(676127..677893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0610"
FT                   /product="Neopullulanase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65992"
FT                   /db_xref="GOA:A4IKY8"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKY8"
FT                   /protein_id="ABO65992.1"
FT                   /translation="MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPY
FT                   DWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLYSGEEKLVYTEKGFYF
FT                   EVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPSISPEGSRPWGSE
FT                   DPTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNHKYDTADYFEVDPHFGDK
FT                   ETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGESSKYKDWFHIHEFPLQTE
FT                   PRPNYDTFAFVPQMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWRE
FT                   FRQEVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFAN
FT                   QMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYG
FT                   DEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRSLRRGEISFLHADDEM
FT                   NYLIYKKTDGDETVLVIINRSDQKADIPIPLDARGKWLVNLLTGERFAAEAETLCTSLP
FT                   PYGFVLYAIEHW"
FT   gene            678140..679414
FT                   /locus_tag="GTNG_0611"
FT   CDS_pept        678140..679414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0611"
FT                   /product="Maltose:maltodextrin transport
FT                   systemmaltose:maltodextrin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65993"
FT                   /db_xref="GOA:A4IKY9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKY9"
FT                   /protein_id="ABO65993.1"
FT                   /translation="MRKAFSLVLMAVMLIGMLAACGPKRDVEQSKQANQGTTENAQKPE
FT                   KLVVWVNDDEKQKQALKDIFQKYTEKTGIKIEMVAVSMLDQTKKLALDGPAGKGPDVFY
FT                   QPHDRIGDIVLQGLADPIDLGDAKGEYSPTAIEAVTYDGQTYGVPTVVETYGVFYNKNL
FT                   VSEAPKTIDDLMKIAKEKTNAAKDQYGFLMEAENFYFVYPFFAGYGGYVFKNENGKYDT
FT                   SDIGLANEGAVKGAELVQSWFQNGYIPKEVTNDVMNGLFTKGNVAVAITGPWNIASYKE
FT                   ALGDKLATAPLPVLENGEHPKSFVGVKTWMLSAYSQHKEWAVDFMKFVTNEENSLHYYE
FT                   VAGEMPANEKALTNEKITNDPLIAGFAEQIQYGEPMPNVPEMSQVWDPMGNAVQFIAKG
FT                   DDPKAVLNEAVKTIQDKIAASGAGK"
FT   gene            679484..680764
FT                   /locus_tag="GTNG_0612"
FT   CDS_pept        679484..680764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0612"
FT                   /product="Maltose/maltodextrin transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65994"
FT                   /db_xref="GOA:A4IKZ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKZ0"
FT                   /protein_id="ABO65994.1"
FT                   /translation="MSEASARHRPAVAMVLSLLFAGLGQLYNRRYIKGIVFIVIEAAFL
FT                   ITFYNFLNIGLWGLVTLGEIPMLDHSIFLLIQGLVSVIIIAFAVALHIANIIDARNDAR
FT                   RRQRGEPAPSLIESCRNAWDRGFPYIFVTPGLVMLLFIVVLPLLFMVSLAFTDYNLYHS
FT                   PPRHLLNWVGFENFKNLVSIPIWKSTFFSVLSWTIVWTVVATTMQIALGLFLALLVNDP
FT                   RIKFKRFIRTVLILPWAVPAFVTILVFAAMFNDKFGAINREVLSLFGLSIPWMTDPFWT
FT                   KVALILIQTWLGFPFVFALFTGVLQSISRDWYEAADIDGATRWQKFKSITLPHVLYATA
FT                   PLLIMQYAGNFNNFNIIYLFNDGGPAVRGQNAGGTDILISWVYDLTFTTNNYNMAAAIS
FT                   LIIGLIVSGFAIYQFRRTRSFKEEGNI"
FT   gene            680764..681606
FT                   /locus_tag="GTNG_0613"
FT   CDS_pept        680764..681606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0613"
FT                   /product="Maltose/maltodextrin transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65995"
FT                   /db_xref="GOA:A4IKZ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKZ1"
FT                   /protein_id="ABO65995.1"
FT                   /translation="MNRKWKSHIEVALIYLFIAFMFVVIAYPLLWTISMSLNPGTSLYS
FT                   ASIIPEKWTLEHYKWLFTSPDSNYLLWYKNSLFVAAANAALSVLFTALIAYAFSRYKFI
FT                   GRKTGLYLFLVLQMFPSLMAMVALYILLNMLHLLDSLWGLILIYVGGQIPFNAWLVKGY
FT                   FDTIPRELDEAARIDGAGHFGVFFRIMLPLAKPILAVVALFNFMAPFTDFLLPSIVLRD
FT                   PEKFTLAVGLFNFISDRFANNFTRFAAGSILIAAPIAIVFLFLQRYLISGLTAGGTKG"
FT   gene            681680..683215
FT                   /locus_tag="GTNG_0614"
FT   CDS_pept        681680..683215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0614"
FT                   /product="Alpha-amylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65996"
FT                   /db_xref="GOA:A4IKZ2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013777"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKZ2"
FT                   /protein_id="ABO65996.1"
FT                   /translation="MGNRLFMLFILPFLLFYAMPVAAAEKEERTWQDEAIYFIMVDRFN
FT                   NMDSTNDQDVNVNDPKGYFGGDLKGVTAKLDYIKEMGFTAIWLTPIFKNRPGGYHGYWI
FT                   EDFYEVDPHFGTLDDLKTLVKEAHKRDMKVILDFVANHVGYDHPWLHDPAKKDWFHPKK
FT                   EIFDWNSQEQVENGWVYGLPDLAQENPEVKNYLIDAAKWWIKETDIDGYRLDMVRHVPK
FT                   SFWQEFAKEVKAVKKDFFLLGEVWSDDPRYIADYGKYGIDGFVDYPLYGAVKQSLAKRD
FT                   ASLRPLYDVWEYNKTFYDRPYLLGSFLDNHDNVRFTKLVIDHRNNPISRMKVAMTYLFT
FT                   APGIPIMYYGTEIAMTGGPDPDNRRLMDFRADPEIIDYLKKVGPLRQQLPSLRRGDFTL
FT                   LYEQDGMAVFKRQYKDETTVIAINNTSETKHVHLTNEQLPKNKELRGFLLDDLVRGDED
FT                   GYDIVLDRETAEVYKLRNKTGVNVPFIVAMVAVYALFILFLYMVKKRTKRTNE"
FT   gene            683232..684251
FT                   /locus_tag="GTNG_0615"
FT   CDS_pept        683232..684251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0615"
FT                   /product="Maltose operon transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65997"
FT                   /db_xref="GOA:A4IKZ3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKZ3"
FT                   /protein_id="ABO65997.1"
FT                   /translation="MTVTIKDVAKRANVAPSTVSRVIADSPRISEKTKQRVREAMKELG
FT                   YHPNFIARSLASQATQVIGIVMPSSADQALQNPFFPEVIRGISKAAHEKRYALQMSTGE
FT                   KESDIYERVIEMLQGRRVDGVILLYSRQNDKLMKYLQKHGFPFVVIGKPHQKAEQVTHV
FT                   DNDNVQAGKDATNYLIDHGHERIAFVGGNPQYFVTADRQEGYEEALREAGLLYRPEYVV
FT                   HEEFLQEGGREAMKELLSLAEPPTGLVVADDLMALGMVKTLDEIGLRVPEDVSIVSFNN
FT                   TLLAEMSRPPLTSVDIGIFQLGYEAAKSLIEKVENPNEPIKRIIIPHRLVERGSCTRR"
FT   gene            684367..686292
FT                   /locus_tag="GTNG_0616"
FT   CDS_pept        684367..686292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0616"
FT                   /product="Putative regulator of acetoin metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65998"
FT                   /db_xref="GOA:A4IKZ4"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKZ4"
FT                   /protein_id="ABO65998.1"
FT                   /translation="MNRERVKYMWEKFVFHNELAPDLPPMIRDSWLRSKKAMVDPFRPY
FT                   GWIKEIDNEKYCSLIDWSLPLMEGLYSIVKGSGFLVILCNESGQLLLSIGDSEPLARAE
FT                   EIGFIAGADWSEQVMGTNAIGTSIAIDRPVQIFAEEHYTKICQSWTCSAAPIHDPDGRI
FT                   IGVLNMSGPYEKVHPHTLGMVVSAVKAIEYQLKLHENTEKNVMMQRFLEATTNNMKEGI
FT                   LIIDCVGKIVKANNQLKKLFRLPQLQLEEKTIDDIFSDSSICSNHPLHLQNQELHLSVK
FT                   PSNAVHHVLVDKIPIYEKKERIGSMIIVKEIEKVRQFVNHLSGNQAKITFADIIGQHPC
FT                   FIQKMNEARLAAATDSNVLILGESGTGKEMVAQAIHNESKRRNKPFIAINCGGIPRDLL
FT                   GSELFGYVDGAFTGAKKGGSAGKFELANGGTLFLDEIGEMSLEMQVLLLRVIQEKEVMR
FT                   IGGHKVTPVDVRIIAATNKDLRREVQKGSFREDLFFRLNVMPIVLPPLRERKEDIPLLV
FT                   RYFIDKLAHKRNKPFPEIRSDFLEVLMQYDWPGNIRELQNIIERVLNHSTKPILTAADL
FT                   PEEIFHPPCSFQVRESIDISRNGIKKQAIIEALKRCNGNISKAARYLGISRSTFYRQMD
FT                   KWNIRY"
FT   gene            686492..687478
FT                   /locus_tag="GTNG_0617"
FT   CDS_pept        686492..687478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0617"
FT                   /product="Thiamine pyrophosphate-dependent dehydrogenases,
FT                   E1component alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABO65999"
FT                   /db_xref="GOA:A4IKZ5"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKZ5"
FT                   /protein_id="ABO65999.1"
FT                   /translation="MTIFKDHLLWMYEMMYKIRYYEDKMAEAYAEGKSPVFNIGAGPVP
FT                   GEMHLATGQEPAAVGICVHLKKEDTVTAPHRPHHHAIAKGVDLNRMTAEIFGKVTGLGK
FT                   GKGGHMHLFDPDVKFSCGGIVGAGIPHALGAALAAKKKGKDWVAVAFIGEGAANQGSFH
FT                   ESLNMAALWKLPLIVVVENNEYGISVPKTASTAVSSNDVRAAAYGIQGYYVKDNDPIEM
FT                   YNVSKEAVKRARNGEGPSIIEIETYRYLGHFQGDPELYRDKNEVTLLREKDPIIRLRNR
FT                   LLNEYGVTEETIAQLEGKARSEVDQAYAFARESDYPKPEAALEDVFV"
FT   gene            687507..688526
FT                   /locus_tag="GTNG_0618"
FT   CDS_pept        687507..688526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0618"
FT                   /product="Thiamine pyrophosphate-dependent dehydrogenases,
FT                   E1component beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66000"
FT                   /db_xref="GOA:A4IKZ6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKZ6"
FT                   /protein_id="ABO66000.1"
FT                   /translation="MQQTKQRLLTGNKALAEAIRLEMERDPNVFVMGEDVGVYGGIFGA
FT                   TEGLFQKFGPERVIDTPISETAFIGAAIGAAAEGIRPIVELMFVDFFGVCMDQIYNHMA
FT                   KIPYMSGGRVKLPMVLMTAVGGGYSDAAQHSQTLYATFAHLPGMKVVAPATPYDLKGMM
FT                   ISAIRDDNPVVFMFHKTLQGLGWMDQLDASIGHVPEEAYTVPLGKANVVREGTDITIVG
FT                   IQMTVHHALEAAKRLEQQGVQAEVIDLRSLVPLDKETIIQSVKKTHRLLVVDEDYLSYG
FT                   MTAEIAAIAAEHCLYDLEAPVKRLAVPDVPIPYSRPLEQFVLPNADKIFHEAIKLINE"
FT   gene            688556..689866
FT                   /locus_tag="GTNG_0619"
FT   CDS_pept        688556..689866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0619"
FT                   /product="Pyruvate dehydrogenase E2
FT                   (dihydrolipoamideacetyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66001"
FT                   /db_xref="GOA:A4IKZ7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKZ7"
FT                   /protein_id="ABO66001.1"
FT                   /translation="MFVEVTLPKLSDSHDESLITFWHVSEGDAVEKGATLVEVQTEKAV
FT                   SEIHAPESGTVKEIKKKRGDTAKVGEVLAVLAVEAFAPDSGGPQIEIKITPRVKKLAKE
FT                   LGVDWRAITPTGANGKITEDDIRRSVSTRRQEVSQKKIVAAPSVRKFAREQNVPLEEVT
FT                   PSGKNGRILKSDIEAVLSVQQRKATDEAAASVEIVKKQESQEKVRRVPLTGIRKAITQA
FT                   MVRSTRTIPQVTHFSEANATRLVQHRQRIKPLAEQQGMKLTYLVYVIKALAAVLKKYPM
FT                   LNASLDEEQEEIVIHESIHIGFAVDTDRGLLVPVIRDADQKSLFQIAKEIEELSAKART
FT                   GAIQAAEMSGGTCTVSNIGSANGSWFTPIIHYPQSCILGIGKIDKKPIVINDSIEISFV
FT                   MPLSLTYDHRLIDGVMAQHALNECQTYLSEPDWLFVM"
FT   gene            complement(690039..690902)
FT                   /locus_tag="GTNG_0620"
FT   CDS_pept        complement(690039..690902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0620"
FT                   /product="Oxidoreductase (short-chain hydrogenase:reductase
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66002"
FT                   /db_xref="GOA:A4IKZ8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKZ8"
FT                   /protein_id="ABO66002.1"
FT                   /translation="MVTKQQTTLPPQHQTRQPGLQSEMNPQPVTIKDTYRGSGRLENKV
FT                   AIISGGDSGIGRAVAVHFAKEGADVAIVYLNEHKDAEETKRLVEQEGRRCLAIAGDIGD
FT                   EAFCKEAVKQTVETFGKLDIVVNNAAEQHPQPNLLNITAAQLEKTFRTNVFGYFFLTKA
FT                   ALPHLKNGSTIINTASVTAYEGNEQLIDYSATKGAIVAFTRSLAKALVGQGIRVNGVAP
FT                   GPIWTPLIPSTFKSEQVATFGANTPMKRPGQPSEVAPCYVFLASDESSYMIGQILHVDG
FT                   GKFVSG"
FT   gene            complement(691246..694656)
FT                   /gene="metH"
FT                   /locus_tag="GTNG_0621"
FT   CDS_pept        complement(691246..694656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="GTNG_0621"
FT                   /product="5-methyltetrahydrofolate S-homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66003"
FT                   /db_xref="GOA:A4IKZ9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A4IKZ9"
FT                   /protein_id="ABO66003.1"
FT                   /translation="MANITLEQQLQRKILVIDGAMGTMIQSANLSASDFGGEAYEGCNE
FT                   YLTLTAPHVIRHIHEAYLEAGADIIETNTFGATRIVLDEYGLGHLALELNIEAAKLAKQ
FT                   AAELFSTPDWPRFVAGSMGPTTKTLSVTGGATFDELVTAYEEQARGLLLGGVDLLLLET
FT                   CQDTLNVKAGFIGISKAFEAVGRRVPLMISGTIEPMGTTLAGQAIDSFFISIRHMNPIA
FT                   VGLNCATGPEFMTDHLRTLSTLADTAVSCYPNAGLPDEEGHYHETPDMLAEKIRRFAEK
FT                   GWINIVGGCCGTTPDHIRAIAEAVRDLPPRVIPSSFDIHAVSGIEALMYDETMRPLFVG
FT                   ERTNVIGSRKFKRLIAEGKYEEAAEIARAQVKNGAHVIDICLADPDRDERYDMEQFVRH
FT                   VIKKVKVPLVIDSTDERVIECALTYSQGKAIINSINLEDGEERFAKIAPLLHQYGAAVV
FT                   VGTIDEQGMAITAERKLEIALRSYDLLVNRYGVPAQDIIFDPLVFPVGTGDEQYIGAAK
FT                   ETIEGIRLIKERLPDCLTMLGISNVSFGLPPAGREVLNSVFLYHCTQAGLDYAIVNTEK
FT                   LERFASIPENEVRMAEALLFDTSDETLNAFIEFYRSKITTAKPVETNLSLEERLARYVI
FT                   EGSKDGLIPDLEQALETYSDPLSIINGPLMAGMDEVGRLFNNNQLIVAEVLQSAEVMKA
FT                   AVAFLEPYMEKKEGSTKGKVLLATVKGDVHDIGKNLVDIILSNNGYEVVDLGIKVAPQQ
FT                   LIEAARQHEPDIIGLSGLLVKSAQQMVVTAQDLRQAGISTPILVGGAALTRKFTENKIA
FT                   PEYDGIVLYAKDAMDGLALANQIQQGTIDYMKKERVENEPARAVGAATAVKSNVSTDVP
FT                   VYIPADLDRHVLRDVPLGHVLPYVNWQMVLGHHLGLKGKVKRLLEEKDEKALALKAVVD
FT                   ELLAEVQERGWIQPAGVYRFFPAQSDGNRVYIYDPVDRQTVLETFDFPRQPRAPFLCLA
FT                   DYLKSKESGEIDYVGFFAVTAGGGIRELAQRWKDEGEFLKSHAIQALALEIAEGFAERI
FT                   HQIMRDRWGFPDDPDFTMEERFAAKYQGQRYSFGYPACPNLEDQEKLFRLLHPEDIGIR
FT                   LTDGYMMEPEASVSAIVFAHPEARYFNVL"
FT   gene            complement(694649..696499)
FT                   /locus_tag="GTNG_0622"
FT   CDS_pept        complement(694649..696499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0622"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66004"
FT                   /db_xref="GOA:A4IL00"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL00"
FT                   /protein_id="ABO66004.1"
FT                   /translation="MGLLDELKQRVLIADGAMGTLLYSHGIDRCFEELNLSKPEEIVHI
FT                   HEAYIAAGADVIQTNTYGANYVKLARYGLEDEVPSINRAAVRLAKQAANGRTHVLGTIG
FT                   GLRTLNKSAVPLEEVKRTFREQLFVLLAEGVDGVLLETYYDLEELETVLTIARKETTLP
FT                   IIAHVSLHEVGVLQDGTPLADALARLEALGADVVGLNCRLGPYHMLQSLEEVPLPTRAF
FT                   LSAYPNASLPDYRDGRLVYETNAEYFEETAKAFRDQGVRLIGGCCGTTPKHIEAMARAL
FT                   QDRKPVTKKTVKRRAVSVSVQADNPSAVTPLSELARTRRSVIVELDPPKQLGIDKFLVG
FT                   AKALHDAGIDALTLADNSLATPRISNVAVGSIVKEQLGVRPLIHITCRDRNLIGLQSHL
FT                   MGLHTLGITDVLAITGDPSKIGDFPGATSVYDLSSFDLIRLISQFNEGLSYSGKPLGQK
FT                   TNFSIGAAFNPNVRHLDKAVERMEKKIQCGAHYFLTQPVYSEEKIVEVYEATKHLHTPI
FT                   YIGIMPLVSARNADFLHHEVPGITLSDEIRARMAACGNDPVQATREGIAIAKALIDAAF
FT                   DLFNGIYLITPFLRYDMTVELIRYIHEKEAAAKERKVVHG"
FT   gene            697260..698384
FT                   /locus_tag="GTNG_0623"
FT   CDS_pept        697260..698384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0623"
FT                   /product="Spermidine/putrescine ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66005"
FT                   /db_xref="GOA:A4IL01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL01"
FT                   /protein_id="ABO66005.1"
FT                   /translation="MMEMERVGGAKVSRQEIIRFDHVTKEYDGTAVLDDVSFEMERGKF
FT                   YTLLGPSGCGKTTILRLIAGFIEPTDGTVYFHGKPMNDVPPNKRQVNTVFQDYALFPHL
FT                   DVFENVAFGLRIKKMKEADIRQKVSEALRFVNLEGYERRRIQEMSGGQRQRVAIARAIV
FT                   NEPEVLLLDEPLSALDLKLRTEMQYELRELQRRLGITFVFVTHDQEEALAMSDYIFVLN
FT                   KGKIQQFGTPKEIYDEPVNRFVADFIGESNILSGRMIEDFLVEFAGQRFVCVDHGFAPN
FT                   EPVDVVIRPEDLELVAPKDGQIVIRVDSLLFRGVHYEICGYDENGNEWLVHSTRRAEVG
FT                   ETVGLRFEPEAIHVMRVEREKGDVEWNGHGGTGI"
FT   gene            698354..699160
FT                   /locus_tag="GTNG_0624"
FT   CDS_pept        698354..699160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0624"
FT                   /product="Spermidine/putrescine ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66006"
FT                   /db_xref="GOA:A4IL02"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL02"
FT                   /protein_id="ABO66006.1"
FT                   /translation="MERAWRNWYLIPYVVWLVLFVIAPIVFLVYESFLDIDGQWTIANY
FT                   EKVLTPIYLKMMAYSFWYAFLITLVSLLIGYPTAYWLTKTKHKQLWLLLLILPMWVNLL
FT                   LKVYAFLGLFGTYGLANAFLQAIGIGARQLLFTDFSFVFVSVYIFIPFMVLPIFNALEE
FT                   LPPTLIDAARDLGASAWTTFRRVVFPLTLGGVKAGCQAVFIPALSLFMITRLVAGNRVI
FT                   TLGTAIEQHFLVTQDWGMGATIAVVLMIAMAIIVFLTGSGRKEGSR"
FT   gene            699157..699960
FT                   /locus_tag="GTNG_0625"
FT   CDS_pept        699157..699960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0625"
FT                   /product="Spermidine/putrescine ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66007"
FT                   /db_xref="GOA:A4IL03"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL03"
FT                   /protein_id="ABO66007.1"
FT                   /translation="MKRTHRWGRLYLLVVFAIMYTPIGYLMYYSFNSGGTMHDFQSFTL
FT                   EWYREVLSDDRLLIIVLNTIVVALLSAAVATILGVIGALAIYYVKRQRTKHTLLALNNV
FT                   LIVSPDVIIGASFLLLFTLAGIKLGFTSVLLSHIAFSVPIVVLMVLPKLEEMSPTLIDA
FT                   ARDLGAGPWQVLSGVVLPFLTPSIWAGFFMALTYSLDDFAVTFFVTGNGFSTLSVEIYS
FT                   RARQGISLSINALSTLLFLFTMLLVVGYYVLSQKGGRMYGIGGRK"
FT   gene            699961..701034
FT                   /locus_tag="GTNG_0626"
FT   CDS_pept        699961..701034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0626"
FT                   /product="Spermidine/putrescine ABC transporter
FT                   spermidine/putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66008"
FT                   /db_xref="GOA:A4IL04"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL04"
FT                   /protein_id="ABO66008.1"
FT                   /translation="MKRLVQGFAAIFIAAFALMFMTQQLNEAEGYGGDKTVSVYNWGDY
FT                   IDPALIRKFEKETGWKVIYETFDSNEAMMAKIAQGGATFDVAVPSDYAISKMIEENLLL
FT                   PLDHNKLPNLKYIEPRFLDLSFDPHNRYSVPYFWGTVGIVYNREMLGGKTITDWNDLWD
FT                   PSLRNQILLVDGAREVMGMALNSLGYSLNDTNKHHLREAKQKLDRLMPNVKAIVGDEIK
FT                   LLLVNEEAAIGVVWSGDAAEIIAENDKLDYVVPEEGSNLWFDNMVIPKTAKNIEGAHAF
FT                   INFMLDPKHAAQNAEYVGYSTPNKAALRYLPKDVANDQRFYPDLDSVGRLEVYENLGKR
FT                   MLAYYNELFLEFKMHQK"
FT   gene            complement(701102..701350)
FT                   /locus_tag="GTNG_0627"
FT   CDS_pept        complement(701102..701350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0627"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66009"
FT                   /db_xref="InterPro:IPR011466"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL05"
FT                   /protein_id="ABO66009.1"
FT                   /translation="MYGKIEAYWEKGWSAFFQTLNELQATDLLRTVTIRVKPHSVIEAI
FT                   ERQMYYYSYHIGQIVYIAKQLNADHWKTLTIPRKRKH"
FT   gene            701525..702695
FT                   /pseudo
FT                   /locus_tag="GTNG_0628"
FT                   /note="nonfunctional Transposase due to frameshift"
FT   gene            complement(703684..704175)
FT                   /locus_tag="GTNG_0630"
FT   CDS_pept        complement(703684..704175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0630"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66010"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IL06"
FT                   /protein_id="ABO66010.1"
FT                   /translation="MAKESSFDIVSKVDLAEVTNAINIAMKEIKTRYDFKGSKSDISLE
FT                   KDELVLISDDEFKLEQLKDVLIGKLIKRGVATKNIQYGKIEPASGGTVRQRAKLVQGID
FT                   KDNAKKINTIIKSTGLKVKSQVQDDQIRVSGKSKDDLQKVIAAIREADLPIDVQFVNYR
FT                   "
FT   gene            complement(704455..705624)
FT                   /locus_tag="GTNG_0631"
FT   CDS_pept        complement(704455..705624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0631"
FT                   /product="Transposase (04)"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66011"
FT                   /db_xref="GOA:A4IL07"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL07"
FT                   /protein_id="ABO66011.1"
FT                   /translation="MSKRSIPNVDWANQLENAIRQFVKEKLELIMREEIKNFLEIEQAG
FT                   TPNMRNGYYQRNLDTQYGRIEGLLVPRDRNGEFQTQLFAPYQRHTGWLEEAIIRMYQSG
FT                   MSTREIGKFIERILGSTYSPATISRITDVVKEDIEKWHARPLHQRYSVLYLDGLYVKLR
FT                   RDTVEKEVIYVVLGVNEEGYREILDFFVGGQESAYVWQEILQQLYKRGVKEVLLGVFDG
FT                   LPGLEEAFKAVYPKADVQRCVVHKVRNTLSRVRKKDQFEMAEDLKLIYRSPNKEIALEM
FT                   FQQFQSKWSHKYPRAVQSWANELDVLLTFMDYPSSIRSVIYTTNAIERTIKEIRKRLKP
FT                   MNSLSSLEAAEKVVYLTIQDFNEKWAGRKLRGFAEAHEALQRMFEERYC"
FT   gene            complement(706580..707443)
FT                   /locus_tag="GTNG_0632"
FT   CDS_pept        complement(706580..707443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0632"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66012"
FT                   /db_xref="GOA:A4IL08"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL08"
FT                   /protein_id="ABO66012.1"
FT                   /translation="MSIQIITDSGADLPQSYLHEHQIAFLPLVVHWDGQDYEDGVTIEP
FT                   KQVYDAMRQGHAMKTSQPSPLAMKELFLPYAKENRPCLYIAFSSRLSGTYQTAMAVRSE
FT                   LLEEYPEFRLTVIDSKCASLGQGLAVIKAVELAEKNTPYNLLCETIEAYCRHMEHIFTV
FT                   DNLEYLARGGRISKTAAAFGGLLNIKPLLHVEDGALIPLEKLRGRKKVLKRMVELMGER
FT                   GDDLQKQMIGISHADDEETALELKRMIEETYGCTRFFLSDIGSAIGAHAGPGTIALFFL
FT                   NKSIEI"
FT   gene            complement(707618..707818)
FT                   /locus_tag="GTNG_0633"
FT   CDS_pept        complement(707618..707818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66013"
FT                   /db_xref="InterPro:IPR024217"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL09"
FT                   /protein_id="ABO66013.1"
FT                   /translation="MGNRLFQEARKAVAQAKQAANGEIDMSVDRAIAIAKNALSSAYAH
FT                   SNTAEKAQLRQFQAELDELTQ"
FT   gene            complement(708186..708992)
FT                   /locus_tag="GTNG_0634"
FT   CDS_pept        complement(708186..708992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0634"
FT                   /product="Hydrolase HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66014"
FT                   /db_xref="GOA:A4IL10"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL10"
FT                   /protein_id="ABO66014.1"
FT                   /translation="MKQYLIALDLDGTLLKEDKTISPFTKDVIRRAIDAGHLVVIATGR
FT                   PYRASRMYYEELNLTTPIVNFNGAFVHHPRQPSWGMRHFPLPLPVVKDIVELGETYRIK
FT                   NILAEVMDDVYSHEHDDVLLDIIRLGNPTVEIGDLRRSLGKDPTSVLVYTDREHIEQIR
FT                   SHLSNVYANVLHHRRWNEPWHVIEIIRHGVHKAAGLKQVADYFGIPRERVIAFGDEDND
FT                   LEMIDWAGLGVAMGNAIEPLKTVADDVTTTNEEDGIGVYLQDVLGL"
FT   gene            709111..709878
FT                   /locus_tag="GTNG_0635"
FT   CDS_pept        709111..709878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0635"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66015"
FT                   /db_xref="GOA:A4IL11"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL11"
FT                   /protein_id="ABO66015.1"
FT                   /translation="MVMIENEQLAEVPVLHVVKPEKKLEQLPLIFFIHGFTSAKEHNLH
FT                   FGYLLAEAGYRVVLPDALFHGERDEGLSERRLQLSFWDIVVRTITEINEIKNDLVQRDL
FT                   ADPERIGVAGTSMGGIVTFGALAVYPWVKAAVALMGCPNYSAFFDAMIEEGKRRQIDIP
FT                   MPPALLALEKEKLARYDLSKQPEKLAGRPLFIWHGKCDGVVPYAYTYEFYEQIKPLYEG
FT                   NEDRLKFITDPHAGHKVTREAFLETVRWFCEYV"
FT   gene            710076..710447
FT                   /locus_tag="GTNG_0636"
FT   CDS_pept        710076..710447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0636"
FT                   /product="Cadmium efflux system accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66016"
FT                   /db_xref="GOA:A4IL12"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL12"
FT                   /protein_id="ABO66016.1"
FT                   /translation="MHRPDVCDVYCYDEEKVDRVQRRLHDENIAAIVPFFKALADENRA
FT                   KIVYALCGEEELCVCDLANVIGATVATTSHHLRILYKQGIVKYRKEGKLAFYSLDDEHI
FT                   RELLLVALAHRKEGDGRGE"
FT   gene            710431..712563
FT                   /locus_tag="GTNG_0637"
FT   CDS_pept        710431..712563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0637"
FT                   /product="Cation-transporting ATPase, E1-E2 family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66017"
FT                   /db_xref="GOA:A4IL13"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL13"
FT                   /protein_id="ABO66017.1"
FT                   /translation="MAVANEQALEQLETKTYRVQGLTCTNCAAKFEQNVKALPGVKEAK
FT                   VNFGAAKLTVWGEATIEELEQAGAFERLKIREERERITRREPFWKKKENWNILASAVLL
FT                   LIGIAADAADGGILAVAMYLAVIVIGGYSLFSTGLRNLARLQFDMNTLMTIAILGAAAI
FT                   GEWQEGAVVVILFAISEALERYSMDQARRSIASLMEMAPAEAIIRRGAEEMTVPVEDVR
FT                   VGDVMIVRPGGKIALDGVVVNGASTVNEAAITGESMPSEKTVGDSVFAGTLNGEGFLEV
FT                   KVTKRTDETTLAKMIDLIEEAQAERAPSQAFIDRFARYYTPFIIIFALFIAIVSPLWMG
FT                   GAWLDWVYRGLAVLVIGCPCALVISTPVAIVTAIGNAARRGVLIKGGVYLEQIGRLRAV
FT                   AFDKTGTLTKGKPAVTDIIVYEGKRERLLAVAAAIEKRSQHPLASAVVRQAKEEGVSFL
FT                   DVPVDEFQSLTGQGVKAVVGNETYYIGSPSLFVDMLGRLPDEVEQRIAAFRQEGKTVMA
FT                   IGTASRLLGLIAAADQLRSSAPDTIKAMRRLGVKEVAMVTGDHEQTAQAIGRQAGVSDI
FT                   RAGLLPEQKLAAIRELKQRYGMTAMVGDGVNDAPALAAADVGVAMGGAGTDTALETADV
FT                   VLMADDLRQLPYTIRLGSRTLAIIKQNIAFALGLKVLALIAAVPGWLTLWLAVFADMGA
FT                   TLLVTLNSMRLLRVKE"
FT   gene            complement(713030..713332)
FT                   /locus_tag="GTNG_0638"
FT   CDS_pept        complement(713030..713332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0638"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66018"
FT                   /db_xref="GOA:A4IL14"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL14"
FT                   /protein_id="ABO66018.1"
FT                   /translation="MDVRELAVQQLKTVIDPELGINVVDLGLIYDLQIQDGHIDVLMTL
FT                   TTPGCPLHDSIAGGVKRALEQIDGIRDVRVQVTWNPPWTPDRMSEEALRQLGYFA"
FT   gene            complement(713503..714744)
FT                   /locus_tag="GTNG_0639"
FT   CDS_pept        complement(713503..714744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0639"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66019"
FT                   /db_xref="GOA:A4IL15"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL15"
FT                   /protein_id="ABO66019.1"
FT                   /translation="MFPTRTGTETDIRLPFSFIIFAVLALAVSQLVLLAAVPALSGGTF
FT                   RLPLVWSAAHLALLGFALMAAMGAMYQLVPVAFLTPIWSERLGFWQFAVTAVGIVTLTA
FT                   NLAFMPNQAFFPGLLLFFGIVLFVWQMAMTLKQQGNKTVMTLFVATSLLFLLLTAAAGA
FT                   LLTFHFFAATGANSHEMVFGLHVLFGLCGWFTLLIMGFSYKMAPMFSLAHGFSMQPARY
FT                   VYALYTSGIAVALIGLFLPGRALLTIGAALLTAGFALFAWHVYTILQKRMKKVLDRPFQ
FT                   FSLFAIAIGLGLHVAALVAVVVGSGRLLGIIVYLFIFGWIIFSIVGYLFKIVPFLWWTH
FT                   RYSEKVGQENVPTLKQLMNERSITIQCLLFTVALVLAAVALLFANVPLFAVAQALFAGL
FT                   SVLFAGTILAVFRK"
FT   gene            complement(714750..714959)
FT                   /locus_tag="GTNG_0640"
FT   CDS_pept        complement(714750..714959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0640"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66020"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL16"
FT                   /protein_id="ABO66020.1"
FT                   /translation="MILDNRGLEPPQPMMRTLAALAKMNPGETLTIINDRRPMFLYEQL
FT                   DELGYRHETIAREDGSFEIRITKG"
FT   gene            complement(714956..715354)
FT                   /locus_tag="GTNG_0641"
FT   CDS_pept        complement(714956..715354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0641"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66021"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL17"
FT                   /protein_id="ABO66021.1"
FT                   /translation="MIVRLETSLIQRKTSLFFKLAAKTTFSDRMVVSYITTSSNENDYH
FT                   NSKKGRICMGVTIELDVREDLRQKREPFEKIMNAIKPLQPGDTFILHAPFKPLPLFPIM
FT                   KAKGFTYEAEQIEKKHWKVTFIKQGGDQ"
FT   gene            complement(715571..716263)
FT                   /locus_tag="GTNG_0642"
FT   CDS_pept        complement(715571..716263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0642"
FT                   /product="cAMP-binding domains, catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66022"
FT                   /db_xref="GOA:A4IL18"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL18"
FT                   /protein_id="ABO66022.1"
FT                   /translation="MANHWMKDRLKTVPLFRELSDYELESLVSISHVRVYKPRTFVFMQ
FT                   GDPLERVYFIHSGTVKIYKTDLSGKEQIVSILQTGEMFPHAGFFLKGTYPAHAEVVEEA
FT                   TLIAIPIHDFEQVLMASPELCMKLFRVMGEKIVDLQNRLEAQVLHNTYEQIVLLLLRLT
FT                   RTNAVKQGKWYRLTTHVTNRELANMIGTARETVSRTLSQLKRKGLINVDEHGFYLIDQE
FT                   ALEKEIFF"
FT   gene            716484..718856
FT                   /gene="norZ"
FT                   /locus_tag="GTNG_0643"
FT   CDS_pept        716484..718856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norZ"
FT                   /locus_tag="GTNG_0643"
FT                   /product="Nitric oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66023"
FT                   /db_xref="GOA:A4IL19"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL19"
FT                   /protein_id="ABO66023.1"
FT                   /translation="MLHMEVNRTVRPNIQTGRKTTNSFLKSILIFTILISFTVLLVGGY
FT                   WIFKEMAPRPKEVRSESGEVLMTKETIIGGQAVFQKYGLMDYGTVLGHGSYMGPDYTAE
FT                   ALKVYTEGMQDYKAKERYNKPFADLTDDEKSIIREQVIKEMRKNRYNPVTDVLVLTDAQ
FT                   VYGLEKVRDYYRDVFTNGDGWGLKKGLIKESDMPKANRAWVADSDQIQQIADFFFWTAW
FT                   LSSTLRIGDEITYTNNWPYYEDAGNTMSFSAVWWSGASVTILILFIGIILYVFYRYQLS
FT                   MQEAYAEGKFPVIDLRRQPLTPSQVKAGKYFVVVSALFFVQTMFGALLAHYYTEPDSFF
FT                   GINWIYDILPFNIAKGYHLQLAIFWIATAWLGMGIFIAPLVGGQEPKKQGLLVDLLFWA
FT                   LVVLVGGSMIGQWLGVNGYLGNEWFLLGHQGWEYIELGRIWQIILVVGMLLWLFIVFRG
FT                   VKRGLKRESDKGGLIHLLFYSAIAVPFFYIFAFFIQPDTNFTMADFWRWWIIHLWVEGI
FT                   FEVFAVVVIGFLLVQLRLVTKKSTVRALYFQFTILLGSGVIGIGHHYYYNGSPEVWIAL
FT                   GAVFSALEVIPLTLLILEAYEQYKMMRDGGANFPYKATFWFLISTAIWNLVGAGVFGFL
FT                   INLPAVSYFEHGQFLTPAHGHAAMMGVYGMFAIAVLLYSLRNIVKPEAWNDKWLKFSCW
FT                   MLNIGLAGMVVITLLPVGILQMKEAFIHGYWASRSPSFLQQDVVQNLLLVRAVPDTIFL
FT                   IGVVALLVFAIKALFHLRKPTHGEGEELPVANLAEEE"
FT   gene            719220..719453
FT                   /locus_tag="GTNG_0644"
FT   CDS_pept        719220..719453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0644"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66024"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL20"
FT                   /protein_id="ABO66024.1"
FT                   /translation="MSQFAAKIHAPDYPPRDRHPAIFRLFDSLKPGEVMELTNDHDPRP
FT                   LQYQFMMERPDQFTWEYLEEGPDVWRVAIGKK"
FT   gene            719535..720137
FT                   /gene="mobA"
FT                   /locus_tag="GTNG_0645"
FT   CDS_pept        719535..720137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="GTNG_0645"
FT                   /product="Molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66025"
FT                   /db_xref="GOA:A4IL21"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL21"
FT                   /protein_id="ABO66025.1"
FT                   /translation="MFGRGIAMKRTIAGAVLAGGQSRRFGRPKAFALHQGAPFFTLSVA
FT                   ALAPIVDELYIISHPSLVDEFRRQTDIPVLLDMERYRGCGPLAGIYTAMEWSQSDWVFV
FT                   LPCDMPYMRKEVTERLAAYADSAFDAIVPLHGDRTEPLVALYHQRLGSVIAELLDAGER
FT                   RMTALLDRVRVRYVDTNELAQEQKVWRNVNTQQEYES"
FT   gene            720453..720695
FT                   /locus_tag="GTNG_0646"
FT   CDS_pept        720453..720695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66026"
FT                   /db_xref="GOA:A4IL22"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL22"
FT                   /protein_id="ABO66026.1"
FT                   /translation="MISFVRFATSWMDGASSKFSAISIAFVFRLVWLLAFFMYDLVVCF
FT                   LFFHLLFQHVFSLLLEFFDEQAELFVPLLSLFDSC"
FT   gene            720988..722106
FT                   /gene="pqqE"
FT                   /locus_tag="GTNG_0647"
FT   CDS_pept        720988..722106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqE"
FT                   /locus_tag="GTNG_0647"
FT                   /product="Coenzyme PQQ synthesis protein PqqE"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66027"
FT                   /db_xref="GOA:A4IL23"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR027634"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL23"
FT                   /protein_id="ABO66027.1"
FT                   /translation="MRDFNENPFIVIWELTRACQLKCLHCRAEAQYHRDPRELTFEEGK
FT                   KLIDEIYDMDEPMLVFTGGDPLMRPDVYDLAKYAIDKGLRVSMTPSATPNVTKEAIRKA
FT                   KEVGLARWAFSLDGPNAEIHDHFRGTSGSFDLTIRAIQYLHELDIPVQINTVISRYNVH
FT                   VLDEMVELVEKLKCVLWSVFFLVPTGRGKESDMISPVEHEQVFRWLYETSKRVPFDIKT
FT                   TAGQHYRRVVLQSKMREGKTAKDGIHYEDVLNKGLTGQVDGLGRAPRGVNDGNGFVFIS
FT                   HIGDVYPSGLLPVKAGNVRETPLADIYRNSPIFQDLRNPDKYKGKCGVCEFRHVCGGSR
FT                   SRAYAVTGDYLESEPYCIYIPKALRNKGTNCC"
FT   gene            722461..723630
FT                   /locus_tag="GTNG_0648"
FT   CDS_pept        722461..723630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66028"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL24"
FT                   /protein_id="ABO66028.1"
FT                   /translation="MIHVKPDELETVAGHIPDAEDACQRARMTLSWELSSLAMNLPGVS
FT                   TPAIEELRDELVHWLQRYEEKLNEAEELLYRTAAAMRQADQTLADNMKEFGLELIGWYD
FT                   LQRVFGEYDPVTGERLSFGDRLLAGGMLIASIAPPAKGVGMAGKAATKGAKAIDTASTL
FT                   SKVKHVVRYDKVKVFFQRIYHQVIKAPLVETARLFKTQWDQLVQSIASISMQPVYAGVG
FT                   SAPRMLMNEAKDVSRHMIQKVDNVIEKGTTNVKPKDFSPLAPGGGLAAHEARGGHLIAR
FT                   HVGKTDEELLQRLKDNPKIKGASTFKDRATAERVASEVLNDPNNQKMIQEWLSNPKAKS
FT                   TLVLPYQGTEIIGRGVQRGSTTVENMTNAKIVLKKDGAGNFILTGYPTK"
FT   gene            724857..726032
FT                   /gene="narK"
FT                   /locus_tag="GTNG_0649"
FT   CDS_pept        724857..726032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narK"
FT                   /locus_tag="GTNG_0649"
FT                   /product="Nitrate/nitrite extrusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66029"
FT                   /db_xref="GOA:A4IL25"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL25"
FT                   /protein_id="ABO66029.1"
FT                   /translation="MNKQKALLPITTLAMTFSFAVWAVFSPLASTFQEMYGLTSTQKSI
FT                   LVAIPVLLGSIMRLPLGIWTDRIGGRRLFSLLLLFLIVPLIGAGFADSYAMLMFWAFFI
FT                   GMAGTSFAISVTFVSRLTPPEKQGTALGINAMGNFGTAVASFSIPSIAAAFGVSWAFWG
FT                   MIIPIVIMLILVWFFTPDMPKPKQQKTMRESLSVLKYKHTWTLSLFYFVTFGAFVAFGI
FT                   YLPSLLVDLYGLTPVDAGMRAAGFTVLATLARPVGGNLGDKIGAERVLTFVYAGMTIGA
FT                   LVIAFWMENIWVMTAACLLLAVMSGLGNGAVFKLVPQLFPAETGAVTGLVGAWGGLGGF
FT                   FPPILMGIIKDVTGSYVLGFMLLSLFTLICFLLNRIVFGKKAGEPANRYAS"
FT   gene            726332..727390
FT                   /gene="nirK"
FT                   /locus_tag="GTNG_0650"
FT   CDS_pept        726332..727390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirK"
FT                   /locus_tag="GTNG_0650"
FT                   /product="Nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66030"
FT                   /db_xref="GOA:A4IL26"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="PDB:3WKP"
FT                   /db_xref="PDB:3WKQ"
FT                   /db_xref="PDB:3WNI"
FT                   /db_xref="PDB:3WNJ"
FT                   /db_xref="PDB:3X1E"
FT                   /db_xref="PDB:3X1F"
FT                   /db_xref="PDB:3X1G"
FT                   /db_xref="PDB:3X1N"
FT                   /db_xref="PDB:4YSA"
FT                   /db_xref="PDB:4YSD"
FT                   /db_xref="PDB:4YSO"
FT                   /db_xref="PDB:4YSP"
FT                   /db_xref="PDB:4YSQ"
FT                   /db_xref="PDB:4YSR"
FT                   /db_xref="PDB:4YSS"
FT                   /db_xref="PDB:4YST"
FT                   /db_xref="PDB:4YSU"
FT                   /db_xref="PDB:4ZK8"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL26"
FT                   /protein_id="ABO66030.1"
FT                   /translation="MNRNVYAVLSTVLAASLLAACNSGGEQVKAESKNKTAATQQSEPN
FT                   VIAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVV
FT                   VNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYH
FT                   CGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSY
FT                   VVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDD
FT                   VYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTE
FT                   TGEDDGTETSGH"
FT   gene            complement(727543..729216)
FT                   /locus_tag="GTNG_0651"
FT   CDS_pept        complement(727543..729216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0651"
FT                   /product="acetolactate synthase large subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66031"
FT                   /db_xref="GOA:A4IL27"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL27"
FT                   /protein_id="ABO66031.1"
FT                   /translation="MVHLPTRLGADVLVESLAVQGIAHMFGCCHESMLPVRHVLNHHPG
FT                   LSYIEMKHEQAAVHAADGYARASGKLGVAIIGAGVTNGITGITTALSDSIPLLAIIGRP
FT                   SPEEHLYAPDLDMLSLCTPVTKYHLQVSKINDIPSTIQRAYEIALDGRPGPVTVEIPTH
FT                   LLHQETAEAYPMQKAVLPKPKNIRRKSLEAAITTIENAKKPVLFIGGGVIHSGASEWVR
FT                   EVATQSQIPVVSSLMGIGAFDKTNPLYLGMVGMHGTYAANKAVHQCDVLICVGVRFSDR
FT                   VTGKISGFSPKSKKIHVDIDAAEINKNIHVDIPIVGDATQFFRSLAGRLRYPLVREHTK
FT                   DWVAEVTKWQRTVPRFDTSTSRLKPQNVIRLLSALTEEDAIVVTDVGQHQIWTAHHYTF
FT                   TKPRTFLTSGGLGTMGYGLPAAIGAAVASPGKKVICISGDGCFQMNVQEMMTAVAYKLP
FT                   IKIAVLNNGYLGMVRQWQELFYQKRYSAVKITSPHFAKLAEAYGAIGYAVDSEEEAEDI
FT                   IKKALKHDGPVLLDFNIAEEENVYPIVPPGQSNEQAILSH"
FT   gene            729397..729804
FT                   /locus_tag="GTNG_0652"
FT   CDS_pept        729397..729804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66032"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL28"
FT                   /protein_id="ABO66032.1"
FT                   /translation="MSGPSLRKLEAHRSIHHGAFVEAKRLTELLETLYTDGRYEHAAEV
FT                   ADALAEHWEKRIIAHAEAEEEGFYREKAEERKELSETIAQLKRDHDMMRTLIAEIRQRL
FT                   SEQIDREVLTRFHALLHINRIHSADEEALLF"
FT   gene            729836..733519
FT                   /gene="narG"
FT                   /locus_tag="GTNG_0653"
FT   CDS_pept        729836..733519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narG"
FT                   /locus_tag="GTNG_0653"
FT                   /product="Respiratory nitrate reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66033"
FT                   /db_xref="GOA:A4IL29"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL29"
FT                   /protein_id="ABO66033.1"
FT                   /translation="MNEKPAPLLRKLKYFGRSEKIASHAELSPYGRDAEKTYRRRWQHD
FT                   KVVRTTHGVNCTGSCSWKVHVKDGIIAWETQQTDYPTTGPDMPEYEPRGCPRGASFSWY
FT                   IYSPLRVRYPYVRGALLRLWKEALQQEGDPVAAWKSIVEDPEKAKRYKRARGKGGFVRA
FT                   KWDDVYTMIAASLIYTIQKYGPDRIFGFSPIPAMSMVSYAAGARFLNLIGGALLSFYDW
FT                   YADLPPASPQIWGEQTDVPESSDWFNSSYMIVWGSNLPQTRTPDAHFYVEVRYRGTKVV
FT                   AISPDYAEFVKFADNWLPVQPGMDGALAMAMTHVILKEFYVNQSADYFTDYVKKYTDLP
FT                   FLVMLKKHGDRYAAGRFLRASDLGMPLQYAEWKTIVWDEQSQTFAVPNGTIGHRWENNG
FT                   NWNLQLNDIDNKRMGIQPALTFLGQQDDTVIVQFPHFEAGNKTVLERGVPVKAIEQNGE
FT                   TVYVTTVFDLLLAKMGVNRGLPGDYPTDYDDMKPYTPAWQEAITGIDRKTAAQIAREFA
FT                   QNALDSKGRSMIVMGSGINHWYHSDTIYRAILNLVLLTGSQGVNGGGWAHYVGQEKVRP
FT                   LEGWQTIAMARDWGGPPRLQNGTSFFYFVTEQWKYEDQSMDEHVSPLVDKPRYEHGGDY
FT                   NYLAARLGWLPSYPQFNANSIALVEQANAKTNEEAVQYVVEQIKKGNIKFAIENPSDPV
FT                   NFPRVMFVWRGNLIGSSAKGHEYFLKHLLGTHHANLSEQNDDLKTSEIVWDENAPEGKL
FT                   DLMVNIDFRMAGTGLYSDIVLPAATWYEKYDVSSTDMHPFVHPFNPTIAPPWEAKSDWD
FT                   FFKGLAKTFSELAAHYFSKPVSDVVATPLLHDTRDEIAQPFGVVNDWKDGTTEPVPGVN
FT                   FPRLHIVERDYKEIYNKFVALGPIVREQIGAKGLSWDAKEEYKWLLDTLGSSALEGPYQ
FT                   DCPSLLTDRDAAEAILALSSTTNGSLALKAWGEMEKKTMQPLKDLVVERAEEHITFQAI
FT                   TAQPRQVLTTPVFSGSETGNRRYSPFTTNVERLIPWRTLTGRQHFYLDHEIMFEFGEEL
FT                   PTFKAPLRKLAFYDHDRRPRVSGKEITLRYLTPHFKWSYHSTYWDTLPMLTMFRGGPTV
FT                   WMNKEDAAEAGIADNDWIEMYNRNGVVIARAVVSHRLPRGVAFMYHVQERHINVPGSPI
FT                   SKLRGGTFNSPTRIHVKPTQMIGGYAQLSYGFNYYGPTGNQRDEQVMIRKLEKREVDWL
FT                   ES"
FT   gene            733509..735041
FT                   /gene="narH"
FT                   /locus_tag="GTNG_0654"
FT   CDS_pept        733509..735041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narH"
FT                   /locus_tag="GTNG_0654"
FT                   /product="Nitrate reductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66034"
FT                   /db_xref="GOA:A4IL30"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL30"
FT                   /protein_id="ABO66034.1"
FT                   /translation="MRVRAQFGMVMNLDKCIGCHTCSITCNNTWTNRPGAEYMWWNNVE
FT                   TKPGIGYPKEWENQDAHKGGWVLKDGKLELRAGGRVNKLLNIFYNPDMTVIDDYYEPWT
FT                   YDYEQLINRPEGEHQPVARPKSQLTGEYMDITWGPNWEDDLAGVYETGKRDPNVRGIEE
FT                   KVKFEFEQTFMMYLPRICEHCLNPPCVSSCPSGAIYKRDEDGIVLVDHDACRSWRFCVT
FT                   GCPYKKVYFNWKTHKAEKCTFCFPRIEAGLPTVCSETCVGRLRYIGIVFYDLDQVEAAA
FT                   SVQDEKELYHAHLRIFLNPYDPDVIEAAREAGYTDDWIEAAQRSPVYKLAVEQKIALPL
FT                   HPEYRTLPMVWYIPPLSPIMGAFDGGLDDIHPHVIFPAIDQMRIPIEYLANLLAAGDTE
FT                   VIRTVLKKMVAMRSYMRAVNLGKEPDRSILEKVGMDEHTVKEMYKLSAVAKYSDRYVIP
FT                   SSHREKAGNAFYSQGTAGYAFMESCSGCSGYDAESFYQFYWGDEDGRASETI"
FT   gene            735016..735576
FT                   /gene="narJ"
FT                   /locus_tag="GTNG_0655"
FT   CDS_pept        735016..735576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narJ"
FT                   /locus_tag="GTNG_0655"
FT                   /product="Nitrate reductase protein J"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66035"
FT                   /db_xref="GOA:A4IL31"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL31"
FT                   /protein_id="ABO66035.1"
FT                   /translation="MEEHQKLFKLASILLQYPEREWLEDDRLFYEISQLANHTARKRFL
FT                   QFLDYAKTKEIDELCELYVRTFDLSDRTTMYITYYLFGDQKERGQALLKLKEAFRRAGL
FT                   ELTGDELPDYLPLMLEFAAVAPVNDAKNVLLAHQKAIKGLADRLQEVDHPYFFVLDGCL
FT                   AGMAAFFEETRGVDIPMRAEEAT"
FT   gene            735573..736265
FT                   /gene="narI"
FT                   /locus_tag="GTNG_0656"
FT   CDS_pept        735573..736265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narI"
FT                   /locus_tag="GTNG_0656"
FT                   /product="Respiratory nitrate reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66036"
FT                   /db_xref="GOA:A4IL32"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL32"
FT                   /protein_id="ABO66036.1"
FT                   /translation="MTLLDQFLWVIYPYIMLTLFVAGHIYRYNTDQFGWSAKSSEFLEK
FT                   RRLRWGSVLFHWGILFVFFGHVAGILVPKTFYESIGITEEMYHFGAVWFGGAAGVATVI
FT                   GVVLLLWRRFSVRRLLRHSSKSDLVVLLLLTIVILTGFTNTVGYTATGGTFDYRDTIGP
FT                   WFRGLLTFRPLPQLVSDAPIGFQIHILSALLLFGIWPFTRLVHVWSIPLTYLNRHYVVY
FT                   RRMRAKKI"
FT   gene            complement(736333..737058)
FT                   /locus_tag="GTNG_0657"
FT   CDS_pept        complement(736333..737058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0657"
FT                   /product="Transcription regulator Crp family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66037"
FT                   /db_xref="GOA:A4IL33"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL33"
FT                   /protein_id="ABO66037.1"
FT                   /translation="MEVSIMERQSRTAANRDFSLLRSWLQSSKKVIPLRKHSFLFQEGM
FT                   PANELYLILSGKVQVSKICPDGKEMCFRICGSGEIVGELTLFTDDPRYLLTAKVIEPGE
FT                   AAVMNKNELEEQLLINPTLTLEYMRWISKHARRTQTKFRDLIMNGKKGALYSTLIRLCN
FT                   SYGVPLEDGSIFIDLTLKNQDLANFCGTTRESVNRMLNALKQDGIISMKRGKITVHDLN
FT                   YLKTEIQCEDCPPDICCIE"
FT   gene            737266..737928
FT                   /gene="modB"
FT                   /locus_tag="GTNG_0658"
FT   CDS_pept        737266..737928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="GTNG_0658"
FT                   /product="Molybdenum transport system permease protein B"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66038"
FT                   /db_xref="GOA:A4IL34"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL34"
FT                   /protein_id="ABO66038.1"
FT                   /translation="MTAFWSPVWLSIKVSLLAGLIVAVLGTAAARWMARRRFRGKTVVE
FT                   TVFMLPLVLPPSVVGFLLVVLFGRHSPIGQWIESSFHTTILFTPGAAVMAAVVVSFPLM
FT                   YQAAKTGLEAVDPTIEGAARIDGANERQVFWHISLPLARHALLSGAVLSFARSLGEFGA
FT                   TLMFAGNIPGKTQTIPTAVYMAMESGRMELAWAWVAVTIGLSFSLLVFATKLGRLRE"
FT   gene            737983..739008
FT                   /gene="moaA"
FT                   /locus_tag="GTNG_0659"
FT   CDS_pept        737983..739008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="GTNG_0659"
FT                   /product="Molybdenum cofactor biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66039"
FT                   /db_xref="GOA:A4IL35"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL35"
FT                   /protein_id="ABO66039.1"
FT                   /translation="MSERNRTDVMDRLSRPLRDLRLSVIDQCNFRCIYCMPAEVFGPNF
FT                   RFLAEGELLTVEEMALLSECFVELGVEKIRLTGGEPLLRRDLDALVARLSAIPGLRDIG
FT                   LTTNGVHLVKWAQRLKEAGLKRVNVSLDALDDDIFRKMNGIGVGVAPVLKGIEAARAAG
FT                   LGVKVNMVVKKGWNDSQIVPMASYFKDLGIPLRLIEFMDVGTTNGWDYSHVVTKKEMYE
FT                   QINAMHPLEPIEKAYFGEVASRYRYVGTEVEVGFIASVTETFCRSCTRARISADGKLYT
FT                   CLFASKGVSLKDKLRAGATKEELKSLITAVWNQRTDRYSEERTEETAKQRVKIEMSYIG
FT                   G"
FT   gene            complement(739110..739817)
FT                   /gene="dnrN"
FT                   /locus_tag="GTNG_0660"
FT   CDS_pept        complement(739110..739817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnrN"
FT                   /locus_tag="GTNG_0660"
FT                   /product="Nitric oxide-dependent regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66040"
FT                   /db_xref="GOA:A4IL36"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL36"
FT                   /protein_id="ABO66040.1"
FT                   /translation="MEQRFTEQSLIGDIVTQFPKAADLFKARRIDFCCGGQRPLKEAIE
FT                   ERGLDGEALLRELNALYAEAQNKPTGNWSEAPLTDLVDHIVSTHHRYLNEELPQLSPYV
FT                   TKVLRVHGMHHPHLSRVHKLFHELKTELEQHLIKEETGAFPLILQFADNPSPENREAVE
FT                   RAVRELVNEHDAAGDLIKEIREITNDFTPPEDACGTYRLVYSRLAALEEDLFTHIHLEN
FT                   NVLFPRVLAAVKA"
FT   gene            740106..741062
FT                   /locus_tag="GTNG_0661"
FT   CDS_pept        740106..741062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0661"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66041"
FT                   /db_xref="GOA:A4IL37"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL37"
FT                   /protein_id="ABO66041.1"
FT                   /translation="MWPLVKGRQWEEEKAKLEQQIAEMKDQLTRQKESIHETVAGLLGE
FT                   LQEIVHQHEVVNGQHHALGRLVDRTKEKVDNVSTLSKSSYAISDRLCEQGNSLAETAGQ
FT                   MVAAAKEGIRMSGEMEKAMGQLGSEMEATSAAMYRLRGRSQEIEQIVKVIKEIAGQTNL
FT                   IALNASIEAARAGEHGKGFSVVAAEVRKLAEHTADSTETIHQLTDAVQQEIERSLEQTE
FT                   AISSLIETVVQMSIHTARKWSAMRELIDQVENRAKDVLNYIQEQYRYADEVMQELEQSA
FT                   SLFSETREMILRHIADASVVDEKLAEGIKQLQQWQQR"
FT   gene            741112..742371
FT                   /gene="moeA"
FT                   /locus_tag="GTNG_0662"
FT   CDS_pept        741112..742371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="GTNG_0662"
FT                   /product="Molybdopterin biosynthesis MoeA protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66042"
FT                   /db_xref="GOA:A4IL38"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL38"
FT                   /protein_id="ABO66042.1"
FT                   /translation="MVERRTPIPVAEAINRVMCYAGVGEEETVPLRQSYGRYLAEDLCA
FT                   DHDVPPFDRSPYDGFAIRAADSQEAGLDHPVEFEVIEAIGAGQVATKTVGPFQAVRLMT
FT                   GAQIPNGCDAVVMLELTKQYERDGKTYMSIKRPFRPGDNISFQGEDAKKGTPLVKKGTR
FT                   INPGVAALLATFGYAEVKVAKKPRIGLFATGSELLDVSEPLVPGKIRNSNAYMIEAQAL
FT                   KSGAELIYFGQLADDLDACFHAVREALDQVDMLITTGGVSVGDYDYLPAIYERLQANVL
FT                   FNKIAMRPGSVTTVAEWNGKLLFGLSGNPSACYVGYELFVRPVVRTRLFSTKPYLKKVK
FT                   ATLGADFPKPNPFTRFVRSRVEAIDGRLIVKPVGMDKSNIVTSLAAANALMVLPGGTRG
FT                   FAKDDEVDVWLLDDDEGSSE"
FT   gene            742368..742868
FT                   /gene="mobB"
FT                   /locus_tag="GTNG_0663"
FT   CDS_pept        742368..742868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="GTNG_0663"
FT                   /product="Molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66043"
FT                   /db_xref="GOA:A4IL39"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL39"
FT                   /protein_id="ABO66043.1"
FT                   /translation="MNVWQVVGYKHTGKTTLVEKWVAAAVREGWRVGTVKHHGHGGEPA
FT                   RPEGVDSVRHERAGAVVTAVEGDGLLQLHLRRPLWRLDDVLALYAPLRLDLVLVEGYKQ
FT                   APHPKVVLVRSEEDWASLQHLANIRAVIAWEPLSRPLPHPVFSMADDARYIPWLMNEVR
FT                   MRT"
FT   gene            742865..743332
FT                   /locus_tag="GTNG_0664"
FT   CDS_pept        742865..743332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0664"
FT                   /product="Molybdopterin converting factor, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66044"
FT                   /db_xref="GOA:A4IL40"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL40"
FT                   /protein_id="ABO66044.1"
FT                   /translation="MTESLFSITSEPISVEAVMKKVMRPEAGAVAVFAGTVREWTNGKR
FT                   TLFLQYEAYVSMAEKMLAQIGAEIAEKWPGTKTAITHRIGRLEIGDIAVVIAVSSPHRA
FT                   EAYEANRYAIERIKQIVPIWKKEQWEDGSAWIGDQLETKAYPSGKPEVNEP"
FT   gene            743329..743559
FT                   /locus_tag="GTNG_0665"
FT   CDS_pept        743329..743559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0665"
FT                   /product="Molybdopterin (MPT) converting factor, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66045"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL41"
FT                   /protein_id="ABO66045.1"
FT                   /translation="MIRLLFFAHLGEQVGERQVTWPHVPETVGKLKEEVEARYSLSLER
FT                   VMTAVNEEYAHDDAPLQTGDTVAFIPPVSGG"
FT   gene            743565..744293
FT                   /locus_tag="GTNG_0666"
FT   CDS_pept        743565..744293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0666"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66046"
FT                   /db_xref="GOA:A4IL42"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL42"
FT                   /protein_id="ABO66046.1"
FT                   /translation="MANKSKWVMPKQHGAWAMLIIPFWLGAYAGGVSWIHVPLFIAWLA
FT                   LYLATYPLLMAVKTKRKEPYVPAAIRYGAIAAPALAVSLWQRPSLVFFGLAMIPFFLVN
FT                   TYYSRKKNERAFWNDVAAIGAFCIGGLGAFYVGCGELTLEAFELAVFSFLFFIGSTFYV
FT                   KTMIREKKNERYKWLSWGYHALLVAGLIATGETFAVLAYAPSVVRAVYLYGKALPIMKL
FT                   GILEIANAAYFFIAMIVLYS"
FT   gene            complement(744437..745327)
FT                   /locus_tag="GTNG_0667"
FT   CDS_pept        complement(744437..745327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0667"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66047"
FT                   /db_xref="GOA:A4IJN7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A4IJN7"
FT                   /protein_id="ABO66047.1"
FT                   /translation="MISNWNSEHAWTYEIDPILEALFRYIDSLSLPETPYVTGRPPVSK
FT                   KSLLKCFFLKTYFSIDSLRKLVRILQRFRCFQRACGLGEVPHLSTFSRAAKWFREQGFP
FT                   VFHAQLLKDLEVRYPQIVLIDSTALRSSLYDSQAKWGVSTRYHWFKGYKLHLCTTAEGI
FT                   ILSHVLTTANRNDAAVAPELLVSLKQWDIEFVLGDAAYDSEKVRQTAEQSGILFISPIN
FT                   RRNSEERKDAYGRVLPVFLKTRFGQWLFGLRREIERVFNELKSDGLEQPRWYGFHRYVL
FT                   HVLCCILMHNFEFLL"
FT   gene            complement(745769..746452)
FT                   /locus_tag="GTNG_0668"
FT   CDS_pept        complement(745769..746452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0668"
FT                   /product="Transcription regulator Crp family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66048"
FT                   /db_xref="GOA:A4IL44"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL44"
FT                   /protein_id="ABO66048.1"
FT                   /translation="MEHVSVELRELLSAIYRTIPVKKGMYLFQEGEKADELYYIQSGKI
FT                   QISKTNMDGQELTLRICSQGDLIGELTLFCPGARYMLTAKALEDSVVSAIPREVIEKEL
FT                   SDNPKLAIEFMKWMSLHFRKTQTKFRDLILHGKKGALYSTLIRLCNSYGVMKEDGILID
FT                   IPLTNQELANFCGTAREVVNRMLGDLRKKGVISVQKGKIRVHNLQYLRDEIACEGCPPE
FT                   LCSID"
FT   gene            746608..746799
FT                   /locus_tag="GTNG_0669"
FT   CDS_pept        746608..746799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66049"
FT                   /db_xref="GOA:A4IL45"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL45"
FT                   /protein_id="ABO66049.1"
FT                   /translation="MEKCDFAIASVFIVSPLLLFSLFHRLANKGEKKSSKIIKYTFDFI
FT                   FMQYYNENYMKHIGRWTG"
FT   gene            746796..747830
FT                   /locus_tag="GTNG_0670"
FT   CDS_pept        746796..747830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0670"
FT                   /product="N-acetyl-glutamate-gamma-semialdehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66050"
FT                   /db_xref="GOA:A4IL46"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IL46"
FT                   /protein_id="ABO66050.1"
FT                   /translation="MKVAIIGATGYSGAELFRLLQAHPHVDRCDVYLSSQDGVHLSESF
FT                   PHVGAVDGAVLHKLDIEALAKYDAVFFATPPGVSGEWAPALVDRGVKVIDLSGDFRLKD
FT                   GAVYERWYGREAAPAAYLKRAVYGLTEWNRDAVREAELLSNPGCYPTATLLGLAPLVKE
FT                   RLIEEDSIIVDAKSGVSGAGRKAGLGTHFSEVNENVKIYKVNAHQHIPEIEQMLGTWNG
FT                   AMKPITFSTHLIPMTRGIMSTIYAKVKQPFSLNDLIDLYKTSYEDASFVRIRQPGQFPA
FT                   TKEVYGSNYCDIGLAYDERTGRVTVVSVIDNLMKGAAGQAVQNFNLMMGWDEVEGLCFL
FT                   PTYP"
FT   gene            747856..749088
FT                   /locus_tag="GTNG_0671"
FT   CDS_pept        747856..749088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0671"
FT                   /product="Ornithine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66051"
FT                   /db_xref="GOA:A4IL47"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL47"
FT                   /protein_id="ABO66051.1"
FT                   /translation="MTVTKQTAQVTALAGGTVVTPKGFQAAGVHAGLHHSKKDIGVIVC
FT                   DVPASAAAVYTQSHFQAAPLKVTQASLAVEQKLRAVIVNSSCANACTGEQGLRDAYEMR
FT                   DLCAKQFGFAPHYVAVASTGVIGEHLPMEKIRAGIEKLAPGATIADAEAFQTAILTTDT
FT                   VMKHACYETKVDGKTVIVGGAAKGSGMIHPNMATMLAFITTDANISSPVLQAALRSITD
FT                   VSFNQITVDGDTSTNDMVVVMASGLAGNDELTPDHPDWENFYEALRKTCEDLAKQIAKD
FT                   GEGATKLIEVRVHGAKTDDEAKKIAKQIVGSNLVKTAVYGADANWGRIIGAIGYADADV
FT                   DPANVDVAIGPIVMLKGSEPQPFSEEEAVAYLQNDMIVIDVDLHLGDGFGIAWGCDLTY
FT                   DYVKINASYRT"
FT   gene            749101..749877
FT                   /locus_tag="GTNG_0672"
FT   CDS_pept        749101..749877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0672"
FT                   /product="Acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66052"
FT                   /db_xref="GOA:A4IL48"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4IL48"
FT                   /protein_id="ABO66052.1"
FT                   /translation="MENTVVIKCGGSVLDELSPAFFASVKTMREQGMNVVIVHGGGPEI
FT                   GKMLKQLNVRSEFVNGLRKTTKEVLAVVEMVLSGKVNKQLVTMFKQHGLPAVGISGVDG
FT                   GLLEAEPIDGIKLGYVGRVTAVRVDLLQTLLAANYIPVISPLGVGRSGQTYNINADTAA
FT                   GAIAAAIGANQLAFVTNVPGLLQDGTLIGEATAETVEQLLKDGVITGGMIPKVKAALSA
FT                   LSDALPKVMIVSGKTPFYEQGTWHGTTIRKEVGAYL"
FT   gene            749874..751034
FT                   /locus_tag="GTNG_0673"
FT   CDS_pept        749874..751034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0673"
FT                   /product="N-acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66053"
FT                   /db_xref="GOA:A4IL49"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL49"
FT                   /protein_id="ABO66053.1"
FT                   /translation="MSALFPTYNRWKISVQSAEGTVVTDVNGKQYLDFVSGIAVCNLGH
FT                   RHPHVKKAIEEQLNQYWHVSNLFTIPIQEEVASQLVAHSAGNYVFFCNSGAEANEAALK
FT                   LARKHTGRHKVITFHQSFHGRTFATMAATGQEKVHSGFGPLLPEFIHLPFNDASALEKA
FT                   MNDEIAAVMLEIVQGEGGVRPIDPVFLQTAAELCQKYGALLIIDEVQTGIGRTGKPFAY
FT                   QHFGIEPDIMTVAKGLGSGIPVGAMIGKAFLKDSFGPGVHGSTFGGNPIAMAAAKATLE
FT                   VVFDSAFLQEVQEKGSYLLGRLNEALSPLEIVKDVRGLGLLVGVECQTEIAPLLPLIHE
FT                   SRLLVLPAGPKVIRLLPPLVVTKDEIDQAVDILTATLKNANASAVL"
FT   gene            751127..752191
FT                   /gene="carA"
FT                   /locus_tag="GTNG_0674"
FT   CDS_pept        751127..752191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="GTNG_0674"
FT                   /product="Carbamoylphosphate synthetase light subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66054"
FT                   /db_xref="GOA:A4IL50"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL50"
FT                   /protein_id="ABO66054.1"
FT                   /translation="MKAYLHLASGKTFSGKLATPLEKKVSGEIVFFTGMTGYQEVLTDP
FT                   SYKNQIIVFTYPLIGNYGINDEDFESKRPHVAAAVVYEASNEGFHYGVKYSLAEYLRHW
FT                   NIPLLTHVDTRALVKEIRMEGTMMAELSSSPIPAVMDEETTFPVCAVSTKKMETYGQGG
FT                   PHIVLIDFGYKKSILQSLVSRGCQVTVVPHDTAPEAIDALKPDGLVLSNGPGDPKQLSV
FT                   RLPAIRQLIDRYPTLAICLGHQLVALAYGADTEKLRFGHRGANQPVWDAVKQKVMITSQ
FT                   NHSYVVKEKSLEGKPFAIRFININDGSVEGMIHRDKPILSVQYHPEAHPGPQDTGYIFD
FT                   EFLQTVAKGEKVYA"
FT   gene            752184..755312
FT                   /gene="carB"
FT                   /locus_tag="GTNG_0675"
FT   CDS_pept        752184..755312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="GTNG_0675"
FT                   /product="Carbamoylphosphate synthetase heavy subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66055"
FT                   /db_xref="GOA:A4IL51"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL51"
FT                   /protein_id="ABO66055.1"
FT                   /translation="MPKDSSLQSILLIGSGPIVIGQAAEFDYSGTQACIALKEEGYRVI
FT                   LVNNNPATIMTDDVHADAVYFEPLTVDAIEAIIAKERPDGLLATFGGQTGLNLAFQLYE
FT                   AGVLEKYGVRLLGTPIEAIKRGEDREAFRALMHELGEPVPESEIVTNVKEAVAFAEQIG
FT                   FPIIIRPAYTLGGTGGGIAENMKQFIALVEKGLAESPIRQCLIERSVAGFKEIEYEVMR
FT                   DQSNTCITVCNMENVDPVGVHTGDSIVVAPSQTLTDEEYQMLRSSAVKIISALGIIGGC
FT                   NIQFALDPNSKQYYLIEVNPRVSRSSALASKATGYPIARIAAKLAVGYTLAELINPVTK
FT                   TTYASFEPALDYVVVKFPRLPFDKFPHADRKLGTQMKATGEVMAIDRNMERAFQKAVQS
FT                   LEGKNNGLFLSELSAKTNDELKQLLVNKDDRRFFAILELLRRGVTVETIHEWTKIDRFF
FT                   LCTFERLVALEKQAAAVTLDTIDETMFRFLKEKGASDAFLAETWSVTELEVRNKRKELG
FT                   IVPSYKMVDTCAAEFHSETDYYYSAYFGEDERKQASGKEKVLIIGAGPIRIGQGIEFDY
FT                   SSVHSVFALQKEGYETIMINNNPETVSTDFAIADRLYFEPLTLESVLDVIEAEQIQHVI
FT                   VQFGGQTAINLVKGLEEAGVRLLGVTYDIIDQLEDRDRFYQLLEELDIPHVPGLMANDA
FT                   EELVAKAAEIGYPVLLRPSYVIGGRGMFIIRSEAQLAALIEQGELTYPILIDAYLDGKE
FT                   AEADIVTDGTDILLPTIIEHVEKAGVHSGDSYAWLPAQTLTEEERANIVDYARRIAKKL
FT                   GFKGIMNIQYVIADGNVYVLEVNPRASRTVPIVSKTTGVPLAQIATKLLLGKSLVDIPG
FT                   GKMSGLTVMPYVVLKYPVFSTYKLPGVDPTVGPEMKSTGEGISIAMTKEEAAYKAFYAY
FT                   LQKKANANELYVIGDIDAELAAEIETKQLNIVTDVSFADWVKRDGALAVIDLRKEEGEA
FT                   PKRMAALSQQLLVFTERETLDLFLQALTVGQLDVQPISGWIKKKKQAEQAVIA"
FT   gene            755309..756247
FT                   /locus_tag="GTNG_0676"
FT   CDS_pept        755309..756247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0676"
FT                   /product="Ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66056"
FT                   /db_xref="GOA:A4IL52"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL52"
FT                   /protein_id="ABO66056.1"
FT                   /translation="MNTVMSLKGRDFLTLLDFSTEEIFDLLALAGDLKAKQKAGMPYTP
FT                   LAGKTMAMIFEKPSTRTRVSFEVGMIQLGGSALYLNSNDLQLGRGETIADTARVLSQYV
FT                   DVIMIRTFAHQKVEELAEYASIPVINGLTDDDHPCQALADLLTIYEVKKTFQGIKLAYV
FT                   GDGNNVANALLAAAAKVGMDVAIACPPGYEPKAAYVEAARQIGEKTGAAVTVTHDPLEA
FT                   VAGADAIYTDVWTSMGQESESDERLQVFQPYQVNEALVKAAKPDYIFLHCLPAHRGEEV
FT                   TAGVMDGPNSMVFEQAGNRLHAQKAILVSVL"
FT   gene            756461..756640
FT                   /locus_tag="GTNG_0677"
FT   CDS_pept        756461..756640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0677"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66057"
FT                   /db_xref="InterPro:IPR025549"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL53"
FT                   /protein_id="ABO66057.1"
FT                   /translation="MGQPRHFKPGDKAPNNGVYIEIGETGDNVKNPKKLKLKAGDTFPE
FT                   TSNHNRHWTYLRKP"
FT   gene            756747..759332
FT                   /gene="clpB"
FT                   /locus_tag="GTNG_0678"
FT   CDS_pept        756747..759332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="GTNG_0678"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66058"
FT                   /db_xref="GOA:A4IL54"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL54"
FT                   /protein_id="ABO66058.1"
FT                   /translation="MDASRLTEKLQEALMAAQSLAKERHHQQLDVEHLLSALLEQEGGL
FT                   APRLLELSGADRNKVVGFLNEQLRHKPEVHGTEGQLYIAPALARLLDEAEAEAKRMQDE
FT                   YVSVEHVLLALPSGAEHIARRLASFGLTREALLTALTKVRGNQRVTSPHPEATYEALTK
FT                   YGRDLVAEVKAGKIDPVIGRDSEIRRVIRILSRKTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVRKDVPEGLKDKTIFALDMSALVAGAKFRGEFEERLKAVLNEIKKSDGRIILFIDELH
FT                   TIVGAGKAEGAIDAGNMLKPMLARGELRCIGATTLDEYRQYIEKDPALERRFQQVLVEE
FT                   PSVEDTISILRGLKERYEVHHGVKIHDRALVAAAVLSDRYISDRFLPDKAIDLVDEACA
FT                   TIRTEMESMPSELDEVMRRVMQLEIEEAALSKETDEASRTRLEALQNELANLRERANAM
FT                   KAKWQQEKETLDRVRRVREELERAKRELEEAENDYDLNKAAELRHGRIPQLEKQLKQLE
FT                   QEASGQGEGKLLREEVTEEEIAEIVSRWTGIPLTRLVEGEREKLLRLHELLHERVIGQD
FT                   EAVELVADAVLRARAGIKDPNRPIGSFLFLGPTGVGKTELAKTLAEALFDSEEQLIRLD
FT                   MSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVLLLDEIEKAHPDVFNLLLQ
FT                   LLDDGRLTDSQGRTVDFKNTVVIMTSNIGSPLLLESRNGEIEEETRKQVLDQLRAHFRP
FT                   EFLNRIDDVVLFKPLSTNEVKGIVAKFARELSRRLADRHIELVLTEEAKQHIAEAGFDP
FT                   VYGARPLKRFMQKQIETPLAKELIAGRVKDYSTVTVDVENGQLVIRPSA"
FT   gene            759510..760082
FT                   /locus_tag="GTNG_0679"
FT   CDS_pept        759510..760082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0679"
FT                   /product="Transcriptional regulator TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66059"
FT                   /db_xref="GOA:A4IL55"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A4IL55"
FT                   /protein_id="ABO66059.1"
FT                   /translation="MARERKISLNELFAQTKQLLLEHGYEGFTFGLLAERLGVARSAIY
FT                   KYFENKEELITTYMVNEMEEVFIKLEHIHVYPTFDEQFRFLLDFILYHNDLHEMISIGK
FT                   RIPENHPKVQENKQRLAQFHKRMYEELEHLIKRGKQEGKIKPHLPNQVILGYIFQSVSV
FT                   PHFPGISLAEWVESIREIIMYGVMNRN"
FT   gene            760172..762292
FT                   /locus_tag="GTNG_0680"
FT   CDS_pept        760172..762292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GTNG_0680"
FT                   /product="Probable export protein"
FT                   /db_xref="EnsemblGenomes-Gn:GTNG_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABO66060"
FT                   /db_xref="GOA:A4IL56"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL: