(data stored in ACNUC7421 zone)

EMBL: CP000561

ID   CP000561; SV 1; circular; genomic DNA; STD; PRO; 2009313 BP.
XX
AC   CP000561;
XX
PR   Project:PRJNA18111;
XX
DT   28-FEB-2007 (Rel. 90, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 4)
XX
DE   Pyrobaculum calidifontis JCM 11548, complete genome.
XX
KW   .
XX
OS   Pyrobaculum calidifontis JCM 11548
OC   Archaea; Crenarchaeota; Thermoprotei; Thermoproteales; Thermoproteaceae;
OC   Pyrobaculum.
XX
RN   [1]
RP   1-2009313
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Cozen A.E.,
RA   Fitz-Gibbon S.T., House C.H., Saltikov C., Lowe T.M., Richardson P.;
RT   "Complete sequence of Pyrobaculum calidifontis JCM 11548";
RL   Unpublished.
XX
RN   [2]
RP   1-2009313
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Cozen A.E.,
RA   Fitz-Gibbon S.T., House C.H., Saltikov C., Lowe T.M., Richardson P.;
RT   ;
RL   Submitted (07-FEB-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; d47e41fbc8a86b14f0e6eaa771e321b8.
DR   BioSample; SAMN00623060.
DR   EnsemblGenomes-Gn; EBG00001147904.
DR   EnsemblGenomes-Gn; EBG00001147905.
DR   EnsemblGenomes-Gn; EBG00001147906.
DR   EnsemblGenomes-Gn; EBG00001147907.
DR   EnsemblGenomes-Gn; EBG00001147908.
DR   EnsemblGenomes-Gn; EBG00001147909.
DR   EnsemblGenomes-Gn; EBG00001147910.
DR   EnsemblGenomes-Gn; EBG00001147911.
DR   EnsemblGenomes-Gn; EBG00001147912.
DR   EnsemblGenomes-Gn; EBG00001147913.
DR   EnsemblGenomes-Gn; EBG00001147914.
DR   EnsemblGenomes-Gn; EBG00001147915.
DR   EnsemblGenomes-Gn; EBG00001147916.
DR   EnsemblGenomes-Gn; EBG00001147917.
DR   EnsemblGenomes-Gn; EBG00001147918.
DR   EnsemblGenomes-Gn; EBG00001147919.
DR   EnsemblGenomes-Gn; EBG00001147920.
DR   EnsemblGenomes-Gn; EBG00001147921.
DR   EnsemblGenomes-Gn; EBG00001147922.
DR   EnsemblGenomes-Gn; EBG00001147923.
DR   EnsemblGenomes-Gn; EBG00001147924.
DR   EnsemblGenomes-Gn; EBG00001147925.
DR   EnsemblGenomes-Gn; EBG00001147926.
DR   EnsemblGenomes-Gn; EBG00001147927.
DR   EnsemblGenomes-Gn; EBG00001147928.
DR   EnsemblGenomes-Gn; EBG00001147929.
DR   EnsemblGenomes-Gn; EBG00001147930.
DR   EnsemblGenomes-Gn; EBG00001147931.
DR   EnsemblGenomes-Gn; EBG00001147932.
DR   EnsemblGenomes-Gn; EBG00001147933.
DR   EnsemblGenomes-Gn; EBG00001147934.
DR   EnsemblGenomes-Gn; EBG00001147935.
DR   EnsemblGenomes-Gn; EBG00001147936.
DR   EnsemblGenomes-Gn; EBG00001147937.
DR   EnsemblGenomes-Gn; EBG00001147938.
DR   EnsemblGenomes-Gn; EBG00001147939.
DR   EnsemblGenomes-Gn; EBG00001147940.
DR   EnsemblGenomes-Gn; EBG00001147941.
DR   EnsemblGenomes-Gn; EBG00001147942.
DR   EnsemblGenomes-Gn; EBG00001147943.
DR   EnsemblGenomes-Gn; EBG00001147944.
DR   EnsemblGenomes-Gn; EBG00001147945.
DR   EnsemblGenomes-Gn; EBG00001147946.
DR   EnsemblGenomes-Gn; EBG00001147947.
DR   EnsemblGenomes-Gn; EBG00001147948.
DR   EnsemblGenomes-Gn; EBG00001147949.
DR   EnsemblGenomes-Gn; EBG00001147950.
DR   EnsemblGenomes-Gn; EBG00001147951.
DR   EnsemblGenomes-Gn; EBG00001147952.
DR   EnsemblGenomes-Gn; EBG00001147953.
DR   EnsemblGenomes-Gn; EBG00001147954.
DR   EnsemblGenomes-Gn; EBG00001147955.
DR   EnsemblGenomes-Gn; EBG00001147956.
DR   EnsemblGenomes-Gn; EBG00001147957.
DR   EnsemblGenomes-Gn; EBG00001147958.
DR   EnsemblGenomes-Gn; EBG00001147960.
DR   EnsemblGenomes-Gn; EBG00001147961.
DR   EnsemblGenomes-Gn; EBG00001147962.
DR   EnsemblGenomes-Gn; EBG00001147963.
DR   EnsemblGenomes-Gn; EBG00001147964.
DR   EnsemblGenomes-Gn; EBG00001147965.
DR   EnsemblGenomes-Gn; EBG00001147966.
DR   EnsemblGenomes-Gn; EBG00001147967.
DR   EnsemblGenomes-Gn; EBG00001147968.
DR   EnsemblGenomes-Gn; EBG00001147969.
DR   EnsemblGenomes-Gn; EBG00001147970.
DR   EnsemblGenomes-Gn; EBG00001147971.
DR   EnsemblGenomes-Gn; EBG00001147972.
DR   EnsemblGenomes-Gn; EBG00001147973.
DR   EnsemblGenomes-Gn; EBG00001147974.
DR   EnsemblGenomes-Gn; EBG00001147975.
DR   EnsemblGenomes-Gn; EBG00001147976.
DR   EnsemblGenomes-Gn; EBG00001147977.
DR   EnsemblGenomes-Gn; EBG00001147978.
DR   EnsemblGenomes-Gn; EBG00001147979.
DR   EnsemblGenomes-Gn; EBG00001147980.
DR   EnsemblGenomes-Gn; EBG00001147981.
DR   EnsemblGenomes-Gn; EBG00001147982.
DR   EnsemblGenomes-Gn; EBG00001147983.
DR   EnsemblGenomes-Gn; EBG00001147984.
DR   EnsemblGenomes-Gn; EBG00001147985.
DR   EnsemblGenomes-Gn; EBG00001147986.
DR   EnsemblGenomes-Gn; EBG00001147987.
DR   EnsemblGenomes-Gn; EBG00001147988.
DR   EnsemblGenomes-Gn; EBG00001147989.
DR   EnsemblGenomes-Gn; EBG00001147990.
DR   EnsemblGenomes-Gn; EBG00001147991.
DR   EnsemblGenomes-Gn; EBG00001147992.
DR   EnsemblGenomes-Gn; EBG00001147993.
DR   EnsemblGenomes-Gn; EBG00001147994.
DR   EnsemblGenomes-Gn; EBG00001147995.
DR   EnsemblGenomes-Gn; EBG00001147996.
DR   EnsemblGenomes-Gn; EBG00001147997.
DR   EnsemblGenomes-Gn; EBG00001147998.
DR   EnsemblGenomes-Gn; EBG00001147999.
DR   EnsemblGenomes-Gn; EBG00001148000.
DR   EnsemblGenomes-Gn; EBG00001148001.
DR   EnsemblGenomes-Gn; EBG00001148002.
DR   EnsemblGenomes-Gn; EBG00001148003.
DR   EnsemblGenomes-Gn; EBG00001148004.
DR   EnsemblGenomes-Gn; EBG00001148005.
DR   EnsemblGenomes-Gn; EBG00001148006.
DR   EnsemblGenomes-Gn; EBG00001148007.
DR   EnsemblGenomes-Gn; EBG00001148008.
DR   EnsemblGenomes-Gn; EBG00001148009.
DR   EnsemblGenomes-Gn; EBG00001148010.
DR   EnsemblGenomes-Gn; EBG00001148011.
DR   EnsemblGenomes-Gn; EBG00001148012.
DR   EnsemblGenomes-Gn; EBG00001148013.
DR   EnsemblGenomes-Gn; EBG00001148014.
DR   EnsemblGenomes-Gn; EBG00001148015.
DR   EnsemblGenomes-Gn; EBG00001148016.
DR   EnsemblGenomes-Gn; Pcal_R0002.
DR   EnsemblGenomes-Gn; Pcal_R0003.
DR   EnsemblGenomes-Gn; Pcal_R0004.
DR   EnsemblGenomes-Gn; Pcal_R0005.
DR   EnsemblGenomes-Gn; Pcal_R0006.
DR   EnsemblGenomes-Gn; Pcal_R0007.
DR   EnsemblGenomes-Gn; Pcal_R0008.
DR   EnsemblGenomes-Gn; Pcal_R0009.
DR   EnsemblGenomes-Gn; Pcal_R0010.
DR   EnsemblGenomes-Gn; Pcal_R0011.
DR   EnsemblGenomes-Gn; Pcal_R0012.
DR   EnsemblGenomes-Gn; Pcal_R0013.
DR   EnsemblGenomes-Gn; Pcal_R0014.
DR   EnsemblGenomes-Gn; Pcal_R0015.
DR   EnsemblGenomes-Gn; Pcal_R0016.
DR   EnsemblGenomes-Gn; Pcal_R0017.
DR   EnsemblGenomes-Gn; Pcal_R0018.
DR   EnsemblGenomes-Gn; Pcal_R0019.
DR   EnsemblGenomes-Gn; Pcal_R0020.
DR   EnsemblGenomes-Gn; Pcal_R0021.
DR   EnsemblGenomes-Gn; Pcal_R0022.
DR   EnsemblGenomes-Gn; Pcal_R0023.
DR   EnsemblGenomes-Gn; Pcal_R0024.
DR   EnsemblGenomes-Gn; Pcal_R0025.
DR   EnsemblGenomes-Gn; Pcal_R0026.
DR   EnsemblGenomes-Gn; Pcal_R0027.
DR   EnsemblGenomes-Tr; EBT00001564167.
DR   EnsemblGenomes-Tr; EBT00001564168.
DR   EnsemblGenomes-Tr; EBT00001564169.
DR   EnsemblGenomes-Tr; EBT00001564170.
DR   EnsemblGenomes-Tr; EBT00001564171.
DR   EnsemblGenomes-Tr; EBT00001564172.
DR   EnsemblGenomes-Tr; EBT00001564173.
DR   EnsemblGenomes-Tr; EBT00001564174.
DR   EnsemblGenomes-Tr; EBT00001564175.
DR   EnsemblGenomes-Tr; EBT00001564176.
DR   EnsemblGenomes-Tr; EBT00001564177.
DR   EnsemblGenomes-Tr; EBT00001564178.
DR   EnsemblGenomes-Tr; EBT00001564179.
DR   EnsemblGenomes-Tr; EBT00001564180.
DR   EnsemblGenomes-Tr; EBT00001564181.
DR   EnsemblGenomes-Tr; EBT00001564182.
DR   EnsemblGenomes-Tr; EBT00001564183.
DR   EnsemblGenomes-Tr; EBT00001564184.
DR   EnsemblGenomes-Tr; EBT00001564185.
DR   EnsemblGenomes-Tr; EBT00001564186.
DR   EnsemblGenomes-Tr; EBT00001564187.
DR   EnsemblGenomes-Tr; EBT00001564188.
DR   EnsemblGenomes-Tr; EBT00001564189.
DR   EnsemblGenomes-Tr; EBT00001564190.
DR   EnsemblGenomes-Tr; EBT00001564191.
DR   EnsemblGenomes-Tr; EBT00001564192.
DR   EnsemblGenomes-Tr; EBT00001564193.
DR   EnsemblGenomes-Tr; EBT00001564194.
DR   EnsemblGenomes-Tr; EBT00001564195.
DR   EnsemblGenomes-Tr; EBT00001564196.
DR   EnsemblGenomes-Tr; EBT00001564197.
DR   EnsemblGenomes-Tr; EBT00001564198.
DR   EnsemblGenomes-Tr; EBT00001564199.
DR   EnsemblGenomes-Tr; EBT00001564200.
DR   EnsemblGenomes-Tr; EBT00001564201.
DR   EnsemblGenomes-Tr; EBT00001564202.
DR   EnsemblGenomes-Tr; EBT00001564203.
DR   EnsemblGenomes-Tr; EBT00001564204.
DR   EnsemblGenomes-Tr; EBT00001564205.
DR   EnsemblGenomes-Tr; EBT00001564206.
DR   EnsemblGenomes-Tr; EBT00001564207.
DR   EnsemblGenomes-Tr; EBT00001564208.
DR   EnsemblGenomes-Tr; EBT00001564209.
DR   EnsemblGenomes-Tr; EBT00001564210.
DR   EnsemblGenomes-Tr; EBT00001564211.
DR   EnsemblGenomes-Tr; EBT00001564212.
DR   EnsemblGenomes-Tr; EBT00001564213.
DR   EnsemblGenomes-Tr; EBT00001564214.
DR   EnsemblGenomes-Tr; EBT00001564215.
DR   EnsemblGenomes-Tr; EBT00001564216.
DR   EnsemblGenomes-Tr; EBT00001564217.
DR   EnsemblGenomes-Tr; EBT00001564218.
DR   EnsemblGenomes-Tr; EBT00001564219.
DR   EnsemblGenomes-Tr; EBT00001564220.
DR   EnsemblGenomes-Tr; EBT00001564221.
DR   EnsemblGenomes-Tr; EBT00001564222.
DR   EnsemblGenomes-Tr; EBT00001564223.
DR   EnsemblGenomes-Tr; EBT00001564224.
DR   EnsemblGenomes-Tr; EBT00001564225.
DR   EnsemblGenomes-Tr; EBT00001564226.
DR   EnsemblGenomes-Tr; EBT00001564227.
DR   EnsemblGenomes-Tr; EBT00001564228.
DR   EnsemblGenomes-Tr; EBT00001564229.
DR   EnsemblGenomes-Tr; EBT00001564230.
DR   EnsemblGenomes-Tr; EBT00001564231.
DR   EnsemblGenomes-Tr; EBT00001564232.
DR   EnsemblGenomes-Tr; EBT00001564234.
DR   EnsemblGenomes-Tr; EBT00001564235.
DR   EnsemblGenomes-Tr; EBT00001564236.
DR   EnsemblGenomes-Tr; EBT00001564237.
DR   EnsemblGenomes-Tr; EBT00001564238.
DR   EnsemblGenomes-Tr; EBT00001564239.
DR   EnsemblGenomes-Tr; EBT00001564240.
DR   EnsemblGenomes-Tr; EBT00001564241.
DR   EnsemblGenomes-Tr; EBT00001564242.
DR   EnsemblGenomes-Tr; EBT00001564243.
DR   EnsemblGenomes-Tr; EBT00001564244.
DR   EnsemblGenomes-Tr; EBT00001564245.
DR   EnsemblGenomes-Tr; EBT00001564246.
DR   EnsemblGenomes-Tr; EBT00001564247.
DR   EnsemblGenomes-Tr; EBT00001564248.
DR   EnsemblGenomes-Tr; EBT00001564249.
DR   EnsemblGenomes-Tr; EBT00001564250.
DR   EnsemblGenomes-Tr; EBT00001564251.
DR   EnsemblGenomes-Tr; EBT00001564252.
DR   EnsemblGenomes-Tr; EBT00001564253.
DR   EnsemblGenomes-Tr; EBT00001564254.
DR   EnsemblGenomes-Tr; EBT00001564255.
DR   EnsemblGenomes-Tr; EBT00001564256.
DR   EnsemblGenomes-Tr; EBT00001564257.
DR   EnsemblGenomes-Tr; EBT00001564258.
DR   EnsemblGenomes-Tr; EBT00001564259.
DR   EnsemblGenomes-Tr; EBT00001564260.
DR   EnsemblGenomes-Tr; EBT00001564261.
DR   EnsemblGenomes-Tr; EBT00001564262.
DR   EnsemblGenomes-Tr; EBT00001564263.
DR   EnsemblGenomes-Tr; EBT00001564264.
DR   EnsemblGenomes-Tr; EBT00001564265.
DR   EnsemblGenomes-Tr; EBT00001564266.
DR   EnsemblGenomes-Tr; EBT00001564267.
DR   EnsemblGenomes-Tr; EBT00001564268.
DR   EnsemblGenomes-Tr; EBT00001564269.
DR   EnsemblGenomes-Tr; EBT00001564270.
DR   EnsemblGenomes-Tr; EBT00001564271.
DR   EnsemblGenomes-Tr; EBT00001564272.
DR   EnsemblGenomes-Tr; EBT00001564273.
DR   EnsemblGenomes-Tr; EBT00001564274.
DR   EnsemblGenomes-Tr; EBT00001564275.
DR   EnsemblGenomes-Tr; EBT00001564276.
DR   EnsemblGenomes-Tr; EBT00001564277.
DR   EnsemblGenomes-Tr; EBT00001564278.
DR   EnsemblGenomes-Tr; EBT00001564279.
DR   EnsemblGenomes-Tr; Pcal_R0002-1.
DR   EnsemblGenomes-Tr; Pcal_R0003-1.
DR   EnsemblGenomes-Tr; Pcal_R0004-1.
DR   EnsemblGenomes-Tr; Pcal_R0005-1.
DR   EnsemblGenomes-Tr; Pcal_R0006-1.
DR   EnsemblGenomes-Tr; Pcal_R0007-1.
DR   EnsemblGenomes-Tr; Pcal_R0008-1.
DR   EnsemblGenomes-Tr; Pcal_R0009-1.
DR   EnsemblGenomes-Tr; Pcal_R0010-1.
DR   EnsemblGenomes-Tr; Pcal_R0011-1.
DR   EnsemblGenomes-Tr; Pcal_R0012-1.
DR   EnsemblGenomes-Tr; Pcal_R0013-1.
DR   EnsemblGenomes-Tr; Pcal_R0014-1.
DR   EnsemblGenomes-Tr; Pcal_R0015-1.
DR   EnsemblGenomes-Tr; Pcal_R0016-1.
DR   EnsemblGenomes-Tr; Pcal_R0017-1.
DR   EnsemblGenomes-Tr; Pcal_R0018-1.
DR   EnsemblGenomes-Tr; Pcal_R0019-1.
DR   EnsemblGenomes-Tr; Pcal_R0020-1.
DR   EnsemblGenomes-Tr; Pcal_R0021-1.
DR   EnsemblGenomes-Tr; Pcal_R0022-1.
DR   EnsemblGenomes-Tr; Pcal_R0023-1.
DR   EnsemblGenomes-Tr; Pcal_R0024-1.
DR   EnsemblGenomes-Tr; Pcal_R0025-1.
DR   EnsemblGenomes-Tr; Pcal_R0026-1.
DR   EnsemblGenomes-Tr; Pcal_R0027-1.
DR   EuropePMC; PMC1974822; 17635535.
DR   EuropePMC; PMC2222616; 18042280.
DR   EuropePMC; PMC2223247; 18039820.
DR   EuropePMC; PMC3916527; 24347172.
DR   EuropePMC; PMC6009581; 29771354.
DR   EuropePMC; PMC6060358; 29866806.
DR   GOA; P0DOY4.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00062; HgcC.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01354; CRISPR-DR45.
DR   RFAM; RF01722; Pyrobac-1.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000561.
DR   SILVA-SSU; CP000561.
DR   StrainInfo; 556407; 1.
DR   UniProtKB/Swiss-Prot; P0DOY4; RKD3_PYRCJ.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002680
CC   Source DNA and archaea available from Todd M. Lowe
CC   (lowe@soe.ucsc.edu)
CC   Contacts: Todd M. Lowe (lowe@soe.ucsc.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Additional Note: The following regions have unresolved homopolymer
CC   regions: 1730980-1730996, 382652-383661, 836734-836747,
CC   1722385-1772398.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2009313
FT                   /organism="Pyrobaculum calidifontis JCM 11548"
FT                   /strain="JCM 11548"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:410359"
FT   gene            9..308
FT                   /locus_tag="Pcal_0001"
FT   CDS_pept        9..308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0001"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0736 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07441"
FT                   /db_xref="InterPro:IPR021540"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS24"
FT                   /protein_id="ABO07441.1"
FT                   /translation="MGVAHVLVITVPKKERIVARDLCDCLYYYDQAVECRVLSPSRVYI
FT                   RTSIDYLHECLKLKYFEKLIKNIEIFDFVSTSKPSCTECRVIQIGDLYFVKSRV"
FT   gene            379..1551
FT                   /locus_tag="Pcal_0002"
FT   CDS_pept        379..1551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0002"
FT                   /product="cell division control protein 6"
FT                   /note="KEGG: pai:PAE0737 cell division control protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07442"
FT                   /db_xref="GOA:A3MS25"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS25"
FT                   /protein_id="ABO07442.1"
FT                   /translation="MHMVIIDEAVFSPSYVPERLPHREEQIQQLDALFGGWLRNPGRHY
FT                   PRVVLLGRPGTGKTATLRRFWSTIKNETNVKFVHINCFIYRNFSTIIGEIAKSLNIPFP
FT                   RRGLSKDEFLSLLIEHLRERDLYIFLALDDAFNLSADVLSTFIRLGQESDRLGAFRIAL
FT                   AVVGHSDSMINNLDPSTRGIMGKFVIRFPPYTRDQIFDIILERAQMGLAPGAYSDEVLQ
FT                   MIADLTGAQSPLDSSKGDARLAIDILYRSAYIAQQSGRRQITPEDVRRATKEVLFGVSE
FT                   EVLRGLSLHEKLFLLAIVRALKSTNSPYVTFGDVEDMYKMICEEFDEKPRVHTQLWTYL
FT                   SDLRDKGIVETRLNKRGEGVRGRTTLISIGSEPLDTLEAVVTKLIREELQ"
FT   gene            1548..1835
FT                   /locus_tag="Pcal_0003"
FT   CDS_pept        1548..1835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0003"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein, ArsR; KEGG: pai:PAE0738
FT                   transcriptional regulatory protein (helix-turn-helix),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07443"
FT                   /db_xref="GOA:A3MS26"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS26"
FT                   /protein_id="ABO07443.1"
FT                   /translation="MIEIVLGSGLRVRVILALWKYGELHTTELAHRLGTNYRLLMRHIG
FT                   VLSRYGIVEERRIGRLRLVKLSNKTHVIELAKALAKMEEYLEATYKDTTL"
FT   gene            complement(1830..3095)
FT                   /locus_tag="Pcal_0004"
FT   CDS_pept        complement(1830..3095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0004"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; KEGG: pai:PAE0735 replication factor C large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07444"
FT                   /db_xref="GOA:A3MS27"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR023935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MS27"
FT                   /protein_id="ABO07444.1"
FT                   /translation="MPIPWVEKYRPKSFSEIVNQEEAKQILASWICTRFKAPQEFCARW
FT                   AKRRDKEIKEARAVLLWGPPGIGKTTLVHALAKEIGYELVELNASDVRTGERIRQVVGR
FT                   GLREASLFGYAGKIVLFDEVDGLHVKEDLGGLEAILNLIETAKVPIVLTANNPFDPKLR
FT                   PLRDISLVVGLKRLSEDEVVEVLKRICASEGAKCEEEALRSLAKSSYGDLRAAINDLQL
FT                   YLAGRKVLTVDDIKRAGERNPQLSMFEILDRVYKARWFDEARAVSFNPSFDWEQYFVWA
FT                   LETIPIVYKDLEVMSEAFDRLSKADMFIGIVKRTQEWELLSYAMELALGGVSQVKNKPR
FT                   LPPFIRYGFPQRLLLLAKSKEARRRREMVVEYLARNLHVSKGLVNAEIFYVLSALAKKD
FT                   DHVVERLARALGISPIDIKNLL"
FT   gene            complement(3095..4075)
FT                   /locus_tag="Pcal_0005"
FT   CDS_pept        complement(3095..4075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0005"
FT                   /product="Replication factor C"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5;
FT                   Replication factor C; SMART: AAA ATPase; KEGG: pai:PAE0734
FT                   replication factor C small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07445"
FT                   /db_xref="GOA:A3MS28"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR023748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MS28"
FT                   /protein_id="ABO07445.1"
FT                   /translation="MSELFWFEKYRPRSFEEVVDLEEVKARLREFVKAGNLPHLLFYGP
FT                   PGTGKTTMALVLARELYGEYWRENTLELNASDERGIGVIRERVKEFARTAPVGKAPFKL
FT                   VILDEADNMTSDAQQALRRIMEIYAQNTRFILLANYVSRIIDPIISRCAVFRFSPMPRH
FT                   LMAERLREIARSEGVELKDDAIDLIYEISEGDMRKAINLLQVAAAVSKVVDANAVASAA
FT                   AAVRPSDVLELFNLAMGGDLAKARDKLRELMYIKGVAGVDLIRVFQRELIRMQLDDDVK
FT                   AEVAELLSEVDYRLTQGADEEIQLMYFLMKLGSIGKKIRVAPKKR"
FT   gene            complement(4106..4777)
FT                   /locus_tag="Pcal_0006"
FT   CDS_pept        complement(4106..4777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0006"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: pai:PAE0733
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07446"
FT                   /db_xref="GOA:A3MS29"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR026018"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS29"
FT                   /protein_id="ABO07446.1"
FT                   /translation="MASIFGEQLPKTSRVEYIGDVPIIEECPRELKTLDGNPILLFGKW
FT                   SFEDVVVRDPGLRRYICLKPVVLPHTEGRYQKRRFGKAHIPIVERLVNLLMRPGRNTGK
FT                   KHKAYNIVKRAFEIIYYKTGRNPIQVFIDAIINTAPREEITRIIMGGIAYSVSVDVSPQ
FT                   RRLDLSLRWITEGARQCSFNNPKPIEECLADEIMAAAANDPKSYAVRKREELERIAAAS
FT                   R"
FT   gene            complement(4799..5014)
FT                   /locus_tag="Pcal_0007"
FT   CDS_pept        complement(4799..5014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07447"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS30"
FT                   /protein_id="ABO07447.1"
FT                   /translation="MKGLCVVAWGNSRYVVDCSPSFLLSLATKIAEAESASYIDVYRRI
FT                   LHSLNAEYDKARIAVEDILSEKVENI"
FT   gene            complement(5083..5307)
FT                   /locus_tag="Pcal_0008"
FT   CDS_pept        complement(5083..5307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0008"
FT                   /product="regulatory protein, Crp"
FT                   /note="PFAM: regulatory protein, Crp; KEGG: pai:PAE0731
FT                   transcriptional regulatory protein, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07448"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS31"
FT                   /protein_id="ABO07448.1"
FT                   /translation="MRSGSDVRAIAEAIIRLLQERGELSSADIARILGIKRHTVTAVLT
FT                   RLRKEGVVEYIGQCYGGRRCNTKWKLRIN"
FT   gene            complement(5329..5727)
FT                   /locus_tag="Pcal_0009"
FT   CDS_pept        complement(5329..5727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07449"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS32"
FT                   /protein_id="ABO07449.1"
FT                   /translation="MAEELSLYIRKGGLVIKKEIIKSGGKVAGEYLYVRHGLFEAEAEY
FT                   DVEDGVLYYLQICWFKRCFIWYDGEPDAAPPMQLLKKTIAVFKELSGFSNVAAVVVKTI
FT                   ASYIRRSSRLRSSDPAHLGSCGAGFKKI"
FT   gene            complement(5845..6618)
FT                   /locus_tag="Pcal_0010"
FT   CDS_pept        complement(5845..6618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0010"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="PFAM: KaiC domain protein; KEGG: pai:PAE0729
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07450"
FT                   /db_xref="GOA:A3MS33"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS33"
FT                   /protein_id="ABO07450.1"
FT                   /translation="MEGHLYYETVPTGIEGLDTVLGGGFIRGRTYLISGETGTAKTLTA
FT                   LTFLIQGALKYGEPGIYISVDETYEQFVEGARRFGWDIEELRAKGLLEVLVPEMDIVER
FT                   IREKDPTAIAKSLVASIRDYVAALGAQRLVIDPIAPLVSLDKDVQVLREYIRVLVMSIE
FT                   REIATTNIITTEIPSGSGAISRYGVEEFLATGVFIMGIAKTRDGAFKRVMFIRKMRWSP
FT                   VHPGIYEVEIVPKVGVVVKGQVREPMVPVTYLPTI"
FT   gene            complement(6661..7044)
FT                   /locus_tag="Pcal_0011"
FT   CDS_pept        complement(6661..7044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0011"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /note="TIGRFAM: cytidine deaminase; PFAM: CMP/dCMP
FT                   deaminase, zinc-binding; KEGG: pai:PAE0794 cytidine
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07451"
FT                   /db_xref="GOA:A3MS34"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS34"
FT                   /protein_id="ABO07451.1"
FT                   /translation="MDELVEAAKAVLNNAYAPYSKFKVAAAVKTRSGKVYTGVNVENAS
FT                   YGLTVCAERVAIFKAVSEGDRDIEVVAVYVDADEPVAPCGACRQVIAEFNPNALVVMAS
FT                   RNKVKTARLSELLPMAFTGERLR"
FT   gene            7057..8004
FT                   /locus_tag="Pcal_0012"
FT   CDS_pept        7057..8004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07452"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS35"
FT                   /protein_id="ABO07452.1"
FT                   /translation="MELNKPVATAEEIRGRIVKHGASIRDTVVETLPHTYSMMVEQIRS
FT                   IASTYKNDLDTFIANISNIKNLDLLIIYIISLSILNKYKNLTAAELSTFSNAYERYVYD
FT                   VFSASKLRRALEEVVDREVANEVVSGTIRAINIILNKYKSLNLWIIKQKKILNFEKDIR
FT                   KIIFRDEGGNRVGRGVKLFLRTFIHETNIPLAIRIAYTQEHRKYLLHGDIYTTLVTIRS
FT                   GAFEDVKSITAERVKARIAKRILCQERGGKCNDVVLRLGSIRGLVRYVGKVSGDPVLFE
FT                   RGAYDIGIKYCKELKCDICPIRDVCKRYTFVRVK"
FT   gene            8023..8805
FT                   /locus_tag="Pcal_0013"
FT   CDS_pept        8023..8805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0013"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   pai:PAE0797 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07453"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS36"
FT                   /protein_id="ABO07453.1"
FT                   /translation="MLLKGKVSIVTAASRGIGAGVASVLAREGSDLVIASRDKARLEDL
FT                   AKRLSSQYGVTVVPVKADLTVREEVRRISVEALRNFGKIDVLVYNTGPPKPGTFLELSE
FT                   EDWEYGVRLLLMSAIWLTRDVVPHMIQRGGGRLIYITSSTLKHPIPTLTLSNVIRISLA
FT                   GLVKTLAYQLGQYNILVNGIMQGYIDTERVREVASTRAQREGRSVEDVLREIAAEIPLG
FT                   RLGKPEEIGELVAFLASDKASYISGSLILIDGGRTLCI"
FT   sig_peptide     8023..8103
FT                   /locus_tag="Pcal_0013"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.873) with cleavage site probability 0.826 at
FT                   residue 27"
FT   gene            complement(8802..10094)
FT                   /locus_tag="Pcal_0014"
FT   CDS_pept        complement(8802..10094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0014"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   pai:PAE0798 serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07454"
FT                   /db_xref="GOA:A3MS37"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MS37"
FT                   /protein_id="ABO07454.1"
FT                   /translation="MIPREIKEVLDVVLRHNRWRRWETINLIASENVMSPLAEIFYIND
FT                   FGGRYAEGTIGSRYYQGTKYVDVVEEALVKEFAEVLGAKFVDVRPISGTVANLATYFAL
FT                   VPEGGSVASLPIRCGGHISHSNVGGLKALRIKTVELPWDLENFNVDVDAARKVLEDKRP
FT                   NLVILGGSLYLFPHPIKEVAEIAKGIGAYVLHDSAHVLGLIVGGVFPNPLREGADVITS
FT                   STHKTFPGPQGGLIATNLGDDANGQIQKAVFPTFTSNYHLHRYVATYITLVEMKLFGHE
FT                   YASRVVENAKALAEALAEEGVTPVAERLGFTKTHQVAVDVSKYGGGDKVAALLEEANII
FT                   VNKNALPWDRSVVKPSGIRIGVQEMTRFGMGKDEMREIAKFIARVLRGEDPASVRRDVV
FT                   DFRRGFVEVKYGFKASREVIEEVFASLNLLA"
FT   gene            complement(10125..10853)
FT                   /locus_tag="Pcal_0015"
FT   CDS_pept        complement(10125..10853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0015"
FT                   /product="molybdenum cofactor biosynthesis protein (moaC)"
FT                   /note="KEGG: pai:PAE0799 molybdenum cofactor biosynthesis
FT                   protein (moaC)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07455"
FT                   /db_xref="GOA:A3MS38"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS38"
FT                   /protein_id="ABO07455.1"
FT                   /translation="MIVDVSKKLDVYRYAKASVELGLSRCNTVVAAKGAAEAYRHLPFL
FT                   HPVPLRAGATCRGGRLYVEGVAEWQTGVEMDVLFGALVGAVASGAVEMRNMLVEAKVKG
FT                   SPVEIQGELQEAPFERRGDLSARAFGRLMLKSLELVKRPVEKGHPLYAAQTAASLSSKR
FT                   FCEIVGGVCPKIQHYKIDIEVVDAVEVRVEVKARDVSPAPEALFSAGVALLTIWDMLKK
FT                   YEKDEAGQYPHTRITSISLD"
FT   gene            complement(10850..11146)
FT                   /locus_tag="Pcal_0016"
FT   CDS_pept        complement(10850..11146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07456"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS39"
FT                   /protein_id="ABO07456.1"
FT                   /translation="MLAPSGEFVCKKCGHRWPLPQADLTWAELEIKKAKLFEKYIDEPI
FT                   EECSELLSKLRQELDEKSARLLAGKILIQRAERRKLAPAELEKLYAEVEKCWG"
FT   gene            complement(11209..12267)
FT                   /locus_tag="Pcal_0017"
FT   CDS_pept        complement(11209..12267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0017"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 2"
FT                   /EC_number="5.3.3.2"
FT                   /note="KEGG: pai:PAE0801 isopentenyl-diphosphate
FT                   delta-isomerase; TIGRFAM: isopentenyl-diphosphate
FT                   delta-isomerase, type 2; PFAM: FMN-dependent alpha-hydroxy
FT                   acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07457"
FT                   /db_xref="GOA:A3MS40"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS40"
FT                   /protein_id="ABO07457.1"
FT                   /translation="MEKRKDDHIHLAYSDVSQVGSPWFDEVLLIHNALPELDLADVDLS
FT                   ADFLGAKVSAPFGIGAMTGGTELAGKINAELAKAAEEFGIPMYVGSQRVALQNPSVRWT
FT                   FEVVKQHAPTIPKVANLGAPQLSALPEEKVVEWVVEAVEMIDAYAVAIHLNAAQEVVQP
FT                   EGEPRFRGVLEKIKLVKRAVGKPVIVKEVGNGISKEVAERLAGVVDAIDVGGLGGTSFV
FT                   SIEGARALGAGLELYRRISEVFKTWGIPTAASICEVRSVFGGYVIASGGVRSGLDGARA
FT                   LALGANFFTMSQPLLRAVLDGRIREEISAVLTELKVAMFLVGARRVSDLAKVPRVYGPR
FT                   LREWIEQRGLRC"
FT   gene            complement(12267..13001)
FT                   /locus_tag="Pcal_0018"
FT   CDS_pept        complement(12267..13001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0018"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: pai:PAE0803
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07458"
FT                   /db_xref="GOA:A3MS41"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR023672"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MS41"
FT                   /protein_id="ABO07458.1"
FT                   /translation="MGKRILVQRRGRGGSQFRSPSWKRDGPVRYPPNISGRGIVVEILH
FT                   EPGLNAPVAKIRMENGVEFFNYAAEGLYVGQVIQVGPDAPPAVGNVLPLGKIPEGTMVF
FT                   NVEKRFGDGGKFARSGGTYALVIGQRPEENKTIVRLPSGRVIEVDARGRATIGIVAGGG
FT                   RVEKPFVKAGKKYHRARAKSWKYPTVRGKAMSPYAHPHGGGSHQKGGTPVPKTAPPGQK
FT                   VGFIGSRCTGRGCVRARAQQKQ"
FT   gene            13328..13543
FT                   /locus_tag="Pcal_0019"
FT   CDS_pept        13328..13543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0019"
FT                   /product="SSU ribosomal protein S17E"
FT                   /note="KEGG: pai:PAE0804 ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07459"
FT                   /db_xref="GOA:A3MS42"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="InterPro:IPR018273"
FT                   /db_xref="InterPro:IPR036401"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MS42"
FT                   /protein_id="ABO07459.1"
FT                   /translation="MGRVKPKFIKSLAEKLLEAYPDRFTESFKENKKAVAELADIPSKT
FT                   VRNKVAGYITRLVKRQKAKEKAEQAA"
FT   gene            13546..14235
FT                   /locus_tag="Pcal_0020"
FT   CDS_pept        13546..14235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0020"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase, FKBP-type; KEGG:
FT                   pai:PAE0805 FKBP-type peptidyl-prolyl cis-trans isomerases"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07460"
FT                   /db_xref="GOA:A3MS43"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR040825"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS43"
FT                   /protein_id="ABO07460.1"
FT                   /translation="MPLSKGDYILLDYTVVSKDDNKVVETTVEAVAKEAGIYRPENVYG
FT                   PRLIVLGETQLWEPVENALLSIDEGQDFEVEVPPEKAYGVRDPNKVKVVSIREFHRHGI
FT                   VPQVDDVVEYEGQRARVVSISGGRVVLDFNHPLAGKAFIVRGRVVKKLTTVEEKALALL
FT                   KLYLPRISEEKVKVAVEGDVITLQLPAEVLLYERIGGILLQYVSEVSTRFPEVRRVRFI
FT                   EEVEVRS"
FT   gene            14264..14869
FT                   /locus_tag="Pcal_0021"
FT   CDS_pept        14264..14869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0021"
FT                   /product="proteasome endopeptidase complex, beta component,
FT                   Threonine peptidase, MEROPS family T01A"
FT                   /EC_number="3.4.25.1"
FT                   /note="PFAM: 20S proteasome, A and B subunits; KEGG:
FT                   pai:PAE0807 proteasome beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07461"
FT                   /db_xref="GOA:A3MS44"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR019983"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MS44"
FT                   /protein_id="ABO07461.1"
FT                   /translation="MTTTVGIVAKDGVVLATDKRVTAGYYIAHKAGEKIWKIDDHVAAT
FT                   MSGGVADLQSVLSFLSLRAREYRVEHKRPIPIRALVNYVSLLLFYSRPYIYLVHSIVGG
FT                   VDAEEGPVLYMVDWLGTVTKEKYIATGSGSPYAKGALEVAYREDLTIDEAVELAIRAVK
FT                   AAIRNDPGSGEGIDVVTITKSDGFRRVFTTQQKIIIPE"
FT   gene            14872..16107
FT                   /locus_tag="Pcal_0022"
FT   CDS_pept        14872..16107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0022"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase; KEGG: pai:PAE0812 enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07462"
FT                   /db_xref="GOA:A3MS45"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS45"
FT                   /protein_id="ABO07462.1"
FT                   /translation="MEIKDVAIRKIFTGRGDLTVEVEVATEDFVAKAAAPAGASRGANE
FT                   VVYFPEEGIDAAIAAFERLVAPEVVGLDVSEPYVVDGKLEEVDGTARFERIGGAVAIAT
FT                   SFASAEAGAASLGLPLFSFIGGAYARRLPLPLGNVIGGGKHSRGLGPDIQEFLAIPLNP
FT                   PDIFTAIYTNVEIHKRALKGILKVDASFTGGKNDEGAWTPRISSRTALRILKETAEEVG
FT                   KEVGVEVGIGVDVAASSLWNGERYVYKNEGVERGPREQLEFIAKLIEEFDLVYVEDPFH
FT                   EEDFQSFAELTDRFRDRLIVGDDLFVTNPDRIRHGGRLKAATGVIIKPDQIGTLLRAHT
FT                   AVSTAREYGLKIVVSHRSGDTEYKTLAHVAVGFGAEVIKTGIMGGERTAKLNELIRIGE
FT                   YLGRWGNISRIR"
FT   gene            16157..16564
FT                   /locus_tag="Pcal_0023"
FT   CDS_pept        16157..16564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0023"
FT                   /product="putative transcriptional regulator, ModE family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: pai:PAE0813
FT                   molybdenum-pterin-binding protein, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07463"
FT                   /db_xref="GOA:A3MS46"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS46"
FT                   /protein_id="ABO07463.1"
FT                   /translation="MVVRIKSRIWVDKDGQELIGPGIYSILKAIEETGSIASAARKLGY
FT                   SYKFVWTYIKRLEDVLGVPLVESKRGGKERGVTELTEVGKILLNYYESMSREVEEVLKR
FT                   WEQKFSNLVETLQTAVAEVEKEEEIPYYEEE"
FT   gene            complement(16811..17740)
FT                   /locus_tag="Pcal_0024"
FT   CDS_pept        complement(16811..17740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0024"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /note="PFAM: Radical SAM domain protein; molybdenum
FT                   cofactor synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; KEGG: pai:PAE0814 molybdenum cofactor
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07464"
FT                   /db_xref="GOA:A3MS47"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013485"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS47"
FT                   /protein_id="ABO07464.1"
FT                   /translation="MLSDRVGRPFLKMRYVVDDECNYNCLFCHFEGQQRRQGSTLTAED
FT                   YEFASYVFSKLGVYDFKLTGGEPLLRRDIDKIVEAIARVAAVSITTNGLLLRRWVDRLY
FT                   KAGLRKINVSIHTADPEKYSKVVGAPTWAFKEVLRGLQESRNRGLAIKLNAVVLRGINT
FT                   DDKSVKELVKLAASLDASLQFIELMPSGSGLKVFGDYYEPIETIAEIVTRLGGRPLSLR
FT                   KELHNRPLYKLGGVTIELIKNYNNPTFCSGCTTMRLTSDGKLKTCIYAEPAVDLAPYIK
FT                   NRDVEGMVYAVKTALASREPRFHIYASK"
FT   gene            18142..19248
FT                   /locus_tag="Pcal_0025"
FT   CDS_pept        18142..19248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0025"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG: pai:PAE0815
FT                   serine/threonine protein kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07465"
FT                   /db_xref="GOA:A3MS48"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS48"
FT                   /protein_id="ABO07465.1"
FT                   /translation="MLSAYSFKPPRLKYAQVLAFPASALSSLLTLPESVVLGILVALLD
FT                   TPPYVAAALAAANAAYLYVVGDTALFLPPLLFTVAYVIAYKRVLFIAEKPPAGWLYSWL
FT                   GGRYKVVKLLGVGGFSYVLAVKRGGKIYAAKILRYTDDYGVPLAGDEKVLAFFGQEMNR
FT                   YLEIKSERIVKAYEVYLPAVGYKDLRHYMRDPPYILLEYMRGTLRDVLRIKKTLPVPQV
FT                   VEMFKQLAAGLYDIHRHNVVHLDIKPENIMFGEGGVVKIGDMGIAKVVAGGYVHSSYMS
FT                   PAYAAPELKRGVASFASDVYSLACVIYEALTGINPNVFVENGYPVPPPSSYNKEVPPWL
FT                   DELLLKMLAPDPARRPSAAEVLKALEGR"
FT   gene            19286..19735
FT                   /locus_tag="Pcal_0026"
FT   CDS_pept        19286..19735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0026"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG: pai:PAE0816
FT                   conserved protein with forkhead-associated (FHA) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07466"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS49"
FT                   /protein_id="ABO07466.1"
FT                   /translation="MPWRCPICGTENRDDALTCRVCGAYKPEATTKRMGQPPREEVSGV
FT                   VVIEVLESPVEPLVGKKFEFRVNSPGTIITVGRSVENQVVVPDPLVSRRHLRLIVTQNG
FT                   IVVEDLGSSNGTYLLTEGGERLVKVENVGKSAVLRIGRTKLRIVA"
FT   gene            19769..20395
FT                   /locus_tag="Pcal_0027"
FT   CDS_pept        19769..20395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0027"
FT                   /product="SSU ribosomal protein S2P"
FT                   /note="PFAM: ribosomal protein S2; KEGG: pai:PAE0817
FT                   ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07467"
FT                   /db_xref="GOA:A3MS50"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR023454"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MS50"
FT                   /protein_id="ABO07467.1"
FT                   /translation="MAEEAQYEYLVPLEKYLSAGVRLGTRLSNKYLEERGFIYAVRPDG
FT                   LRIFDIKKIDERLRIAAKLIARYPPDRVLVHTTRPYGFKPVQMFCKFVGCKALTGRFIP
FT                   GMLTNPNLSNYLEVDLLFVVDPRLDSQAVAEAAKMGIPVVALVDTDTPHQYIDFMIPCN
FT                   NKGRKSLALIFWVLARQVLRERGELKPDQDLPVPPEEFETRLVQT"
FT   gene            20428..21273
FT                   /locus_tag="Pcal_0028"
FT   CDS_pept        20428..21273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0028"
FT                   /product="protein of unknown function DUF52"
FT                   /note="PFAM: protein of unknown function DUF52; KEGG:
FT                   pai:PAE0818 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07468"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MS51"
FT                   /protein_id="ABO07468.1"
FT                   /translation="MRIRKPAVAGYFYESRADELQARIEWSIKHEIGPKAPVLPKLGTE
FT                   ALGGVVPHAGYMYSGPVAAWLYSALAGYGAPTTFVIIGPNHYGIGAPVAIMKSGAWETP
FT                   FGRVEIDEELASLIASNYREIEDDAHAFSKEHSIEVQLPFIQYYFKNVKFVPIAVWRQT
FT                   LSTSRELGKAIAKALREYKRRVYLLASSDFNHYEPHDVTVKKDDMAIGKILELDEAGLF
FT                   DVASRFDISICGIGPIASVIVAAKELGFSNAALLKHATSGDTSGYRDETVGYASILFYK
FT                   "
FT   gene            complement(21253..22623)
FT                   /locus_tag="Pcal_0029"
FT   CDS_pept        complement(21253..22623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0029"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: pyruvate kinase; KEGG: pai:PAE0819 pyruvate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07469"
FT                   /db_xref="GOA:A3MS52"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS52"
FT                   /protein_id="ABO07469.1"
FT                   /translation="MGKASAKPLTKRVLTLGPATDALSIGEVFRFLDLADGVRINLAHA
FT                   TPGEVEARVRTVRTYEAERGRPLALVVDLRGPSVRVGKTPPISVERGQEVVFKPGRESD
FT                   GSFIPVPELFFAVVEPGDVVLMLDGKLRMRVVSAGPGAARALAESSGVVESGKAVVIEG
FT                   KDFDLPSPTDDDIETLRGIAHLAREVDYVSVSLARGCGDVEKARAILRELGFESQVAVK
FT                   IETRRAVEALEELAQCGDYLVVARGDLGLHYGLESLPVVQRRVVYTALRLGKPVAVATQ
FT                   LLDSLQSYPTPTRAEVNDVFTTASMGVDSVWLTNETASGRYPIEAASWLTKILNAVEYH
FT                   VPQRPLPNGVRDRFAKALVELAEDLGADILIYSMSGALARRVAKFRPLQLVYVGTPSMK
FT                   TARALSVVWALEPHHIPAPSYEEGLAKLIAMRGKAPYVATYGIRGGEHVIKLFIEED"
FT   gene            complement(22625..24529)
FT                   /locus_tag="Pcal_0030"
FT   CDS_pept        complement(22625..24529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0030"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase; KEGG: pai:PAE0820
FT                   mRNA 3'-end processing factor, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07470"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019975"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR033769"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS53"
FT                   /protein_id="ABO07470.1"
FT                   /translation="MSYLEVESKVKSILSGVEVAKVSFEGPNLCIYVRRPLDVAFDLVG
FT                   EVAKALKKRVVLRADESSRLPEKRARQVISEVLDGVEEVVFEKSGDVYVYLSKPARGAE
FT                   LREAAREIFVKTGWRAVIESGVPRGGEKIPAHEVLAVRQIFHGAYEQRRELMERLARFI
FT                   HQEPVVKEGPITVTFLGGAMEVGRSAVLVSTGESNVLLDCGLKPVQDDEDFPLLDMLDL
FT                   DRLDAVVLTHAHMDHVGCLPLLYKYGYRGPVYATDPTKYQAYILLMDYVELKEREGGLP
FT                   SFSRADVEAVIYHTITLDYEEVTDITPDIKLTFYDAGHEIGSAMAHLHIGNGRYNILYT
FT                   GDFKYGKTRLLNRAVNKFKRVEMLIMESTYGGRDDVQPPRVEAENALAKHVAETVAKGG
FT                   KVLIPAFSTGRGQEILYILNKMMEGGLIPRVPIYVDGMIVETLNVYLMYPHYLNPEVAE
FT                   EIYSGVNPFTTSGAVVIVDRAKRVEDRINQVAKIAQSEEPAVIIAPHGMLNGGPILDYF
FT                   AQLAPDERNKLIFVSYQAEGTLGRRILNGEREFTVRSLTAGEIKVQMRMEAASIPGFSG
FT                   HSDRRELMKYVEHIEPKPKKIVLIHGEPSKIISLATSIELKYKITTVVPKVGERIRAL"
FT   gene            complement(24812..26233)
FT                   /locus_tag="Pcal_0031"
FT   CDS_pept        complement(24812..26233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0031"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: pai:PAE0821 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: cysteinyl-tRNA
FT                   synthetase, class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07471"
FT                   /db_xref="GOA:A3MS54"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MS54"
FT                   /protein_id="ABO07471.1"
FT                   /translation="MRIYNTATRQVEEFTTYTPGLARGYVCGITPYDHVHVGHGRVYVF
FT                   FDMFRRYLESLGYEVRLVVNFTDIDDKIIAKAREEFGPEAYKRWREVPERYIAEFFEVS
FT                   KRLFIKPAYAYPRVTENVDDMVKWISALVEKGFAYVAPDGSVYFEVGKVPNYGVLSRQR
FT                   IEELIAGARVEPEPGKRNPLDFALWKSWSPGEPWWNSPWCPGRPGWHLECVVMSTKHLG
FT                   VPFDFHGGGADLIFPHHENEIAIAKAYFGVDNFAKYWIHVGYLTVRGEKMSKSLGNVIT
FT                   LREVLSKYSGEALRLAYAMSHYRKPMEFSFELLDQAEDIVKTLYTAYDELSQAVADAGD
FT                   ADRERVDIGNFKAAFYSALEDDFSTPEAVQQLYAAAKYIISTVLHKVDKLSKNTVLAIL
FT                   ADYVKMADVIGVLERREVAKEVEEAVKALVEVRARLRSERLYQLADYVRERAKALGAEL
FT                   HDFGPRTYYTIRRRG"
FT   gene            complement(26406..29927)
FT                   /locus_tag="Pcal_0032"
FT   CDS_pept        complement(26406..29927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07472"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS55"
FT                   /protein_id="ABO07472.1"
FT                   /translation="MRVLLFALFLAVAVAALETEHFVITPDDPTLAKYLEDAYSFYVSK
FT                   GLSPAPPCQGDKYRVYYNQSLGDVSYTKLGGRCVLEVDFGRYTRRLVFHEVGHVFLANY
FT                   DPDIYDYFWAKEAAPEGMASVATGVYYFPAMYFSDKLYSVNPFSLGEDRVYDWYKYSAA
FT                   VAWHLQQASSWESVLKAFLTRSGAARLYVQFLLALAKSVELGGVRYEPERKAVTLSPGP
FT                   YYLYLDIPGYSAVYYEFTAPTGLVKISVDDPRVVSNLLLNREFEVRNGTLLAAFVNNYS
FT                   DTVHVAVTVFFTQLRTYLAGGRYEDGKISVNLCAELNGVKINGVVKVNGSEVRLADGCG
FT                   VYNFTGVLRPYTLAVEYGGYAAYVRLNLSPPALAASPSRLFLGAGGRGYVNVTLSNPNP
FT                   LSLVCFLNAAASGVQFNSSKVAVPPNSTTVFKLGFKVVDKVGGNATVSCGVANATVPIY
FT                   GLSYSLSYDLDSERGVLTAYFGSEQRSYSVGKLPTDVELVYGGYVAAVVHVEARLSVSV
FT                   SSPKLEGGLLRYVLSVAVVGPPWAKFSGAASVDGVTRGVYTGGVLNLTVALRPGERKRV
FT                   LVGVGRLAEWVSLEAPEVVVKVEPLGAVVEGGVARILVGLRYNVEVSSPPPPNFDGALS
FT                   VEPLQGGLAVVSYRYGENVTVVYEGRAAAAVYLPRPNVSLLLVEGTVRPNNFSAVFKAV
FT                   VSVCKPSVDARYVVEVGGRRLVVNVPRGGCGFNFTELTWHSAYGPVLNVSVPTSFGPAT
FT                   AHLYVPPPRVEARLLNWTIDKGGESAFVELRVETPGNYTYVVAGRGVRGSASFVVGVRP
FT                   SGGVATVDYGFGALSFTRPLAVVAAQPILAEVGSSAHMQIRVEVPQGLYIRGVLATPWL
FT                   SREVSLGPGVYTESVPVDTSGRPGAYEVEVKLGPYVNRTTVVLYKVELSLSAPRLLPVG
FT                   ATAEVQVVGRVEPAAPARVAVRVEGCGLSRADVVPLNATLRLSSNATCAARIAAASNST
FT                   SAEATVEWASLTAGLNYTRLGSLRGLPIFPVGGLLAVPLLGGRQVDGRVEVVGDFRRLG
FT                   LVNYTIRVTYMGVSNVTEFVGFAVPPDAYTAANRTYGLLPPEARPYYRYLLERAVATGD
FT                   WRLVEDLAKLYSEPPTPLTLAARALVEMSLASGREPNMGVVETLRKVEPLLLGVAGGFL
FT                   LALLRRL"
FT   sig_peptide     complement(29877..29927)
FT                   /locus_tag="Pcal_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.566 at
FT                   residue 17"
FT   gene            29959..31899
FT                   /locus_tag="Pcal_0033"
FT   CDS_pept        29959..31899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07473"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS56"
FT                   /protein_id="ABO07473.1"
FT                   /translation="MDTKPWLLLALAAALVVIFYLMNTSQTPTVPTPTPTTTATVTPSP
FT                   TTSTTLTATPTETPKPTATATTTTAPKPSAAPVYIPRLEVELSAPQAVNTTKLPTAVNY
FT                   TVTLRNVGNGTAVVYVFGKYVEVKPGEVVKLNATATAQAAGILKIAVEVNGTEYAREVY
FT                   IYYYTPILAAEPAYVEVRKLPTNVTLSVVVKNVGNWTGRLGPIEIPPGGTAAINITAAV
FT                   NATGTYSLQIGGVEVPITVVYKAPSFEIKTGGPTETEALPGEKYPAWLWIKNVGNATAK
FT                   LSIDGEERELGPGDAVNITKWIQVDKVGIYKAVFKVEGDLNTTAVHQLSAKIVAVKVEM
FT                   VLWKPELRRGWPPPNGEDRTSLLLESKTAEVQWGYIITSNASKRTVVVYVEDVQGRDYF
FT                   TIPPKGSVGRNLTATVQAPGSIAVWVIVNGTKYTYVISTQLVPPKVTIRDVSKIEFRDS
FT                   REILGLGIKCSGIPIVGTIQRTIDIVEVSGVLAYTTDGKTIEGTVKIRSVDVYTGSYRG
FT                   IITGTSGRVDIDVDFMGGHHVITTKFRTSPFEITEVLIDGVPGKCDIPTQLIPSIFLSG
FT                   KPAADNELATQYAFRLVSAFKKGDSDVPQRVEWNGEYVEVVDKGGNVLRVYFGQGEVVI
FT                   EGPLSARLVIS"
FT   sig_peptide     29959..30030
FT                   /locus_tag="Pcal_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.940) with cleavage site probability 0.406 at
FT                   residue 24"
FT   gene            31940..39925
FT                   /locus_tag="Pcal_0034"
FT   CDS_pept        31940..39925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07474"
FT                   /db_xref="GOA:A3MS57"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS57"
FT                   /protein_id="ABO07474.1"
FT                   /translation="MHNQVKLVLALLIITALGIMAYAQYGPGQALPSAFNVVMQINDAR
FT                   AAAALGYPLCAPWEKGLAHYPPYKFAAGKNFTLIIREVAQNPVYPPQFQDYRVSSVANE
FT                   TGFVTFNINVPAGVDVTKRSKWYVAIIVEWPRKGYYFFVYGRVLDGATLVDVIGNLSGR
FT                   PDKTGFDTYVTPGGVLRVYHGDNRYGVLSSSYIHTFYVGINTLGNPYDLTFTRQVTING
FT                   TTITLEDSIGPASGPTNYVKSIDGKITAVFGPFTYLATYVVSLGKAGTSPETYLVTIAP
FT                   GKVAYNHYVYITIEGMRGLVIQSKNDAFVEPLGFVAFTLNRTAGPGTGEPVPLSCGLVV
FT                   WNMTLYTVTVTGLLDLKGNPIFNPENFRYKIQMKVGDSWVTFSRAQASWKLTLGDAKAV
FT                   LNEVCGTISSFSDIMNCYRSLGPDGFRSAVLRLYEPVTLARLGGLLKLTNTNAEISTQD
FT                   LISKLVVEYSYTAGNDSVKAIVLEAALLEPANFQGVLNVSVLPIQIRLWRWGNDSLPLA
FT                   SREFYYTDPLDLASLRFVVTGDTMYLDRMAYDGAVTYDPWLGQVIWALPPYQVVPGLVG
FT                   NVKAHLLSLFNTSGYLPLPTLVANLTNVGGRVTLEYYNYSDALANGDFFAKFGIGLVQK
FT                   YGYKFRIYSGQVLVGTANLEAYYPVIDKYGLLIHARAGDALQEKYGDDERKDMYALQIL
FT                   QPGRFYDREHVLHIAIVRVFQNILLKDACGNPVYGVGAGLSGASLSLVITVGGRNYTIA
FT                   KLPLGSEVPVDLFIPIDEWGNPQIDLTGGYVQAYAVLNYYGYTLYPVDNITKIPSSQPT
FT                   WFNIPIKFGVVKKPVLYLPIAPLQFRVWSQAVSVDYDPLKEPLMGFVVRVFSTATGDEI
FT                   ARSISNKDGYAYEPNVPIGVPFRVQVRTIVPTSDKRWSYTYDQITRKNDYASYAKALGF
FT                   TPADNVYTLGTRGAIDSGLVVYSKTMALTAENATRYICAKNAIDLPVEVFDLVVRVFDK
FT                   TGKYLLRSQPVFLGPYPQATRPVLLNVTLLLADDYSPYAYASIWRDFGNGDFKILTDFR
FT                   AIGITGMRSIYLNLASKYLDAAKKALGCPQYTTANYSAAINAYALAAMAGYVANASTDR
FT                   YAAVYLLTSQQPKDIINLCDMKPSQAGTAEIARLFMKGQRFRFVVWYMGQKVFDDYVTI
FT                   TGPLVDIKADVYPVNVTTYTKSMRLPVDTFVGFTITDVYLGLALNKTDGMFANKSLVPQ
FT                   LIAPFDTMYKTYNLYYLIRDELAKGTATLYNDNVTAFVTPPASVYYGAYKPAQFGGDFV
FT                   YLPNLAILRNATAPKYLSTVLNSYISTTIPIRQLNTIPAGSGTVTIPAGGSASITIVGA
FT                   KIVPDPNNNATYFKVTSYNGTENSNIVQPQLIITAELAIVGGSYVKNYVATVDANYTID
FT                   LTAIAKCGNIVVALGGGDLTLQITVSAGSCPATITYAATNASYTWKALTSSAAPSTEYV
FT                   VSFDRWFLVPYDWLFAQYNVLYHATNVVERNDVLQVLAYPGATQICAQPAGQVAAGEDD
FT                   EYKYKLTLTGVNVANYRTLAVELPWKAGGGGKALVNITAYFANGTKIDSIVYNLTDMLK
FT                   DARGTRVKVLLPLNFGKVGAKAYDIAVSKATVRFDITFMMYDPKTGPYSVCAVKLVPLA
FT                   ANYTSVSEYECTVPTAPGVPERIDPATVVYAIDPMLSSANGFDETFDAYGGFGTPITYV
FT                   VKSGEVALLPSWYYKTAVGGSRIARVWIIAASDDPSKGPALGTKYYSYTVKDDKVTINV
FT                   YKFEKYLVVNFVPNVCPAGYVSQTFLDEFDGSGRITGLGFGTGGTSALVLSNYTRVQMW
FT                   NSTAMWLAGGVFKLPTVALDALTVQNNAKFPIVVDSLNVKYRDYKYSIPMAPVRVNASE
FT                   TRTVLLNSYGFGRTYMFNISDVWAFKLVQPNYEYGLNVYHAGLLDALKHFGISTDKPLS
FT                   AYLKPLTSAYYVQNVLYASHAETSDWTFGILNGKITEITRGTWGDLRTDASDYDYKYVF
FT                   NYPTLPLKEIRDWNDRPLANQTVALFDGSGALYAVVYTGANGQLIYPLPAIASPVVRVA
FT                   WYNGYLVTLIKGLPEFTIWIYDQTISRDVTELGDARVVDKIRTYVYPVTVSVYDEAGRP
FT                   LNNMWVRVIDAGTSGNLVTSLNSTASDGGAQIVDLRISKYASGVMSQIPATSYYYYVYD
FT                   QSGALVAAGKFDIERGASVPSTGYNVQGKVITYSQVPVKNSATRGYIVVKGVQFVNGTV
FT                   KDVVYPFTVSGGVMTISGKLPLSYSYPVEIYVTHVTLGGQEVPVKGGRFLVYRGTTTDL
FT                   AAGLDFAELGLTGVVSISAVDTTGAPRSDWTVQVLYGNITAAEGKGSVNVVLPRTDVLG
FT                   QPYTVRVVTNVITPEGKALVKEQALEVTQKALAVQIPISTVRVVVQAVDGFGNVRQDWP
FT                   VVLENVASGMGQVSAEVVEGQRYVARATGLGFTNTTAFTARGPQMVVAIKIPTAKITAQ
FT                   AKDGFGKVRSDWPVEIVGVAAGQGTVGPVEVLAGQYTVKTSVFGKDFTQTVTLQPGQSQ
FT                   TVVVQVPTAVLSVTAVDDDRKPIDRYVTAVQISGPVSQSFSTSPKNLEVLAGQYTVTVS
FT                   ALNKQASTQVTLQPGQTANVEVVVPGTAGLDFLGTRIPLPTLVLYALLLLVIVVILAII
FT                   IIEYNNWRRRRLMQILAPPK"
FT   sig_peptide     31940..32011
FT                   /locus_tag="Pcal_0034"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.774 at
FT                   residue 24"
FT   gene            39984..40568
FT                   /locus_tag="Pcal_0035"
FT   CDS_pept        39984..40568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0035"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1 domain protein; KEGG: pai:PAE0830
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07475"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS58"
FT                   /protein_id="ABO07475.1"
FT                   /translation="MLGQLLVSHARLSMVHKLRGLALPEPPEALLGLKYGVFVTVEGIV
FT                   RSGGYERREVRGSLGTVFPMQDLGHDVARIAARLAVSIPRFTEFDLRRSVVEVTLVEGL
FT                   SEWDGDLSNFAWGREGVYVEAGERRFVVLPQTIIERRLFGEALLRYVESMGGAGGTLYK
FT                   FSTRIFYEVRPEGEVIERELWKSRVIKQFVR"
FT   gene            40597..41397
FT                   /locus_tag="Pcal_0036"
FT   CDS_pept        40597..41397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07476"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS59"
FT                   /protein_id="ABO07476.1"
FT                   /translation="MYIELFVVSGQSGDLEGALKKAVEEIRGKVQRPDKVRLATVKIRP
FT                   DAVDQVLKLLGEPPDKVPPHYRSLVNMLKKYGVSKFPAVVIDGVKVGEGDVSVDEVLRV
FT                   VQERARAEFPELAGVELAPPRPAAAEAPKPLPPVEAKPVEAPPPARPQPSEVVPVAPPP
FT                   PPPPPPPPPSPPPPPVVPAEVPRPEPPRPVELPPPSRPPVAEVSPVMPARGRVTAVVKV
FT                   VLGRPDNCSECAYYGPVTGRCFLFGFAVVDPSRPPCKQYARGGG"
FT   gene            41378..41908
FT                   /locus_tag="Pcal_0037"
FT   CDS_pept        41378..41908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0037"
FT                   /product="adenylate cyclase"
FT                   /note="TIGRFAM: putative adenylyl cyclase CyaB; PFAM:
FT                   adenylate cyclase; KEGG: pai:PAE0832 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07477"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS60"
FT                   /protein_id="ABO07477.1"
FT                   /translation="MLEVEVKYRARLGEVRGRVLALGFSPWGVSEEVDTYFQHPCRDFA
FT                   ATDEALRVRVSGRSAVLTYKGPRVGAGAKTRVEVSTSAEPSVVELLEKLGFAKVAVVKK
FT                   RREYYEGLGVLVSLDEVEGLGEFVEIEKVVAREEDILGAVEELRRIASLLGLVEEVKET
FT                   YLELVLKHTANRQ"
FT   gene            complement(42120..42929)
FT                   /locus_tag="Pcal_0038"
FT   CDS_pept        complement(42120..42929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sai:Saci_1842 conserved crenarchaeal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07478"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS61"
FT                   /protein_id="ABO07478.1"
FT                   /translation="MEEFKRLLKRLAEEDREFLRGVLLEAIGDSGAEELVETLLRSPRA
FT                   RARLAAELAAMITIPLNVATKDDIKALEAKMATKEDLQRFATKEDLERFATKEDIKRLE
FT                   ERMATKDDLKALETRMATKEDLERFATKEDIRRLENRMATKEQFESLAISVEEMAREFV
FT                   EWFLKQRGIVCSAQRLLLDEEYEFDVYCAAGDVAVLGEAKVRCGPNDVERVVARVEEAV
FT                   RRWPDKFPGRVAKVLYCQLAAPKAVEKARELGVWLIETRRELTPLQL"
FT   gene            complement(42958..44709)
FT                   /locus_tag="Pcal_0039"
FT   CDS_pept        complement(42958..44709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0039"
FT                   /product="DNA ligase I, ATP-dependent Dnl1"
FT                   /EC_number="6.5.1.1"
FT                   /note="KEGG: pai:PAE0833 DNA ligase; TIGRFAM: DNA ligase I,
FT                   ATP-dependent Dnl1; PFAM: DNA ligase domain protein; ATP
FT                   dependent DNA ligase domain protein; ATP dependent DNA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07479"
FT                   /db_xref="GOA:A3MS62"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR022865"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MS62"
FT                   /protein_id="ABO07479.1"
FT                   /translation="MQFGELAKVLAAVESTTQRTTMVKLLTSLFKKAKPEEIDKIVYFI
FT                   LGDLRPPWEGVELGVAEKLCIRAISKATGLSAAELEGWYKKSGDVGEVARRALAAGKRP
FT                   TLLAFAQQKPLEVAEVYDTLLKVAKAAGEGAQDLKVSLLSSLFSRASPEEAKYIARFVV
FT                   GKLRLGVADMTLIEALSEAFGVSKEGLERAYHVYPDLGRLARHVAEGRPLEEIKITPGV
FT                   PVLPMLAQRLSSASEILAKLGGTAICEYKYDGERAQIHLREGSVKIFSRRLEDITHAYP
FT                   DVAKAVKEAVKAREAILEGEIVAVDPDTGEMLPFQELMHRKRKHDVAEAMEAYPAVLYL
FT                   FDLLYVDGEDLTTQPLIYRRLRLSEVVEEGGDVYIAKWGMFDGAEDVDLFFHEAVSLGT
FT                   EGLICKSPTSTYEMGARGWNWIKYKRDYRSEMIDTVDLVVVGAFHGRGKRAGLYGAFLL
FT                   AAYDPSTDMFYTVCKVGSGFTDADLRRMYDMLQPLKIPHRHPRVVSKMQPDVWFVPQVV
FT                   IEVIGAEITLSPLHTCCIGAVKPGVGLAIRFPRFTGRYRTDKRPEDATTTKELVEMYQR
FT                   QKKVPTT"
FT   gene            complement(44748..45293)
FT                   /locus_tag="Pcal_0040"
FT   CDS_pept        complement(44748..45293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07480"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS63"
FT                   /protein_id="ABO07480.1"
FT                   /translation="MLQSYKNIYVARGVEVQKLLEVRKVIEEKIAKLQEELKFYTSLLE
FT                   VIDKAIGEKSFSTAAQAARQETERPEAVEEVKGRSGEVYATVEVYRDKLRIKFKEPVKV
FT                   DGLFKRFYLDKFLQKYREEDAREVRQGALRQEEALRYELEEQEGEATAMTIYNYRTEER
FT                   KREILRVLRWTLEKVYGG"
FT   gene            45295..46209
FT                   /locus_tag="Pcal_0041"
FT   CDS_pept        45295..46209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0041"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: pai:PAE0835 sugar
FT                   kinase, possible phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07481"
FT                   /db_xref="GOA:A3MS64"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS64"
FT                   /protein_id="ABO07481.1"
FT                   /translation="MLVASVGNLNFDVYLKVGELPGVDENVEAFDLYTGGGGSAANFAV
FT                   AVARLGLGARFIGAVGEDPLGEMALRELREEGVDISHVKRVPSARSGVVVVLVHLDGSK
FT                   RMLSYRGANLGLSPSDLTVEKFAGVRHIHLATGRVEIIARAREIAREVGATVSIDGGTA
FT                   LAKKGLDVVKSVAEGVDVIFMNRAEARLLTGSSDKSAVKKLAEELKARELVVTLGPEGA
FT                   VAYDGARLLQVDAFRVDAVDTTGAGDAFAAAYIAMFLQGRDIYERLLFANAAAAIKVTR
FT                   PGARSSPRRWEVVAFLESLGYKI"
FT   gene            46232..46564
FT                   /locus_tag="Pcal_0042"
FT   CDS_pept        46232..46564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0836 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07482"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS65"
FT                   /protein_id="ABO07482.1"
FT                   /translation="MQRTLCLGPRCVYGPNSSSLFRCGKKALKPTVKGNKIVFWCTWLN
FT                   DECIGAKCQYAYCEARAMTPEGYCTYKAGGEEEPKKDILAEVKKIEKEVERIQVHLKRR
FT                   GLGDYL"
FT   gene            46655..47338
FT                   /locus_tag="Pcal_0043"
FT   CDS_pept        46655..47338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0043"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: pai:PAE0837
FT                   sugar-phosphate nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07483"
FT                   /db_xref="GOA:A3MS66"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS66"
FT                   /protein_id="ABO07483.1"
FT                   /translation="MAHFVKGVVLAAGLGTRLRPLTYFVPKALVSVGGKPLVDYVLEWL
FT                   RLNGVKDVAVVGYYMQDVLARYLAERHPDIAFIRSRRLLGTAGQLYYVMEWVGGDDAVV
FT                   VNTDVLTNLELSAPFSLHKSSGAKLTIVAYRLRQQMRFGALHVEGERLAAWREKPVSEY
FT                   VTAAGIYIISGVKLGEEYLDMDALAQSLIPHVAVYVAKEAQFVDVGTLEDLRKAAALPL
FT                   SPLKP"
FT   gene            47383..48105
FT                   /locus_tag="Pcal_0044"
FT   CDS_pept        47383..48105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07484"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS67"
FT                   /protein_id="ABO07484.1"
FT                   /translation="MSVCPALRRVEGGFVCSYNNKPIDPFSWYCIGNYTECPIFIRFSR
FT                   EVTKPAAPPEAAPKPLADVLPLAAERPSGEFERAIKPVIDNVILKFDDLVKKLDGAWKE
FT                   YEENVVNIRRQWEVEKMSLLRSQELLSRTIAEYEKRLAELELKRDFLPPEAYDQLRRDL
FT                   EEKLASLRALLDEVKAKYDALEESLGVHFRRVLSTSTSAEVISLKLSLSKLEELLQEGK
FT                   ISRETYERLKKELEELMK"
FT   gene            48102..48638
FT                   /locus_tag="Pcal_0045"
FT   CDS_pept        48102..48638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07485"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS68"
FT                   /protein_id="ABO07485.1"
FT                   /translation="MSLDVAYLALGELENLLKQYDEKLKAIEEAWRAFVDSATKAKASW
FT                   DADLPKVKIRVDQLRNVVDSLKKEMEVLLAKKELGLISERDYATLSEELQKKIDELEKR
FT                   LGEFTEKIAEVEGRVRYLWARALTREYLSKFDLVELEKRIEDAKAAGKIDDETYAKMKQ
FT                   ELAVMKSAWEFLNLL"
FT   gene            complement(48635..48997)
FT                   /locus_tag="Pcal_0046"
FT   CDS_pept        complement(48635..48997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0046"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   pai:PAE0840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07486"
FT                   /db_xref="GOA:A3MS69"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS69"
FT                   /protein_id="ABO07486.1"
FT                   /translation="MRLLLLLALLDDLLLLAAPAVVALALYALGVIPLWAAAAVAAPFA
FT                   ALAAYVGAKVVKERPRGFAYVGGRGVAVEDLGPRGVVKIGGEYWRAVCVGGCTVSAGSC
FT                   VELVEVRDGVAYVTPC"
FT   sig_peptide     complement(48872..48997)
FT                   /locus_tag="Pcal_0046"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.658 at
FT                   residue 42"
FT   gene            49022..50083
FT                   /locus_tag="Pcal_0047"
FT   CDS_pept        49022..50083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07487"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS70"
FT                   /protein_id="ABO07487.1"
FT                   /translation="MFTIEVPPGHAALVKGPAEVLCAGKCAVFGGHFESFTVPPHKRYP
FT                   VEGPATLKLKGGEVALVAEPAIPPDWALEAVDVVALVGPTDAGKSSLATFLLNVHVARG
FT                   KRVCVVDADVGQSDIGPPGFVAYSCTSAQVPHISELSPLNAYYVGAANLQGLEDLLVAG
FT                   VVWALKEAMSTYPHLVLINTPGWTTGRGLQLLKALADATAAEVVNIGERVLPGAVVSRP
FT                   KYALPRGPQERKELRVYSYRRHVSLRGKVAVELDKLRNCAWDKGLTCLWGRYVAADVEE
FT                   PEKKGREYAVPSHYLRHIFAALYKGKKLVGYGVVEKFEPKPTLYASTEDFDEVWIGKIR
FT                   IDPHTLEELDPLP"
FT   gene            50114..51001
FT                   /locus_tag="Pcal_0048"
FT   CDS_pept        50114..51001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0048"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: ttj:TTHB171
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07488"
FT                   /db_xref="GOA:A3MS71"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR042150"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS71"
FT                   /protein_id="ABO07488.1"
FT                   /translation="MSKPASAVPLFLATAYLTALVLDVAALELVTPAASSPTGLAVWGI
FT                   TRMWSVALAVVVALWAEGRLRELKEIVGLSGRVLLPYFFAPLVVYGALGIYIALAAPLG
FT                   LFQFQAYIDAIANAIRQYPVQDAEALARIVAYAQIAGAYIAAVTINAVVALGEEIGWRG
FT                   YLFRRLGGEANLRNVVIIGVVWGLWHASAILLLGYNYYYNRWLGVPLFTAFTTALTYPL
FT                   LLFAKNSVLPAASLHGAVNALWPLTVAASYLPPEARELYLGIGALGIAAWALTSLALYA
FT                   AYAKIRSAKQNVPT"
FT   sig_peptide     50114..50173
FT                   /locus_tag="Pcal_0048"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.948) with cleavage site probability 0.671 at
FT                   residue 20"
FT   gene            51029..51628
FT                   /locus_tag="Pcal_0049"
FT   CDS_pept        51029..51628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0049"
FT                   /product="PaREP1/PaREP8 domain containing family protein"
FT                   /note="PFAM: PaREP1 domain containing protein; KEGG:
FT                   pai:PAE3207 paREP8"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07489"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS72"
FT                   /protein_id="ABO07489.1"
FT                   /translation="MDALQHLVDFIKRKKPDEDPVAYLYRLVEETLDPSERVDFYVESS
FT                   EHFWREGLELVEKGELRQGSEKIWNSVVQLVKAAAEKKGLKHHTHRLVWATVRKIAMEH
FT                   DPETITLFAAIEQLHINFYEGHLDKWDVEKLTEAAAKLRKVLFAYSMQIRQDMRSKIIR
FT                   STSSHLLFLNPLSTPRRCILNSNRIRPLLSLLYLVI"
FT   gene            complement(52166..52477)
FT                   /locus_tag="Pcal_0050"
FT   CDS_pept        complement(52166..52477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0050"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07490"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS73"
FT                   /protein_id="ABO07490.1"
FT                   /translation="MHKRGHTLKVQFTGDKVVVGDREIDIRGARPIDLMLAALAYGIGA
FT                   RYIDATGEPFEMECHIEGYQITCTTKCTGQEEKCLVYQTLTKGLLKLLCVKEPPSLQQ"
FT   gene            complement(52453..53346)
FT                   /locus_tag="Pcal_0051"
FT   CDS_pept        complement(52453..53346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0051"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: pai:PAE0857 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07491"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS74"
FT                   /protein_id="ABO07491.1"
FT                   /translation="MVEFIVEGPWDDDEKLAIGVGLSMTFRRALVHAEPSPNALKAAEG
FT                   AVWGALLIKPCPPGLPCHRDIKEAVAVSEAELALVGYEGPDPPTTTRRVSTFNKHYMRP
FT                   WRWARGGEEAKVGHPLLPLMSCLYTLLKMRDDVPIVISDVRLKPTAPAGPDYMVTPTWH
FT                   LPREVAEVVDVHLPPLKAGAIALGVLMGGYRAGPVIAIVKQRDELAETVVKMGGYVVAL
FT                   NEEGDPCQLFERRAVGYSPKVSKYTVDPALCDRCGECLKTACPAITPSPAGHPQILPTC
FT                   TGCSACALVCTRGAIR"
FT   gene            complement(53350..53691)
FT                   /locus_tag="Pcal_0052"
FT   CDS_pept        complement(53350..53691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0858 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07492"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS75"
FT                   /protein_id="ABO07492.1"
FT                   /translation="MPVVLEEEIEVLKREAEKIGVKLEFEPIGSYNGVKLYKWIIRGWC
FT                   PFYKGKCTIHEKKPLACRIYPLVLNLKTGEIYLSEKCLWVKVNGPKPLDHFPAEKEATK
FT                   KLLIKLRIK"
FT   gene            54062..54373
FT                   /locus_tag="Pcal_0053"
FT   CDS_pept        54062..54373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0053"
FT                   /product="LSU ribosomal protein L14E"
FT                   /note="KEGG: pai:PAE0862 ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07493"
FT                   /db_xref="GOA:A3MS76"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR023651"
FT                   /db_xref="InterPro:IPR039660"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MS76"
FT                   /protein_id="ABO07493.1"
FT                   /translation="MVKVIDVGRVVVKVLGREAGRKAVVVDIVDENYVVITGPKSLSGV
FT                   RRRRVNINHIEPTDKKIEIKKGASDEEVLKALEAAGLVEYMKERVKPKLFEITPADVK"
FT   gene            54370..55371
FT                   /locus_tag="Pcal_0054"
FT   CDS_pept        54370..55371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0054"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="PFAM: PUA domain containing protein; pseudouridylate
FT                   synthase TruB domain protein; DKCLD domain protein; KEGG:
FT                   pai:PAE0865 tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07494"
FT                   /db_xref="GOA:A3MS77"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR026326"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MS77"
FT                   /protein_id="ABO07494.1"
FT                   /translation="MKCGSREVFVKLEEGTNPQWGKPPSSRSAEEHIRYSFLILDKPRG
FT                   PTSHEVAAWVKKILGVERAGHSGTLDPKVSGVLPVAVAEGTKVLMALSRADKVYIAVAK
FT                   FHGDVDVENLRRVLQELQGEIYQKPPLRSAVKRQLRTRRVYSLELLELDGRYAVLKMHV
FT                   EAGTYARKLIHDLGEILGVGANMRELRRVAVSCFTEDEAVTLQDLADAYYIWKKYGDDT
FT                   YLRRVLLPIEEIARPLPKIWVRDSAVDALCNGAPLAAPGVAKFEHPFSRGDLVAYFTLK
FT                   GELIGIGRALVDSEEVKKMEKGLVARTDRVVMPRGTYPPMWRRGGKSFKSGT"
FT   gene            55407..55673
FT                   /locus_tag="Pcal_0055"
FT   CDS_pept        55407..55673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07495"
FT                   /db_xref="InterPro:IPR003831"
FT                   /db_xref="InterPro:IPR023129"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS78"
FT                   /protein_id="ABO07495.1"
FT                   /translation="MVIDAAIPTKGVTIVDVARELYKVEGVKAVRITVDDVDVDVLGLA
FT                   IVVEGENIDYREVEEALERVGGVVHSIDEVVVGEYIPQAGATT"
FT   gene            55670..56164
FT                   /locus_tag="Pcal_0056"
FT   CDS_pept        55670..56164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0056"
FT                   /product="protein of unknown function DUF125,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF125,
FT                   transmembrane; KEGG: pai:PAE0867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07496"
FT                   /db_xref="GOA:A3MS79"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS79"
FT                   /protein_id="ABO07496.1"
FT                   /translation="MRYLVLGVVDGLITAGTLSATLIFRGGGIGLDLLVSLAVVVASIN
FT                   ALTVFVAEFVQQMQEVKEVAYKVSLREEWLRWSLLHTRALYATAKSSAFAFVSSLAGAL
FT                   AVLAPAAVFPPAAPLALALAVLVVGAFLAESWGDFAWVVGMIALAVAVGVAVGLAFPVI
FT                   A"
FT   gene            56186..56644
FT                   /locus_tag="Pcal_0057"
FT   CDS_pept        56186..56644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07497"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS80"
FT                   /protein_id="ABO07497.1"
FT                   /translation="MATLPVEYLRTTRLFREKAGDVEIISFEVPTHKYFSRGEVPYLAT
FT                   ALDVDLRKLENMISDMKYGRVAVEKLWAYRLDGDMIRESKKVLLPDLASNPVDGEVEEY
FT                   EDFKVLKIHVGSLRELVRIYVRQRPSFKEVVVYRRPPHPALVRYVAYL"
FT   gene            56641..57573
FT                   /locus_tag="Pcal_0058"
FT   CDS_pept        56641..57573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0058"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; KEGG: pai:PAE0870 conserved NAD/P
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07498"
FT                   /db_xref="GOA:A3MS81"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS81"
FT                   /protein_id="ABO07498.1"
FT                   /translation="MRVAVVGIGGWGKNHLRVVAQLRGEGLVDTVYAVDIDETRLRWAE
FT                   KVYGAQAVRGVEKAADLDVDAAIVATPTTLHARHAALFLSRGVPTLVEKPFTATLGEAY
FT                   ELLDLGKRTLVTTGYLLRFHQGVRYVKANLSKLGRFLSAYGKRTSRWPIRPGDVGVIKD
FT                   LAIHDIDLVTYITGERARAVYAAGGSTRGQYEDHAQIFGQYGGSSAIFEANWLTPYKFR
FT                   RIELTGDQGIFVIDFVTDEVYFYGEDGVYRPRLEVAEPLLLQDREFLLAASGKGGEVVA
FT                   VEDIVYTLKLCEAAVVSIKTGKLVGLDEV"
FT   gene            57865..58407
FT                   /locus_tag="Pcal_0059"
FT   CDS_pept        57865..58407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0059"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: pai:PAE0871 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07499"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS82"
FT                   /protein_id="ABO07499.1"
FT                   /translation="MKGEDFSLYDVERAELGEEFKLALSRASDGANVFIVGPAGSGKTL
FT                   MLRKLGLYLSRAGRRGVYVKLEWVKYGWGLSDYVSRYGARSRELTGLDGGVDADLILLD
FT                   DGELVWGYGSAYKNLLRDLRGRQIVAAFREIDMDAAALLFGDGFVIYLKGEPAEAPVAK
FT                   SPFGFAFLNKSAEIIVI"
FT   gene            complement(58394..58972)
FT                   /locus_tag="Pcal_0060"
FT   CDS_pept        complement(58394..58972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0060"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: pai:PAE0872
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07500"
FT                   /db_xref="GOA:A3MS83"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS83"
FT                   /protein_id="ABO07500.1"
FT                   /translation="MRTAVVALLPPLALMAGGVAAMYTPKCGLAAAITVAYLVMTPLAY
FT                   YARPYVARNLRHVAVAAFSMAALWALQYALAPLLSQYDVTNLIVSMLSTCDKWKIYLTL
FT                   SAIVLAPAAEEALFRGILFQELEKRAGLAVAYVGSALAFAAAHGFPALIPLYFAYGLVL
FT                   THAFRGGGFLFATLLHGVNNLLALYPILQ"
FT   sig_peptide     complement(58907..58972)
FT                   /locus_tag="Pcal_0060"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.815 at
FT                   residue 22"
FT   gene            58999..59469
FT                   /locus_tag="Pcal_0061"
FT   CDS_pept        58999..59469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07501"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS84"
FT                   /protein_id="ABO07501.1"
FT                   /translation="MEIAVAASTIGKRRFFIDITHWDSVDRFHKPFLVNPGHPAGLSVA
FT                   VFDLSRYINEVAQIYKEASEALASARREFVKSASRAWPLRFLLPARIEPPALGPEWEIK
FT                   THVENVIGKKFGGWGEVLVGRVAVEVRDRAVYIGGVPSIGHTYLRMLGALSI"
FT   gene            complement(59459..60247)
FT                   /locus_tag="Pcal_0062"
FT   CDS_pept        complement(59459..60247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0062"
FT                   /product="competence/damage-inducible protein cinA"
FT                   /note="PFAM: molybdopterin binding domain; KEGG:
FT                   pai:PAE0875 competence damage protein, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07502"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR023055"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MS85"
FT                   /protein_id="ABO07502.1"
FT                   /translation="MPTAYIITVGNELLIGRVVNTNAAWLASKLTYLGYSVRRIVVVPD
FT                   VEEDIVEAFREAMAKADVVISTGGLGPTPDDITNLAFCKALGAEPVVNEEALKMVREKY
FT                   ASRGYPMTEERVKMAMMPPGAVPLPNPVGTAPGILYETGGKIVVLLPGVPREMEAIFEG
FT                   YVEPLLKSRGPPAHFSERVVTVRGVPEADVAPIIREVMRQNPRVYVKSHPKGLEVDAPL
FT                   LQIHIYASAPTPQEAEGAVDAALKKLVELIKSKFSNAAIY"
FT   gene            complement(60256..61113)
FT                   /locus_tag="Pcal_0063"
FT   CDS_pept        complement(60256..61113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0063"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: pai:PAE0876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07503"
FT                   /db_xref="GOA:A3MS86"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS86"
FT                   /protein_id="ABO07503.1"
FT                   /translation="MLWLLPIGVLAVASASILIRLTPADPVAIAFWRLALATLIVAPFA
FT                   AARGLPRGRELAYSVASGVLLAVHFLSWIPSLFLTTVAASTTLVNIHPVVMLLFTRALR
FT                   ERVGKWAVAGVLVATAGALLTTFAPGGLLGNALAILGAVSFAGYLALGRVVRSAVNTWG
FT                   YVAVAYGSAAAVSLLAGAVLGSNLFNYSWQVFAMFLLIASIPMMAGHTVFNYLLGKYRA
FT                   ITVATSVLGEPVGATLLAALLLGETPAGYVETPVGALPLQAVGIAATLVGILLVVWEEI
FT                   KTGR"
FT   gene            61160..61570
FT                   /locus_tag="Pcal_0064"
FT   CDS_pept        61160..61570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0064"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   pai:PAE0877 antioxidant protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07504"
FT                   /db_xref="GOA:A3MS87"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS87"
FT                   /protein_id="ABO07504.1"
FT                   /translation="MRFPDVELEAHTGEKVSPARVEKAVVYFFPKAFTQGCTRETIRFN
FT                   ELYDKFKAKGFEVFGVSTDSVETLRKFAEKYGVRFKLLSDRGGALASQLGILRPTGTAE
FT                   RVTYILVKGEIIHVLKGLRSADEHADKALSLI"
FT   gene            complement(61769..62350)
FT                   /locus_tag="Pcal_0065"
FT   CDS_pept        complement(61769..62350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0065"
FT                   /product="peroxiredoxin-like protein"
FT                   /note="KEGG: pai:PAE0879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07505"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS88"
FT                   /protein_id="ABO07505.1"
FT                   /translation="MCMLHGGVCVKATALPEAQDRAIVLSANKPKSLAWRAGSVGRSTV
FT                   TESPPALDHHHLNTRPLIFMSKVVIMLADNDIARAYHALVVATSARAMGYEVHLFATGL
FT                   GALIFSKRPRTRLLGLPALAMWLIKRRLKRLGAASVKELARQCLSLGVKVYVDEPVLKM
FT                   LGVEPLEGVEVAGSLTFLALAKEADLVLTF"
FT   gene            complement(62370..63029)
FT                   /locus_tag="Pcal_0066"
FT   CDS_pept        complement(62370..63029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0066"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: helix-hairpin-helix motif; HhH-GPD family
FT                   protein; SMART: iron-sulfur cluster loop; KEGG: pai:PAE0880
FT                   DNA-(apurinic or apyrimidinic site) lyase (endonuclease
FT                   III, PaNth)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07506"
FT                   /db_xref="GOA:A3MS89"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS89"
FT                   /protein_id="ABO07506.1"
FT                   /translation="MDLGEFIDAVDKTVELRLNEFIAPVVWRRGGNLFEMAVAVVLSQN
FT                   TSDRNAFKAYDQLKRRLGEITPEAVLQLSEDELAELIKPAGMYRIRARNIRALADAFIR
FT                   HKVTPEKLREMGPVEARKFLLSLPGVGEKTADVILVNLGLPAFPVDTHIRRIAKRWGIV
FT                   GNHGEISRRFMEAVPPEKYLEVHLKLIQFGRDICTARAPKCHICPIGSKCPSYTRR"
FT   gene            63077..63562
FT                   /locus_tag="Pcal_0067"
FT   CDS_pept        63077..63562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0882 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07507"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS90"
FT                   /protein_id="ABO07507.1"
FT                   /translation="MEAKFSVRKSDFDKFAERLGLNPEELLSHLKAEVVKVGPGFRYVI
FT                   DMEHFFFYVIAKLHGQQKSSGGAQVDGRSFEEAFNRAVDALAGASGYAKLAEVREAVCR
FT                   ELGISEEEFSRRLAELVQAKRGAYILLEGGDVKVQVGPKKYGYVKRVERKVAEVVYY"
FT   gene            63606..64379
FT                   /locus_tag="Pcal_0068"
FT   CDS_pept        63606..64379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07508"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS91"
FT                   /protein_id="ABO07508.1"
FT                   /translation="MTCHIPTWPVASDKIALGGKSWIRAVESLIKLTSAYPMAVLLGRA
FT                   GMGKSQVALEVCKRTNCIYIDFTEMGERSMANIAAVVAWRLLSRHGGREAKSRIVEAYR
FT                   KFGYEGLLSLARGDPTWTLKAALELADTRVVVVIDELLPSAEDPKFFEAAYILHRIRNM
FT                   NLPNASFLVTMLPEVYEKIVERIPPLGNLFLHVTVQLPDVIPEEEVEDLVSSFCPEKAE
FT                   LAKKILQEKPDITVRELLLELNNLPSRRFVELTPV"
FT   gene            64428..65900
FT                   /locus_tag="Pcal_0069"
FT   CDS_pept        64428..65900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0069"
FT                   /product="carboxypeptidase Pfu, Metallo peptidase, MEROPS
FT                   family M32"
FT                   /EC_number="3.4.17.19"
FT                   /note="PFAM: peptidase M32, carboxypeptidase Taq
FT                   metallopeptidase; KEGG: pai:PAE0885 thermostable
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07509"
FT                   /db_xref="GOA:A3MS92"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS92"
FT                   /protein_id="ABO07509.1"
FT                   /translation="MIKSETVKQILEHYRVIWALSHAQGVMGWDSETYMPEEGIKARAI
FT                   ARAEISQLIQKFMLDEKFVKLIEKAEEEKDLTDVERGIVRVLKRDLKYYQRVPPEVVKE
FT                   FAKVTSEAFVAWRNAKEKARFGLFAPYLEKIVELSRVIAEKLGYKEHPYDALLDLYEEE
FT                   LTSRDVEEVFSTLEPGVRRLLSKLEARGWPRRHPLEEMPYERPRVEAAIFEVLELLGYP
FT                   KARFRVDVSPHPFTVGIGAPYDVRITVRFRGVDFREPLFSALHEYGHALYELNIDESLA
FT                   FTPVGTGVSLGVHESQSRFMENIVGRSREFTGKIAPILRRHLPLEQYSDEDLYYYFNVV
FT                   RPSLIRTEADEVTYNLHILLRYRLERLMIAGEVKVADLPELWNNEIDRLLGVRPRNDAE
FT                   GVLQDIHWAHGSIGYFPTYTLGNVVAAMIYYKHGRVKQHIADGDFASIKEYLREKIHRW
FT                   GAVYPPKELLTRSFGEAYNAEYLVKYLEEKYR"
FT   gene            complement(65872..66549)
FT                   /locus_tag="Pcal_0070"
FT   CDS_pept        complement(65872..66549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07510"
FT                   /db_xref="GOA:A3MS93"
FT                   /db_xref="InterPro:IPR007537"
FT                   /db_xref="InterPro:IPR024956"
FT                   /db_xref="InterPro:IPR038469"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS93"
FT                   /protein_id="ABO07510.1"
FT                   /translation="MYINVAHVVSTLVRLNPKALEASYREREAVCEPAAPPFAVRLDGV
FT                   GFGKRLRDFPHPRSRVVHEALVDTAKTLAATYGAELVHVVSDEINLIFLGQAPYGGRTF
FT                   KIVSVLAAHAASELTARLARPLHFDGRVIRLRDRCDAATYVLYRARVGLNNYVVQLARG
FT                   AGLINSHTPHIEELLPKVEIADFELAWGSTMKKEGGYRREGLCEALVALCDVCTSGTSP
FT                   RGI"
FT   gene            66564..67025
FT                   /locus_tag="Pcal_0071"
FT   CDS_pept        66564..67025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0071"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /note="TIGRFAM: cytidyltransferase-related domain; PFAM:
FT                   cytidylyltransferase; KEGG: pai:PAE0887
FT                   pantetheine-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07511"
FT                   /db_xref="GOA:A3MS94"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS94"
FT                   /protein_id="ABO07511.1"
FT                   /translation="MQLKFKNVVLGGTFDTLHSGHIKLLATATLIGERVLIGLTSDAFA
FT                   SSYKQYKVKPFSVRLANLKNLVSLIAPEKEVVYAEINDPYGPAAADPRLEAIVASVETL
FT                   PRALQINDLRSERGLRPMEVIVISTVRDGYGHVLSSTYIRKVLEKMQQS"
FT   gene            complement(67002..68318)
FT                   /locus_tag="Pcal_0072"
FT   CDS_pept        complement(67002..68318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07512"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS95"
FT                   /protein_id="ABO07512.1"
FT                   /translation="MEVFSRCTSFTDLVAGSPEEREFLQWLITALDAPGVWFHLSPVEV
FT                   LYWRDVGTRLEVGGAELRGLAMPYSRGAVVEGRLVPVDGDVEGNIAVAEFPQDLDDAKY
FT                   VVIDAARRGAAAVIFTGSPPRRVVVTSELGFKLDSAPPPVPVASIEGVKGLLGERGRLE
FT                   VNVQTRVTYSYSLIAFNSFENTPMVSAHWDHWLSGATDNCAGVEAAVVAFSELVAEDVP
FT                   IALGLFTAEEGVAPHVPSFYWSWGSYNYLRRWRPTFLVNIDVVGVGTPRIYAPPYLHGQ
FT                   LERLGPVENPQAYFDSVHYERWGLPSVTISSLWDTWDVYHSPLDSQADYENVLYAADLA
FT                   KRIVKIGPATPSVRVEEYGLPPVEDPHEAWSLVYNYLTLFKDFSHSDVAYVNVFETLKR
FT                   GSEYRRIDVFGGPTLCVGDCSHALEVYREAAALGLLHFL"
FT   gene            complement(68406..68777)
FT                   /locus_tag="Pcal_0073"
FT   CDS_pept        complement(68406..68777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07513"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS96"
FT                   /protein_id="ABO07513.1"
FT                   /translation="MEDYIKKAEAAIKMLAAEAFEKLEKKKRLELQDAIVLALYVNMRK
FT                   VDQLREDVDGVLRAFRRLDELVDVVKQLKSAVEALQKSQTSDDVAKVLREVSTKLDQIL
FT                   LAVSYKEVETRPNEAEPHH"
FT   gene            complement(68792..69589)
FT                   /locus_tag="Pcal_0074"
FT   CDS_pept        complement(68792..69589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07514"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS97"
FT                   /protein_id="ABO07514.1"
FT                   /translation="MLLTHVKFDEWPAKALREMGAEAVEGVGAWEDLLLVHSEIFLRAA
FT                   KRAGERPLLAVAVANAALGKRQAVFYIGGTMMAGPHAARGGHFFNAVVYIARKLGAAVV
FT                   SIDGHFPRGTWEAHMEYKFPLYLIYGGADGPPQRYIHRRGHKAVAIPMPPGAGDRSFWL
FT                   AISHVLKAEGPLAIHLGFDIHREDPTGHFFAGEYLFYKLGEALRGRQFYISIECTSTPK
FT                   VFASALGSLLAGVAGRGAEPAPGEESEEALREVRRVVSSVFKK"
FT   gene            69794..70564
FT                   /locus_tag="Pcal_0075"
FT   CDS_pept        69794..70564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0075"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: pai:PAE0893 putative prephenate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07515"
FT                   /db_xref="GOA:A3MS98"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS98"
FT                   /protein_id="ABO07515.1"
FT                   /translation="MAYLGPERSFTWEAAVALFPHGVYKPAKTITDVFKAVEAGDALYG
FT                   VVPFINSLEGPVGETVDALATHDLKIVAMGELRIVLCLAKKGVPRVVYTHPHAAAQARR
FT                   ALQALGAEVVYTASTSEAVREFEKCDNCAVLASPKALEGVEKTCGVEDAESYTRFAVVS
FT                   REGGVGERALLIFAVPNVPGALHKALGPLARRGINMTLIYSRPTKLSPWDYYFLAEVQS
FT                   GEGLEEALEEMGHYTTMLKVAGRYNIVTIQPTQP"
FT   gene            complement(70539..71090)
FT                   /locus_tag="Pcal_0076"
FT   CDS_pept        complement(70539..71090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0076"
FT                   /product="PaREP1 domain containing protein"
FT                   /note="PFAM: PaREP1 domain containing protein; KEGG:
FT                   pai:PAE0422 paREP1"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07516"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A3MS99"
FT                   /protein_id="ABO07516.1"
FT                   /translation="MYEAIERPLPKPSSADYASARLLEALVETKLAIDFLRRGLTRNAA
FT                   GKAFQAWRTVLAVLLKLELERLKALAKTEEERRWLEERAVPRVPTTKMIPLSQMLRELG
FT                   YRDVSAWTNLALNLHDYQYHGPDPDMALIKYRTREEAARAVVELVSAVVDYVQRLREKV
FT                   QFSEEVEKALEGVRAELAVL"
FT   gene            71152..73044
FT                   /locus_tag="Pcal_0077"
FT   CDS_pept        71152..73044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0077"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="PFAM: aldehyde ferredoxin oxidoreductase; Aldehyde
FT                   ferredoxin oxidoreductase-like; KEGG: tvo:TVN1239 aldehyde
FT                   ferredoxin oxidoreductase [AOR]"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07517"
FT                   /db_xref="GOA:A3MSA0"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSA0"
FT                   /protein_id="ABO07517.1"
FT                   /translation="MYGVAGAVVYIDLSTGRVEKIKLGEEVYKKFLGGVGLGAWFLLSR
FT                   MAKGTDPLGPGNVLGFVSGLLNLSNVPLAGRFMAVGKSPLTGGWGDANAGGRFGPKLKE
FT                   AGFDAVFICGVSEKPVYILIENGEVYIESAADLWGKTTKETEDELRRRHRGAQVVSIGP
FT                   AGEKQQLVAAIINEYGRALGRSGLGAVMGSKRLKAVVAVGDKRVEVYDRDLLRQKIVEI
FT                   VQLQKGPRARAAEIWHKYGTLYTLEPSILSGDTPLYNWRGLGYEEVKRLAEVYKADYFI
FT                   KDNVKPYACASCTVACGALIKSRTKYGEVEGHRAEYETASLFGPALLNLDRDSVVYINE
FT                   LCNLYGLDTISTANVVGFAMELYERGVLSEREVGFPLKWGDAEAVIRLVELIGKGEGIG
FT                   RVLGQGVKKACEIIGKGACEYAMHVGGQELPAHHVKYLPGLAVTYVADPTPARHTAGGV
FT                   HFMGEGGRSTWTQFDFGINFGKVEKYAYKDKGRIAAVYAKAAQVENSLGFCAFSSQVVF
FT                   RTLPYVELIYAFTGLKFTPQELLEVGHRIQTMRKLFNIREGVNPTQWKLPKRALEYPKE
FT                   GPLSDVKMTEEDVELMRREYYEEMGWDPATGAPRRATLEKLGILDLAEGLDLPP"
FT   gene            complement(73027..75153)
FT                   /locus_tag="Pcal_0078"
FT   CDS_pept        complement(73027..75153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0078"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helix-hairpin-helix motif; helicase domain
FT                   protein; DEAD/DEAH box helicase domain protein; SMART:
FT                   Helix-hairpin-helix DNA-binding, class 1; DEAD-like
FT                   helicases-like; KEGG: pai:PAE0894 ATP-dependent, DNA
FT                   binding helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07518"
FT                   /db_xref="GOA:A3MSA1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSA1"
FT                   /protein_id="ABO07518.1"
FT                   /translation="MEVSELPLDARLIAVLKERGVGRLFPPQVEAVRAGIFDGRSVLLC
FT                   TATASGKSLLAEVAAVKAGLEGRMALYAVPLKALAYEKLVHFSYYRGLVKVGVSTGDFD
FT                   SDDRRLHEFDVVVVTYEKLDSLLRHRPNWLGLVGVVVVDEIHYLGDPRRGPVLESIVAK
FT                   LRHLGLKTQFIGLSATVGNAGEVAAWLGARLVESSWRPVPLREGVYHGGVIRFSDGSMQ
FT                   RVNAPGDAEVALAVDAVAGGGQALVFTNSRSSTVRLAKAVAKAMEAAGLVPRGAKALAE
FT                   EVLKASSSKIIGRELADLVARGVAFHNAGLELEVRRLVEDGFRRGLLKVVVSTTTLAAG
FT                   VNLPARRVVVADYERFDPALGREEIPVLEYRQMAGRAGRPGLDPYGEAVLVARSKGEAE
FT                   YLMERYVRGQVEGVRSHILAEPNLRAHVLGAVGGGYAKSLDDLVDFFSNTLGAAQMKTS
FT                   LKLSILRSKIGGVVEELVEWGFLERDGDFVYATELGRQVARLYLDPEVAAGYIRLIKSL
FT                   RAGNVPAYLYVVLTAPDFPRVRRGRADKRVVEGILAALDVEEDEEFEDLARTASMLMAW
FT                   IEEVDEDVIYEKFDVAPGDLRVYVDLFQWLGNAAAKLARLVGREEHGKRLEVVTARVVY
FT                   GVREELLGLVTSLRGVGRVRARTLYNFGYRTLEDIARATVREIASLPGFGEKLAESVIE
FT                   QARQMLAEGLRGEV"
FT   gene            75249..76571
FT                   /locus_tag="Pcal_0079"
FT   CDS_pept        75249..76571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07519"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSA2"
FT                   /protein_id="ABO07519.1"
FT                   /translation="MEVVLVSGILIGFILFLFTLTPQQTELYAVAQPALMNLAQQALDR
FT                   AILMQGNITTRRADGWTIVDLALSAQRPLYQPQIDSAKLGALAAPAAQGPTCVIRQQKL
FT                   VEASGISQGVLVGYGVLAPRQSYACDYEAILKNFFGPAWDKYDMTLVLKPLVNLTICPN
FT                   YPVGSVTIRRNDPMCAKVPLGKIWVTLNATGTAVNGTVVVTVIHCPVGGECQIASAEGY
FT                   FKFDPNLRLYYYDVTGLLAQYLQDVPQGAGVAAFAQKVDYPKAFDFWLFNVSNRPLVYG
FT                   FYTPDGRVWITHDATVSCGSGNTPALGIRRLDAYTGAGFTNLAQDAVLDPGQGQGQVKV
FT                   DQCSKCVGNARCAACYVTPPPGSLFMVVWVERNSQGGNAPEGTMVIIPLAPTPPKAPVR
FT                   VDTWRCRGLQSPPQTQSAVATRVVDSQAATYAAELTLYKWP"
FT   gene            76568..77008
FT                   /locus_tag="Pcal_0080"
FT   CDS_pept        76568..77008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07520"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSA3"
FT                   /protein_id="ABO07520.1"
FT                   /translation="MKWVIELGLSAMVVGLVFYVVSAAAPAPAYIAAEREVTANAYFIL
FT                   LRLTADPHFMSALERAVCQNDTKAVAAMLNATIPVRYYYNFTVYLDDERPPSCLACAKW
FT                   SQRLATASRPRGLPQSGASVAAVSALLSDGTRVRLTLSLDRP"
FT   sig_peptide     76568..76642
FT                   /locus_tag="Pcal_0080"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.823 at
FT                   residue 25"
FT   gene            77005..80445
FT                   /locus_tag="Pcal_0081"
FT   CDS_pept        77005..80445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07521"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSA4"
FT                   /protein_id="ABO07521.1"
FT                   /translation="MRGQLILLSAFIAAVAVAAIMTAQIALQMGSYSAGARTGYGIYAK
FT                   AWPEVVDLADSHVLQATAKASAQLSTAATTTGLYAWLSDLPYYAAKWYTNSSLSLLKTA
FT                   LLPIGAQLDFKYRIFYTGFNGTLGPYPQAVEYSRWNLDPVRSGFLTIPGATLYRLVVTW
FT                   QSDDYGGYYVVTYGAHVSEPGAAGEVYNVALADLLRKLGELEEEKIKSSLFAFLVDSQT
FT                   CKLYQLPWWAEIKNCPLCLLHVRLPSSSSDEVSGFKLEKGKAVEVLLVFIPNLQGDEIP
FT                   VLKSGPCASGQPMLSDIVKVNKAVNNEPKAAFAPQVGYEQYPWGGRPAGYSVSYYWGAD
FT                   EIASWGKSVVNTQGCYHSPTGGVIRNEYGVTVEDVPDFRPVARVYARYAVGTTNWAFNV
FT                   YYKLNTPQEDDDDNLRNLGWRGFTVEALVKPLKGIIRPARLDLYYAWNTNPPPPSRHPI
FT                   CAYLLAVQAVVPAIVWTNWYAGNGVWNGRTWDDAGSLTYGTSWYLFSISADTSRVVYSV
FT                   YSYNTTRPLIRLATKTTTHSFGGDWRFYIVLGSAIVDNPASGTPEEAYYAYVRVRPWVD
FT                   PPPSVSLAPVDKTPLARPGRVDVVALSATKVEANINASGSVGLANVERLNISRTIGLSV
FT                   KVVEWSVDGSNPNQDRYHYRVRVESTIPRGAVAAQFTLFYSLGSTYVNTTCVDNGLCTA
FT                   TLAEYLGYSGGRDVAEWEVEFTVPKRASHAIFVNVFGSKVAVSTAQPKLYALGGGTTWY
FT                   LINEGDGTGVLYIPWKKSGQQVCTRWLADYSPKDPRFIGVYDVKYKCPNCGPCESWTVV
FT                   LVPPGSLVRLDFTDSVSLSVLNTFRAQWQPPILPTPPLPSCPNPIYVRFYIPGNASKGY
FT                   YVIYVPPSDTQGPLLTYGGVDRRSAYAYLGGSWKGVNLYRDGPSGVGGYWVRLEGDLTN
FT                   KAVLAVFCQGGTFTPPQDLFRPPQQPSSYFWTLTGPVEVTLQQASLNEFKDGFTVVFGH
FT                   YRSVPSWVALYNGTWSDSMLSCASNRRMVGIQQIGSPKWWWDYDGFCYDRHIWELYGAV
FT                   SGERNFTISVARSVVLYQIFTSGAWGSGQNPWLRSYPNVVPSDGPSDLRNRAMTAFQRA
FT                   RAGVAGGQRYSVAVIPFTWPRPFFYVDSGTAVRGPFETT"
FT   sig_peptide     77005..77061
FT                   /locus_tag="Pcal_0081"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.739 at
FT                   residue 19"
FT   gene            80442..81128
FT                   /locus_tag="Pcal_0082"
FT   CDS_pept        80442..81128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07522"
FT                   /db_xref="GOA:A3MSA5"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSA5"
FT                   /protein_id="ABO07522.1"
FT                   /translation="MTSLEVLLLTAISLIIMFAALPYVISTLYASMAPLEYRNAVAYVL
FT                   AFADGLEADFGMAGSRKYFPLPNFVYGSFGGVNRTYAIAILCGGTPISGYSRWNVVEVW
FT                   YNSTYLVDGPRLYRGVDGGLIALVGDTMVAVNATPPGRLKLYFRPFVVNGTEEVYIYFV
FT                   SSRFYARGRYYLTYEVGGTLAVESLPCNSRLEIRVSDGVRQWSYTTPNVVKRVYFVNQT
FT                   VWIELR"
FT   sig_peptide     80442..80534
FT                   /locus_tag="Pcal_0082"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.904) with cleavage site probability 0.823 at
FT                   residue 31"
FT   gene            81125..81688
FT                   /locus_tag="Pcal_0083"
FT   CDS_pept        81125..81688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07523"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSA6"
FT                   /protein_id="ABO07523.1"
FT                   /translation="MRGSISTSALILFVAFAATVAVLAYIVDMRAQWVLERDVESLAQS
FT                   AADFAASQIRDSLAAASIPGVVELNRSLLVPRDFYGFDTAGVSICVGNRGGFLYVNVTA
FT                   SGTRGRGSATAKATAWLYNVTKWAIDHGRVVYLVGQYGPCGSPPSTCFATVIVGARKVA
FT                   VVNLTRPGCSAMLVKSGVWIIPRG"
FT   sig_peptide     81125..81199
FT                   /locus_tag="Pcal_0083"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.870 at
FT                   residue 25"
FT   gene            81749..83788
FT                   /locus_tag="Pcal_0084"
FT   CDS_pept        81749..83788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0084"
FT                   /product="replicative DNA helicase Mcm"
FT                   /EC_number="3.6.1.-"
FT                   /note="PFAM: magnesium chelatase, ChlI subunit; MCM family
FT                   protein; ATPase associated with various cellular
FT                   activities, AAA_3; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG: pai:PAE0901 DNA
FT                   replication licensing factor (mcm)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07524"
FT                   /db_xref="GOA:A3MSA7"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSA7"
FT                   /protein_id="ABO07524.1"
FT                   /translation="MLEVELDLLRDKIREFITSNEKVSDEVINMIIQQKKSLEVDFHDI
FT                   LMFDKGLADLFIERPRLVLPEADKVVKEVVEEKDPETAKKLRRFYFRVRGSPLVVPLRK
FT                   LRSEYIGRLIRVEGIVTRQTPPKHFLYKALYRCTQCGYEIELVQELERHVEPPAKCPRC
FT                   GASKSFTLVTELSQYIDWQKVIVQERPEDLPPGQLPRSVEVVLLDDLVDSVKPGDIVSL
FT                   TGIVDLTLSELRKGRPPIVTSYIQGVHVETTNKELVEEITSEDEQKILELSRRPDVREL
FT                   IVRSIAPSIYGYEEIKEAIACLLFGGNEIVYPDGVRVRGDINILLIGDPGTAKSQLLKF
FT                   VAKIAPRAVYTTGKGSSAAGLTAAVVRDKLTGEFYLEAGALVLADKGVAVIDEIDKMDA
FT                   KDRVALHEAMEQNTVSISKAGIVATLNARAAVLAAANPAFGRYLPNRTVAENIDLPVSL
FT                   LSRFDLIFVIRDEPREDFDSAVAGHILDLHSGKTPEAFRDVLRPDFLRKYIMYARRYVR
FT                   PILSEEAKERIKAFYLEMRRRYQGPGTAIAITARQLEALIRLTTAEAKMRLSPIATAED
FT                   AERAIRLYLAFLKSVGIDVESGAIDIDAILTGVPASRREAYIRVVELLKKLEEIEKGPV
FT                   KVDLLKAEAEKLGIPGPEVQRIIDLLIRNGEAYTPRPGYIKRVA"
FT   gene            complement(83850..84995)
FT                   /locus_tag="Pcal_0085"
FT   CDS_pept        complement(83850..84995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07525"
FT                   /db_xref="GOA:A3MSA8"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSA8"
FT                   /protein_id="ABO07525.1"
FT                   /translation="MDLKRAKELGAELAGKLPWQEIADSPAVRYYTDWSKFEGFKPLGR
FT                   PPAVSARLGPCEVVVQNGVFAGAGECEGVEVETAGEVFNLAPLDSKILALHAAALEEAV
FT                   KVRVKRAVPLLVVKLEALGEGHVASHVVLEVEGGGSVVVYASNGRGAMHTVVVEGWARA
FT                   PTEYVLVSKAEGPQYVHSVFYTASSVQARPLVVGGVMNAVREEYRIGEEAVAEAIGLEL
FT                   GLGEARIDHVVSLINDAPRGVGRAKLFAVAADKSFVTQRAVGRITKRGVMSDSSVEGVV
FT                   FIAGEGAVANTQPIILVETGEVAGARHSAADASLDEEKEFLLRARGIRREDIPKLLIAS
FT                   FVDQYLASLTDTAAEYLRRAVLGEVAAHLAPISAASQHAAH"
FT   gene            complement(85025..85585)
FT                   /locus_tag="Pcal_0086"
FT   CDS_pept        complement(85025..85585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0086"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: pai:PAE0926
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07526"
FT                   /db_xref="GOA:A3MSA9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032873"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSA9"
FT                   /protein_id="ABO07526.1"
FT                   /translation="MEWARRAREAYLAIGEEYEATRRRPLPVADFGELGPRALDVGAGR
FT                   GAQPLYIELAHGFVVHCDLDRRLLPGGDSVECEATRLPFRDGAFDVAYLVAVLHHMPRE
FT                   AAGEALKEAKRVARRVVATVWAPPKWRGREVGRGVWEVPWGDRAVRVYFQYELGDLAEV
FT                   APSPPLSMGILRRGRQYNFYILL"
FT   gene            86308..87738
FT                   /locus_tag="Pcal_0087"
FT   CDS_pept        86308..87738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07527"
FT                   /db_xref="GOA:A3MSB0"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSB0"
FT                   /protein_id="ABO07527.1"
FT                   /translation="MAKAASNLASSSVSSLREAFTGLKSLKARYSTAATTAASSRTIHT
FT                   WRKAIYLYPFQGVLRLLPPAAVLAAGLLIRAYFAPFTVGSDVVQFAGFADSVHRHGLCF
FT                   YKYAGGENAEAEGWAYPWPFPYGPLAVALLAVARLLAPGAVEKVGEWVYAPPDWIVASK
FT                   ALFIAFDTAVAVLIYSNGAGWPTWRRTAAMALYYLNPAVIYTSAIYGMLDPLPAALLIA
FT                   ALRLRGGFWAGALLGLAAATKLNAAPAALFAALASPSLRLAAGFAAGALVPVMPFEAAC
FT                   PGSLLAWVHAALSVASPGYNPPVVYSFNGVTTLATYLHEKTGGDYLWAIRAWWVAAAAA
FT                   YAPLLLVARRAGPLASAYLAYLAYTATYWRVNYQYFLLLAGLAALHIAAPGVSRAEKAV
FT                   SLAHLAAVALWPFLYPVSWWARVHVKEPNEAVATALDAVSLKLLDPEVYVAYSLALTAL
FT                   AYVALAAHYRRWFKRINP"
FT   gene            87763..89196
FT                   /locus_tag="Pcal_0088"
FT   CDS_pept        87763..89196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0088"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   pai:PAE0922 histone acetyltransferase, ELP3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07528"
FT                   /db_xref="GOA:A3MSB1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR034687"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSB1"
FT                   /protein_id="ABO07528.1"
FT                   /translation="MRFIRAASGVHVVAVMTHPMPCPGRCTFCPTARDAPKSYLSDSPV
FT                   VLRAKRSGYDPYLQTAGRVKVYLENGHVPSKVEVVVMGGTFSALPRGYREWFVANVYKA
FT                   LNDYPNWAAKAAESPSLEFEQLRNEAALLRMVALAVETRPDYVDEGEVDFLLQLGVTRV
FT                   ELGVQSIYDDVLAKVKRGHGAREAAEATALLKDAAYKVCYHLMPGLPGSDPDRDLEMFK
FT                   TVFSDPAYMPDCVKIYPLYVVPGTELYEQWRRGGYKSYDEETWLELLAKIYASVPRWAR
FT                   VMRLGRDIPLHHVVDGPRWGNMRQVVLKKMAEVGLPCVEIRCREVGVKLANGAPVEPGP
FT                   IEIKRAVYEASGGVEVFLEAVGPDDTLYGILRLRMPHAPRRPELSRRTALVRELHVYGP
FT                   AVPVGERGIWWQHMGIGRRLMAAAEEVAREFGARKVAVISGVGAREYYRKLGYERCGPY
FT                   MCKPLEKPLGHADEELITV"
FT   gene            89227..90228
FT                   /locus_tag="Pcal_0089"
FT   CDS_pept        89227..90228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0089"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   pai:PAE0918 histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07529"
FT                   /db_xref="GOA:A3MSB2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSB2"
FT                   /protein_id="ABO07529.1"
FT                   /translation="MSLPPPAGVIKLDQNEVPIPPPQHVVEAAAQALAVANWYQPAALY
FT                   DEVRALYAEYAGVAPAHVWLFPGADDFFEYILHRARKVAVVSPTYFLFEDQARFHGVEL
FT                   LQTPLRGEEFKLDLAEFLSAAKRADAVYIDNPNNPTGQLLLRPKEVEEVLALGKPTVVD
FT                   EAYFEFSGVTVAQLAEAWPNLAVVRTMSKAFLLAGMRVSPVIVGAGYRLHYNTVRFRVS
FT                   LSSLAAARAALYNRGYVGEVVKIVKEGAAYLREELARLGIKAWPTYANFILVKGPPGLA
FT                   AVLREYGVWVRDEEQRLGPGHVRITVGTPEINAQLVRTLKTVLKASLPQPSA"
FT   gene            complement(90197..92779)
FT                   /locus_tag="Pcal_0090"
FT   CDS_pept        complement(90197..92779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0915 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07530"
FT                   /db_xref="GOA:A3MSB3"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSB3"
FT                   /protein_id="ABO07530.1"
FT                   /translation="MRLLLVVLVLAAVGLAYVLPTEALDTFYWASPGAVRVLGADGASL
FT                   FSLDAVFPLVATDAVGKCFAVANRPYVYYTQTQGVAVTISIPTTATLSDDLINALRQYG
FT                   VSLTSKTVPIILNLTLPLPPVALAGVYKSTLVSLHTPYGYPLWATSLGPQVNATAVATN
FT                   CVDVAVGTMGGEVYVLRNGKVVSKASLPSPVTALAYSRDGGALYAGTMGGEVYKVEGSS
FT                   VSKVFSCPGSVLGLAVLLDGSPVAACFSKVDVPKVYVAPYGLEFAPAVAVEYGIDTPRV
FT                   PFAVSQNGEWVFVGTFGELVAIRRGSVAWRAPLPAPPLSVYSSGDGSIVAVGTLGGHVV
FT                   VFKEGREVARISAGRPVTSLAASFNGRALAYETWDSVTPVRLASVRIVPDAPQQCLPVD
FT                   VVVRAGEAVYAYSVSGAQDVLVPVSKISVEPQFKYLGDVRCRPLRNVTLEVTGDLAEHV
FT                   PVRYALEYRISVEPAGLVRGPAWASGPAAFYAEPRVEIPVYNSPVSTGVLRLVGWVVDG
FT                   RRLDVPTPSLTVNVDKPVSVKAVYRVELPPYVQINATARLRLDLVVVFDGSGNVVASGP
FT                   APEVSAYPVSAQGVYVPQALVSTSWPASVNGSTQLWADVGSTVVFKAPEFYDFRNGTRL
FT                   AFVGWAGLEFTPEERALEVVRTVQGPLSLRPKYVVQYRVWTAPPAYVANPPNATWVERG
FT                   ANVTVSIPTPIESRGNVRTVLAQWVINGRPAGSQVPLVVRVDRPLNITYTTKRQYLVYF
FT                   TSAYGQVPPQMWVDEGGVAGVVPTPMDVWSPPPLHWVFAGWRDKATGTVYNYPQMPVVV
FT                   ASTTFEAVWSLDPVPLVAVGGGAAGAAFLVWFIRRRRLAKLTAEVEKL"
FT   sig_peptide     complement(92708..92779)
FT                   /locus_tag="Pcal_0090"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.843 at
FT                   residue 24"
FT   gene            complement(92869..93057)
FT                   /locus_tag="Pcal_0091"
FT   CDS_pept        complement(92869..93057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0091"
FT                   /product="PaREP6 domain containing protein / PaREP6 domain
FT                   containing protein"
FT                   /note="KEGG: pai:PAE2853 paREP6"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07531"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSB4"
FT                   /protein_id="ABO07531.1"
FT                   /translation="MSLSLEKWVEAEKEARKRYADWAFIESLPPRLKAALLYYIETGDI
FT                   RRAAFSPGLTSRILGSL"
FT   gene            93136..93633
FT                   /pseudo
FT                   /locus_tag="Pcal_0092"
FT   gene            complement(93630..94565)
FT                   /locus_tag="Pcal_0093"
FT   CDS_pept        complement(93630..94565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sai:Saci_1842 conserved crenarchaeal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07532"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSB5"
FT                   /protein_id="ABO07532.1"
FT                   /translation="MEEFKRLLKRLAEEDREFLRGVLLEAIGDSGAEELVETLLRSPRA
FT                   RARLAAELAAMITIPLNVATKEDIKMLETKMATKEDLRALEARMATKDDIKALEARMAT
FT                   KEDLERFATKEDLQRFATREDVAVVREEVRRLEESMATKEDLKALEARMATKEDLQKFA
FT                   TKEDLERFATKEDIRRLENKMATKEQVEDIALSLEEVARDYVVWFLKQRGVLCRASRLR
FT                   LDGEYEFDVYCAAGGVTVVGEVKLRASAGAVERLVARVEEAVRMWPEKFQGRVVKVFYC
FT                   MDASPEAVEKARELGVWLIEASRELTPLPL"
FT   gene            94691..95044
FT                   /locus_tag="Pcal_0094"
FT   CDS_pept        94691..95044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07533"
FT                   /db_xref="GOA:A3MSB6"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSB6"
FT                   /protein_id="ABO07533.1"
FT                   /translation="MARRGSGRITWGDVRRGIVWFFVTIFFAAFTWFIVTAFFNYYYTL
FT                   NVTQYVVNFLDRLVGQGLALNYTCSASPCRIDLGPGDKVLNFTVENPTSSPLVVLLRGE
FT                   GGAVATAAVHGSN"
FT   gene            95095..95622
FT                   /locus_tag="Pcal_0095"
FT   CDS_pept        95095..95622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07534"
FT                   /db_xref="GOA:A3MSB7"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSB7"
FT                   /protein_id="ABO07534.1"
FT                   /translation="MTIVNPTEIGVNESTTAEVEVVPLLSVNTFLLVTSTVIGVLTSSL
FT                   VYNHIAKKPLAKIYNGGPIRWGIILIMTPLLFFITGYIVVYFTRAHDVRLLLAYLLIKM
FT                   LYPLMFIYGKLFVLKSGLSLHAKASVFHIVDISWVLWIVHWAFDPLTALSFMGQNNTAS
FT                   CKSRISYHYSQY"
FT   gene            95652..96278
FT                   /locus_tag="Pcal_0096"
FT   CDS_pept        95652..96278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07535"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSB8"
FT                   /protein_id="ABO07535.1"
FT                   /translation="MLPLFRLRTLLLFMPFALNYELAAREEFCRRTRSRLVAVALEAEG
FT                   RVYRGVVTACDGDVVVVEGKEGEYVVPWSKVDHVLEAREVADLGRGEAKALLKRAGRGS
FT                   VVVVHRGGAAPYLYICAEGRDCEIAFEGRLPVAGGEAVGRGSAVVKCGGKKVRLDAAPG
FT                   DAAEGTAHYTCPTRFKVAVVALGPTRVEPRGCWPAEESPYVIEKA"
FT   gene            complement(96356..96724)
FT                   /locus_tag="Pcal_0097"
FT   CDS_pept        complement(96356..96724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0909 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07536"
FT                   /db_xref="GOA:A3MSB9"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSB9"
FT                   /protein_id="ABO07536.1"
FT                   /translation="MTSLEVAVILALVLVVAIAVGGYIYTAFATARQPSGVLVVQEAKV
FT                   YEDGSFELKVVPQVVGRVEVLSVEIAGIQKPLTKVVTGPDTIKGKIDVELTPGQVVSGR
FT                   VILGNGAVALFTATVQPK"
FT   sig_peptide     complement(96629..96724)
FT                   /locus_tag="Pcal_0097"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.904) with cleavage site probability 0.607 at
FT                   residue 32"
FT   gene            96892..98007
FT                   /locus_tag="Pcal_0098"
FT   CDS_pept        96892..98007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07537"
FT                   /db_xref="GOA:A3MSC0"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSC0"
FT                   /protein_id="ABO07537.1"
FT                   /translation="MGKSLVAVAIVAVLYFSLSLWFAITVFSTYASTYNTTKYITEVLS
FT                   AIDGHRPSSIHSCLTSCNVAMGGPHVLNIAVDNPSVYPLVLLARETRGNATVAVVAYGA
FT                   PAISIEFNNTLVVTPYPTHPLVVAKPRYIIADKSASANVETLQILDANMAVATLSLLAG
FT                   VIASALASSHFAKKPLAKMYHELYTAPWRHLLFPSLLAAGPAIPIALALYQAMRPSLGA
FT                   YLLVVGLKLVYPLLHALFKAYVLSKRLSLADKVGVLHTADLFLVFWVVHWAFDPLTNVV
FT                   AANWELAYMLASIAYAASTFLLVVATFLLPAALLPFFRLRTLLLLVPFALNAELAARRE
FT                   LCQRARGSLLCVTLTADGERHSGVVPHATMT"
FT   sig_peptide     96892..96987
FT                   /locus_tag="Pcal_0098"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.857 at
FT                   residue 32"
FT   gene            98585..99031
FT                   /locus_tag="Pcal_0099"
FT   CDS_pept        98585..99031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0909 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07538"
FT                   /db_xref="GOA:A3MSC1"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSC1"
FT                   /protein_id="ABO07538.1"
FT                   /translation="MPKAKGMTSLEVAIIVAIVLVIAIAVGWYLYTTFSSASQQSGITV
FT                   TEATIYASTSGSTTTYTLVMRLTPQGAAQVAIDRIEIAGKQMKCTSGNIIQSPGEYYVT
FT                   LSGITLSVGQVLSGRVVLQSGAVAPFTATVVAGTYTGSNQIVCS"
FT   gene            complement(99193..100434)
FT                   /locus_tag="Pcal_0100"
FT   CDS_pept        complement(99193..100434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0100"
FT                   /product="tRNA(Ile2) 2-agmatinylcytidine synthetase"
FT                   /note="PFAM: domain of unknown function DUF1743; KEGG:
FT                   pai:PAE0933 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07539"
FT                   /db_xref="GOA:A3MSC2"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR024913"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSC2"
FT                   /protein_id="ABO07539.1"
FT                   /translation="MRVFLGIDDTDSHGGGCTTYVAYVLAKEVLKRWGPQAFLDFPRLV
FT                   RLNPNIPFKTRGNAAVALALDVPDPDELWRLAVEVVTALARREGKTDPGIAMAVGEVPE
FT                   RAKVLYRMALTQVVSLSAAERAGATTWGGRGKIGAVAAIGADLRESTFELLAYREGDRA
FT                   EIPPSLVKAMEALTYPFTFHNLDRRRVLIQPRGPDPVYYGIRGLTPHHLLYAKALLEGQ
FT                   GYRPAGWAIFRTNQATDAHLRHGVIYDEPHPYSYYIAKGIIAEARRTKARHVVGRLDTG
FT                   LPFAAYRHLGPLATALEKCVGCYVELYGGLKPRHGSLYLYVERAHIHGRYVKIRQRCPH
FT                   CGGSLESLGRGKGWKCRKCGTIYYVAETLWVLDVTPSEYILPRPAEWRHLLKPPNLDTT
FT                   LPNHYTPQNVQWIE"
FT   gene            complement(101561..101827)
FT                   /locus_tag="Pcal_0101"
FT   CDS_pept        complement(101561..101827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07540"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSC3"
FT                   /protein_id="ABO07540.1"
FT                   /translation="MVQALSVERPYTRRTRRRELRLSQGDILDRQAPTPLLCGGATRRD
FT                   HRQIPRTRPPILKNASQTLQTPHRDDTKAKEAGISAQPPPRRL"
FT   gene            complement(101806..102618)
FT                   /locus_tag="Pcal_0102"
FT   CDS_pept        complement(101806..102618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07541"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSC4"
FT                   /protein_id="ABO07541.1"
FT                   /translation="MAVILRGEVDGVPKRVVSLNPSVNEFLALLGVELAGRDAFTYRPR
FT                   ELMKAPIVGTFVDMNFDAVKRMGPDLVILYHPVQTHLLDKAATAANAVVAVPTPTSVDH
FT                   VAAIFRFFARLFDKDEQGDWIAGVYKDLLRGPPILEGVVAVINLGVYDLACRNSYLADA
FT                   LTAAGLKYAKTPPCVFKHSQDPPKELHEANFVIYEARGKALAPAEHQLLKSRPHVATPN
FT                   DTLAHYGPSLPLDIRNVAQAAVKGQTWVGETSSTQRPSLRDPWYRPYL"
FT   gene            102751..103370
FT                   /pseudo
FT                   /locus_tag="Pcal_0103"
FT   gene            103877..104371
FT                   /locus_tag="Pcal_0104"
FT   CDS_pept        103877..104371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07542"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSC5"
FT                   /protein_id="ABO07542.1"
FT                   /translation="MSNGVEVYLPTMEEMVLYLITTTGFSKLAEFDPNGIVIVSYALAD
FT                   RLCSYPLTKALLSSRELRVGRLRVLSPGEVEGGAAYPRFCWGIDLAPYPGLAAVSLALF
FT                   GGRVPGWFLPPPFGGPPGTSAGGREVPGAARLRACPVPLGAPPLCGCGFLTFPEAYGEA
FT                   Y"
FT   gene            complement(104336..104617)
FT                   /locus_tag="Pcal_0105"
FT   CDS_pept        complement(104336..104617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07543"
FT                   /db_xref="GOA:A3MSC6"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSC6"
FT                   /protein_id="ABO07543.1"
FT                   /translation="MLEQAAALAGPFIIGLLVGILAKRLLSAALVLLALFIALAALGYT
FT                   SPNQVAAVLQQIGYAAKDAIAQAQWLKDAVPYSSAAFLIGLAIGLWKG"
FT   sig_peptide     complement(104486..104617)
FT                   /locus_tag="Pcal_0105"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.744) with cleavage site probability 0.485 at
FT                   residue 44"
FT   gene            104688..105317
FT                   /locus_tag="Pcal_0106"
FT   CDS_pept        104688..105317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07544"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSC7"
FT                   /protein_id="ABO07544.1"
FT                   /translation="MEFRCVPDCALCCRASPVTVLPHEVYVLQKAAGELGVSVVFTPAY
FT                   KVADLRSGVRVALSYLMHLDEEGKCPFLEGTRCRVHDIYKPLTCRSFPYLPKVVKYELD
FT                   PVAKEVRVDVRFVISTLCPVVKRDLSPSDVVKMADVRVAVKYAPREVDVAVSTLEKRML
FT                   YARVLSELWRRGLVELDEDKYPFLPVVNGFAFIRRFYPQLTLEKLL"
FT   gene            complement(105312..106247)
FT                   /locus_tag="Pcal_0107"
FT   CDS_pept        complement(105312..106247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0107"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   beta subunit"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, beta subunit; PFAM: thiamine pyrophosphate
FT                   enzyme domain protein TPP-binding; KEGG: pai:PAE0938
FT                   2-oxoacid ferredoxin oxidoreductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07545"
FT                   /db_xref="GOA:A3MSC8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSC8"
FT                   /protein_id="ABO07545.1"
FT                   /translation="MVQTRRTPADYRWVRPPEWCPGCGHFGVLQAVYNAFAELDLDPSR
FT                   VVLVSGIGCSSRLPHFVKTTSVHAIHGRAIPYAMGIKLANPSLEVVVVGGDGDLMAIGG
FT                   NHLLHMGRRNIDMTVILMDNSVYGLTRGQAGPTLPAGIKVKAIPKANPQSEINPLLLAL
FT                   TAGFTFIARGYSYDIKYTTKLIVEAIRHKGSAFVQIYSPCVTYNNVMTREWYEKRIYKL
FT                   EEADPTWDPVVHDEKEVDIKIRKALDKIVERDRLPLGIFYKNELVPTFEERYEAIYDPH
FT                   YRKLPPAIQPIEVDGRPVVDLEKLLADRIL"
FT   gene            complement(106259..108172)
FT                   /locus_tag="Pcal_0108"
FT   CDS_pept        complement(106259..108172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0108"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: pai:PAE0939 2-oxoacid ferredoxin
FT                   oxidoreductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07546"
FT                   /db_xref="GOA:A3MSC9"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSC9"
FT                   /protein_id="ABO07546.1"
FT                   /translation="MLKLMKIRFLIGGPQGRGVETASFMFIYGVGAAGYYIYARREFWS
FT                   NIAGGRHSYVVGTISESWPAPAPGNTVDMALTFDGHAVLEHVFHLRRGSYLVYNTEEET
FT                   KTPDSYNMMSKALAERLKKFAKERGFEPTVGNFVKYLRENGVEAVGVPYNKSITEIGRK
FT                   IGVTSPVMLARFVNTFVVALGMSLLGLGEEYVARGVEFALGKKAEVIEQNRRVAVEAMR
FT                   LVDKRIATLQPRRVEVKRVFWNGNEAAAYGKIAGGVRFVSYYPITPATDDAMTFERLIP
FT                   FPVRKDAGELAALERVGAVAFQAEDELSAIAVTTGAAIAGARAATATSGPGFSLMAEAL
FT                   SMAGMMEVGVVVTLWMRAGPSTGQATRQAQEELLPATFIGHGEYPKIVYASGDLEEVFY
FT                   DSVKVFNWAEKYRVPVIHLVDKNLSNTFTVMPLPDFSKVRIDAVKPVVFPQTKEAEAYP
FT                   LDSLVPPRLLPGVSNAVFHLNSLEHDPEGDPEEDPVIVARMFERRMAKMKLIDEEIPPE
FT                   DKLAYFGPPDAEVVIVGWGSVKPAVLSALEELRDAAFLYVKMLYPFPAPLVKKHLEGKK
FT                   TLFIENNYLAQLALASRMFAGIEPTAVAVKFNGRPVTTDDVVDAYKRFKAGEKIIKIET
FT                   DL"
FT   gene            complement(108273..108578)
FT                   /locus_tag="Pcal_0109"
FT   CDS_pept        complement(108273..108578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07547"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSD0"
FT                   /protein_id="ABO07547.1"
FT                   /translation="MQILTHWEALDALKSLDGPVLYLAWKCGLYKALNARAVVVVRQGV
FT                   GLGELISSIKYGLSFAPELVGFKYTVVEGEDLEEARLLEALEFSQLGKIIYIDCRK"
FT   gene            complement(108566..109153)
FT                   /locus_tag="Pcal_0110"
FT   CDS_pept        complement(108566..109153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0110"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: pai:PAE0942 conserved hypothetical protein
FT                   part 2, authentic frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07548"
FT                   /db_xref="GOA:A3MSD1"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSD1"
FT                   /protein_id="ABO07548.1"
FT                   /translation="MTPLEFLGLVAQLYAIMNPIGKLAIVGPLAVERPAQIRKVTAVVI
FT                   VVVYLLTALFALSGSYILAAFGVSLDSFRIAGGLILMVISVTTLTSGSYVGKLEIGEEQ
FT                   AVVPLATPLIVGPGTITALIIMSSQYGAALALAAAMAASTAVAATLIVGIRVVKYVGAT
FT                   PLRLLGRFMSLIIASVAVEMMLAGLRNVACKS"
FT   gene            complement(109259..110458)
FT                   /locus_tag="Pcal_0111"
FT   CDS_pept        complement(109259..110458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0111"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="PFAM: protein of unknown function DUF100; KEGG:
FT                   pai:PAE0944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07549"
FT                   /db_xref="GOA:A3MSD2"
FT                   /db_xref="InterPro:IPR002803"
FT                   /db_xref="InterPro:IPR036076"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSD2"
FT                   /protein_id="ABO07549.1"
FT                   /translation="MKVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLREAQRRGVIIDY
FT                   FVYNVGDDISLLMTHTKGEDNPEIHGLAWETFKEVTEQVAKKYKLYGAGQDLLKDAFSG
FT                   NIRGLGPQVAEMEFDERPSEPLIAFAADKTEPGAFNLPLYKMFADPFNTAGLVIDPSMH
FT                   EGFLFEVLDVVEHKVYLLKTPEDAYSLLGLIGTTGRYIVRKVFRRADGAPAAANSVERL
FT                   SLIAGRYVGKDDPVMMVRAQSGLPAVGEILEAFAHPHLVHGWMRGSHAGPLMPAKFYHI
FT                   DPEKRIAIGPKMTRFDGPPKVGALGFQLHEGYLEGAVDMFDDPAFDYVRQVAAQIADYI
FT                   RRMGPFQPHRLPPEEMEYTALPKILAKIKSYPADQYEKQRRKYVEEAIKGTPVEHSQHD
FT                   "
FT   gene            110473..110961
FT                   /locus_tag="Pcal_0112"
FT   CDS_pept        110473..110961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0112"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pai:PAE0945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07550"
FT                   /db_xref="GOA:A3MSD3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSD3"
FT                   /protein_id="ABO07550.1"
FT                   /translation="MLFKSVLVEVVYLDYVEITGVYSVVGEFYKQVSQESMRLRFLHLV
FT                   SDVSYVYKYLWSRGCQTFLVYRDNESVGVVDVTPCGDGAEVAIVIADRHQGKGIGTAVV
FT                   FDFADRLRRMGFRYAFAYVSPDNYRVLAIAKRLGAQVKCRDLCVVKYEFYRGAAEACV"
FT   gene            111043..112071
FT                   /locus_tag="Pcal_0113"
FT   CDS_pept        111043..112071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0113"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase, small chain; KEGG:
FT                   pai:PAE0946 carbamoyl-phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07551"
FT                   /db_xref="GOA:A3MSD4"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSD4"
FT                   /protein_id="ABO07551.1"
FT                   /translation="MFIGRHIGAERVAVGEVVFTTAVVGYPQALTDPSYKGQILAFTMP
FT                   LIGNYGVSEDQMESDGIKVEGVVVFEATEPSHYKSAMSLEEWLAASNVPGLARVDTRAL
FT                   AQLLREHGVMMGAMGPAKPHELAKALRRSPKYEEASYVDLVSVKEPVELGDGKLCIGLV
FT                   DCGVKRSIVRELLKRGVRLRIVPCRRPELAYDCDGLFVSNGPGNPKLLTFLAEEIRQYV
FT                   EYRKPLMGICLGHQVVAMAMGAEIYKLKFGHRASNKPVRDLAFTGKTYITTHNHGYAVD
FT                   PRGTELKVWAIQPDDGTVEGLYHESLPILTTQWHPEASPGANDTKWVFDKFVKLVERHA
FT                   GH"
FT   gene            112058..115135
FT                   /locus_tag="Pcal_0114"
FT   CDS_pept        112058..115135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0114"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein,
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain,
FT                   oligomerisation; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; KEGG: pai:PAE0947 carbamoyl-phosphate
FT                   synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07552"
FT                   /db_xref="GOA:A3MSD5"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSD5"
FT                   /protein_id="ABO07552.1"
FT                   /translation="MPDIRKVLVIGSGAIKVAEAAEFDYSGSQALKAFKEEGIETVLVN
FT                   PNIATIQTSKILADRVYFIPIQRPFLEGVLEKERPDAVACGFGGQTALSACVELDESGA
FT                   LAKYGVRVIGTPVRGIRRALSRDLFQRAMREAGIPTPPSKPARSPEEALAVAAEIGYPV
FT                   VVRVSFNLGGAGAFVAKTEEALRARVYKAFAQSAIGEVLVEKYLEGWKEVEFEVVRDSY
FT                   DNVAAVVCMENVDPMGVHTGDSIVVAPCLTLTDEEYQKARDISIGVARAIELVGEGNVQ
FT                   VAVNYAGPEQYAIETNPRMSRSSALASKASGYPLAYIAAKLALGYRLDEVLNQVTRRTV
FT                   AAFEPALDYIVVKHPRWENDRFGVVEGLGPEMMSIGEAMGIGRTLEEAWQKAVRMIDIG
FT                   EPGLVGGRMFDELTLEEAERCLAEYRPYWPICAAKAMYLGVPLERVYQYVKVDKFFLRA
FT                   IQRVVEFYKRMERGEADLEEAKVLGFSDEQIAKALRIGVEEVRKMRRRPVVKKIDTLAG
FT                   EWPAETNYLYLTYGGYYDDAAPKADFLVVGAGVFRIGVSVEFDWSTVNLAVELRNRGHR
FT                   VAILNYNPETVSTDWDVVDKLYFDEITVERVLDVVEKEGGDVAVVLYAGGQIGQRLYVP
FT                   LERAGVKIGGTRASSIDAAEDRYKFSKLLDKLGIRQPPWFTATSIDEALKLAEELGYPV
FT                   LVRPSYVLGGTYMAAVYSPGELAEFLTKAAKVSGRYPVVVSKFMPWGIEAEVDAVSDGR
FT                   RLVATPIEHVEPPGVHSGDSTMVLPPRRLGDSAIKKMIDVVHSLARELEVRGPMNVQFL
FT                   VNDDVYVIEANLRVSRSMPFVSKATGVNYMSLVADVLTNGRLATDEEVVALRPTKWWVK
FT                   SPQFSWSRLRGAYPRLGPVMYSTGEVAANGKTFEEALLKSWLSATPNKIPQKTALVYTY
FT                   DERDAEKMRHAASLLSTRLEVYKPEELGEKVVELLKWRKIDIVMTSGYTPQRDYTIRRT
FT                   AADTNTPLVLDATLAVELANAFLWYYNGGRLEVEPW"
FT   gene            115129..115923
FT                   /locus_tag="Pcal_0115"
FT   CDS_pept        115129..115923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0115"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /note="TIGRFAM: alpha-L-glutamate ligases, RimK family;
FT                   PFAM: protein of unknown function DUF201; RimK domain
FT                   protein ATP-grasp; KEGG: pai:PAE0948 ribosomal protein S6
FT                   modification protein (RimK)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07553"
FT                   /db_xref="GOA:A3MSD6"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSD6"
FT                   /protein_id="ABO07553.1"
FT                   /translation="MVALAYDVVREEERALIKAAASLGVGLRLVEIGDVLVLDAWEPDV
FT                   YLVRTLSHNKGIIFASAVESRGGVAVNSSAALATSWNKALTLTKLLAAGLPVPKSFVLF
FT                   GKAPLDVEGRKIVKAVSGSWGRKVSLVTSREELEVLLKSAEGEVLLLQEAVGTGEDIRV
FT                   FVIGDRAVAAMRRIPPSGDWRSNAARGGTTLPQPIDGELEKLAVKAAKAVGAYYAGVDI
FT                   LVGDRYYVNEVNGIPEFKALMRTTGIDVAKELVLAVHELAKR"
FT   gene            complement(115909..116409)
FT                   /locus_tag="Pcal_0116"
FT   CDS_pept        complement(115909..116409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0116"
FT                   /product="PaREP1 domain containing protein"
FT                   /note="PFAM: PaREP1 domain containing protein; KEGG:
FT                   pai:PAE2821 paREP1"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07554"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSD7"
FT                   /protein_id="ABO07554.1"
FT                   /translation="MELVKPWRNEAGYMRARLLEASYEAELAAKFLEEGLIRNAAGRAY
FT                   QAWKALLAALAARARDELAKVYTGMKRLRSGARISEVDWVIAFMPSSRVRPVAQVLARV
FT                   FGRDVLMYTDVALNLHEYQYNGPDREGVSSRYPSDEYAKEDIERLLKGVEEVKRRVFES
FT                   PLG"
FT   gene            complement(116439..117410)
FT                   /locus_tag="Pcal_0117"
FT   CDS_pept        complement(116439..117410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0117"
FT                   /product="AIR synthase related protein domain protein"
FT                   /note="PFAM: AIR synthase related protein domain protein;
FT                   KEGG: pai:PAE0949 hydrogenase expression/formation protein
FT                   HypE"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07555"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSD8"
FT                   /protein_id="ABO07555.1"
FT                   /translation="MKVGKLHPQLLRQLVLARRGAWRREVVVGPAVGEDAAIIDLGGAY
FT                   LVVHTDPISGSVKLVGRLAVFVSTNDVAVRGVEPMWLSVSIFLPSAAGEGDLDEIARQI
FT                   DEAAREIGVAVVGGHTEVTTAVTRPVVVATAMGVGRRYVTTGGARPGDYVLMTKYAGQE
FT                   AASILATDFGEEAVRRGVDKSAVEAAKSFNISVIREALALADFATSMHDPTEGGVAGGL
FT                   AEIAYASGVSIVVDRGAVLTRPEIEALCRAFGIDPLKTLSSGVLLATVPPNQLDAALNK
FT                   LRGLGVPHAVIGRVVEKSDYLVDISGEKIHEPYVEDKLFSLF"
FT   gene            117437..118345
FT                   /locus_tag="Pcal_0118"
FT   CDS_pept        117437..118345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0118"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="KEGG: pai:PAE0951 aminotransferase, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07556"
FT                   /db_xref="GOA:A3MSD9"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSD9"
FT                   /protein_id="ABO07556.1"
FT                   /translation="MDFSGSWLKVEPELVKSVHRAVLEKWGAKALQYTDPAGAPEPRRA
FT                   LEELVGGLGLTGFRAFFTNGLGDSLRILAFAHLEKPCVRLEDPTSQEALRAFEHCADSR
FT                   LAYIQPIWRNPDGYTYSEDEIKRVASEVPLVVYDLTYGLLSGRRVPIYGSAVAVASFHA
FT                   LFPGLALGFIAAPEELYEVYLEYVQSAYLHPPTYLQYLFYTALKEGAVGEVFASLKRRA
FT                   RAVEELLGVVATPYFAWVEARNPEIFLKHGAVPGGEFTRRRRLGKCLRLGLTSATEEEI
FT                   ARFFSSLPPEELQDVGHCREL"
FT   gene            118323..118871
FT                   /locus_tag="Pcal_0119"
FT   CDS_pept        118323..118871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0119"
FT                   /product="protein of unknown function DUF99"
FT                   /note="PFAM: protein of unknown function DUF99; KEGG:
FT                   pai:PAE0952 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07557"
FT                   /db_xref="InterPro:IPR002802"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSE0"
FT                   /protein_id="ABO07557.1"
FT                   /translation="MAIAESFKVEDGFSVLAGVVARRDGTVEAVAVDTATVGGTDATEA
FT                   AVRIAERLLKPDVSIIMLDGCVVSFYNWIDGEALWRRFGVPVACYVFEDPEGRVEEAVK
FT                   KLFKDWELRIEAIRRLGWPTPYYTKSGYKIYIRSWGIDPADAGRAAELCAKFGKWPEPI
FT                   RVAQLVASGVREYLSRRSR"
FT   gene            119005..120099
FT                   /locus_tag="Pcal_0120"
FT   CDS_pept        119005..120099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0120"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: pai:PAE0953 putrescine/spermidine binding protein,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07558"
FT                   /db_xref="GOA:A3MSE1"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSE1"
FT                   /protein_id="ABO07558.1"
FT                   /translation="MVTRRKLLIAAGGAVVAVALGAIGFSMLQRPRLAVYNYSYYIDKD
FT                   LLKEFEREFGVEVIYREFESGEEAYSALLRGGGGYDLVVVPDTYLKDVIAGGYVRKIDH
FT                   GKLSNLGNVAPEFFENPNDRGLQYSIPYAFGITGFAVNYYAMRGVDRRLDSWSDLFDFG
FT                   LLEKMRDRVAMLEEFIEPVMAAKYALGIDPDDWSDAAVNKVVDLLKRQKDYIRGYLGVS
FT                   QIVDALAAGELWVSQIWSGDAATARDKFVNLAGEVNRDKFEYVLPRPKTHRWVDFMVIP
FT                   RDAKNVDAAYAFIDFVLRPENAARITLASYYPTAVKKQLVAKYLPADVLEDPAVYPPEG
FT                   ANLIYLNYTKELLDAVERIRAAVR"
FT   sig_peptide     119005..119070
FT                   /locus_tag="Pcal_0120"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.613 at
FT                   residue 22"
FT   gene            120126..120299
FT                   /locus_tag="Pcal_0121"
FT   CDS_pept        120126..120299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0121"
FT                   /product="paREP10"
FT                   /note="KEGG: pai:PAE0648 paREP10"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07559"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSE2"
FT                   /protein_id="ABO07559.1"
FT                   /translation="MYGVFVALVLEVLGPHAYGLWKYGVGPTDDVETAIAKLRATAPHL
FT                   AKFLSEVAQRRL"
FT   gene            120321..120842
FT                   /locus_tag="Pcal_0122"
FT   CDS_pept        120321..120842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0122"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: pai:PAE0969 molybdenum
FT                   cofactor biosynthesis protein (moaB)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07560"
FT                   /db_xref="GOA:A3MSE3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSE3"
FT                   /protein_id="ABO07560.1"
FT                   /translation="MSHELHRAQGPKSARFYVVTVSTSRFQEKVRGGSPRDESGDVAVE
FT                   MITSAGHAVVGRDLLPDDVTAIRKKAFELMARDDVDIVVFTGGTGLTKSDVTIEALRPL
FT                   FEKEIEGFGDVFRFYSIQEVGTAAFLTRATAGVVKGKVFVLLPGSPNAVKTGLRILLGE
FT                   VSHLLYLVRQ"
FT   gene            120839..121369
FT                   /locus_tag="Pcal_0123"
FT   CDS_pept        120839..121369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07561"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSE4"
FT                   /protein_id="ABO07561.1"
FT                   /translation="MKQIAVAIHSGRVEGLGEKAAKFVDALAEACPDAVLLVGGYWGHM
FT                   VDVVDAALRRGLRVVVFLPMEREDVALPKGVIVVRTGCEFRCRSVQMVRSADAVAVLGG
FT                   GVGTMIEALMAYAMGKPLFVLVGTGAYSDRLREAYPRHFDERKAVDVVYVESPEELARA
FT                   VCAAGPGVAAKFG"
FT   gene            complement(121366..121908)
FT                   /locus_tag="Pcal_0124"
FT   CDS_pept        complement(121366..121908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0124"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: pai:PAE0966
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07562"
FT                   /db_xref="GOA:A3MSE5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSE5"
FT                   /protein_id="ABO07562.1"
FT                   /translation="MYFAKPPICLGLYIGAVIYAAFLPAGLLTQWRLSRAFPLAFAAYF
FT                   LALIAAGLIAAIPPIGAEFQRLQRAQAEFFARAATCPLGTVAVGAQALILAPLVEETLF
FT                   RGMLFEEVKRKVGTVAAYLVSSALFAVLHSPGLGALPIFVISLALAYAYHKHGLISSVL
FT                   IHFTQNFIAFAMAHGGV"
FT   gene            122008..122505
FT                   /locus_tag="Pcal_0125"
FT   CDS_pept        122008..122505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0125"
FT                   /product="Protein of unknown function DUF1288"
FT                   /note="PFAM: Protein of unknown function DUF1288; KEGG:
FT                   pai:PAE0965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07563"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR038437"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSE6"
FT                   /protein_id="ABO07563.1"
FT                   /translation="MYQGILNDYRVRVVFKKDVALPLLGVSYKANTEADLPLYLALSLE
FT                   EVGAVEIDEGSLIAPKDVTTYKYMEQRETYPVQLPEGFYARVKLTVHVLNKRGDSKGAR
FT                   AVAQDLRELLIERVRKIAVLVATKPDVVSDQGFLERLTPEEKALLNSMYVSISSFIAAV
FT                   MP"
FT   gene            complement(122483..123064)
FT                   /locus_tag="Pcal_0126"
FT   CDS_pept        complement(122483..123064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0126"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: pai:PAE0964
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07564"
FT                   /db_xref="GOA:A3MSE7"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSE7"
FT                   /protein_id="ABO07564.1"
FT                   /translation="MFIAVEGIDGSGKTTVIAEVAKALPRVYVTREPSGGPIGRLLKEW
FT                   ALRGGTADPHVDALLFAADRVEHYKREIEPKLREGYIVITERYVESSIAYQGAAGVPIE
FT                   YILYINSVVPRPHLTIILDVDPAEAIKRIKARERLEKFEDVEFLRRVREIYLTRARAEG
FT                   YPVIDAGRPAGEVAKDVVAIIERAMASLRR"
FT   gene            complement(123093..124547)
FT                   /locus_tag="Pcal_0127"
FT   CDS_pept        complement(123093..124547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0127"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: glucose-inhibited division protein A; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: pai:PAE0983
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07565"
FT                   /db_xref="GOA:A3MSE8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSE8"
FT                   /protein_id="ABO07565.1"
FT                   /translation="MVKVVTSYLSRLRALERYVGDYDVVIVGAGPAGLFAALELAKAGG
FT                   LRVALVDGGYRASQRHCPLQTPLEKCTFCVPCHIMYGIGGAGTLSSGLINLRPDVGGDL
FT                   HELVGDWDKAMELINYVDKTFVEFGAPDKVYEPQMELIGKLSAIAARVNARIVPIRQRH
FT                   MGTDGARAVVENMTKFLEGAGVAVMYATWALEVEKGGNGLFTVKTTRGVLNARAVLLAP
FT                   GRGGAEWLVAQLKRLGASLDFGPIDIGVRVEVPYHVMKPLTDAVHDPKVILYTSKYDDK
FT                   VRTFCTNPRGFVVKEVYSDGTVGVNGETYLERKSENTNFAFLVTLRLTDPMEDTIEFGK
FT                   SIARLATKLGGGKPLIQRLYDLERGQRSTWDRIRRSSISPTLKDVTPGDISLALPHRIV
FT                   EDIIEGLKKLDELAPGVASPQTLIYAPEIKYYSARPTVDKNLMTTVPGLFVAGDGAGLS
FT                   RGINVAAATGVLAARGILLYLQSGKQ"
FT   gene            124656..125660
FT                   /locus_tag="Pcal_0128"
FT   CDS_pept        124656..125660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0128"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG: pai:PAE0974
FT                   adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07566"
FT                   /db_xref="GOA:A3MSE9"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSE9"
FT                   /protein_id="ABO07566.1"
FT                   /translation="MLTVVVDGFFGDTGKGKVVAYLALADKPELCVRTGAPNAGHTVVI
FT                   GGEVHVLRTLPTCFVNPTSKLAVAPGALIKVDVFLSEVERYGKGKSYVDFNTGVIEDRH
FT                   VEAERRDEFLMKTVGSTGQGVGAAMVDRVLRRLRLAKDVEELRPYLADVPSMIHEARER
FT                   GVVIEGTQGTFLSLYHGTYPYVTSRDVTASGVLSEAGVGPKAVDEVVLVFKAYVTRVGG
FT                   GPLPGELPPEEAERRGWVERGAVTGRPRRAAPFNFELAKRAVLLNTPTQIALTKVDALF
FT                   KDAAGKTRWQDLPPEARRWVEEVEERLGVPVTLIGTGPEPWHMVDLRREKGRL"
FT   gene            125657..126883
FT                   /locus_tag="Pcal_0129"
FT   CDS_pept        125657..126883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0129"
FT                   /product="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="PFAM: fumarate lyase; KEGG: pai:PAE0972
FT                   adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07567"
FT                   /db_xref="GOA:A3MSF0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSF0"
FT                   /protein_id="ABO07567.1"
FT                   /translation="MKPSLISPFDWRYGSEEVRALFTPQAFIDAYVEVERALVCALEEL
FT                   GVAERGCCEAVGKASVSAEEVYELEKKTGHDVLSLVLLLEEKSGCRFVHFGATSNDVID
FT                   TAWALLVRRALGHIKRKVNAVGGELASLAARYRRLEMVGRTHGQWAEPITLGFKFANYY
FT                   YELHIACRLLALAEDLMRAKLGGAVGTMAAWGELGPAVRERVAQRLGLPYHPISTQVAP
FT                   RETFAVLASALAVLSSVFERLAVEVRELSRPEIGEVVERGGGSSAMPHKANPTTSERIV
FT                   SLARYVRSLVSVALENVALWHERDLTNSANERVWIPQAILAVDEILDSAARLLKSIHVD
FT                   EGRIRENLEKALPYILTEFHMNRMIKEGLPRAEAYKRAREVRAITFDYQKWPIDKLIDN
FT                   ALSLPLCQQ"
FT   gene            126981..127571
FT                   /locus_tag="Pcal_0130"
FT   CDS_pept        126981..127571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0130"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: pai:PAE0956
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07568"
FT                   /db_xref="GOA:A3MSF1"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSF1"
FT                   /protein_id="ABO07568.1"
FT                   /translation="MLWVVAVRIGVVDYTVGNLGSLLAALKRAGAEPVVVNEPEEANRV
FT                   DAIVLPGVGAYDAAAAKARSFKRVIESKPTLAICLGMQLLFEGSEEGAERGLGIFPGRA
FT                   ERIKAAKVPHIGWSYTRVVKQLPFLEENYYYYLHSFGVPYAPDARFVAYVELQRPYVAA
FT                   VYKEPILGVQFHPERSGKAGLALLRNLFAAWRR"
FT   gene            complement(127577..127963)
FT                   /locus_tag="Pcal_0131"
FT   CDS_pept        complement(127577..127963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0131"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase; KEGG:
FT                   pai:PAE0957 phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07569"
FT                   /db_xref="GOA:A3MSF2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSF2"
FT                   /protein_id="ABO07569.1"
FT                   /translation="MDAVPLATPEEAWRIAKSLNYRHIGGTVVAVVQDVETGEVLMVGH
FT                   MDPVAVVLTLTTGLAHYYSTSRKRIWLKGETSGHYQIVKEFRTDCDGDAVVLKVVQIGA
FT                   ACHTGARSCFSSPASFKIRLNRDA"
FT   gene            complement(128171..129835)
FT                   /locus_tag="Pcal_0132"
FT   CDS_pept        complement(128171..129835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0132"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: pai:PAE1112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07570"
FT                   /db_xref="GOA:A3MSF3"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR026447"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSF3"
FT                   /protein_id="ABO07570.1"
FT                   /translation="MPKFDVVFLHAPSVYDFRKTAKVYGPIADVIPSTPVFDMYPIGFF
FT                   SLASYLSSSGYKIGIVNLAARMLLDKDFDVERAVKGIEAEIFAIDLHWLVHSHGAIEVA
FT                   KLVKKYHPNSAVVFGGLSATIYYEEVLSRYRQIDYVVLGDTVEVPFKMLVEHLLDSRRG
FT                   LEEVPNLAWRDREAVKTTGIKFVPKSLDEYAVDYGEVLKIAARGGALSAIPFAGFLKEP
FT                   IGAVLSYKGCILNCATCGGSLCAYASYFSRTYLGVKKPETLVNEVKSIEQYLRVPIFVV
FT                   GDLQPLGVKWIEKFVEGLRRERFSSEIIFEFFTPPPLNVLKLLSKASDSVYLQISPETQ
FT                   DELLRLKFGRPYDNSSLETFIKRTLSLGFARLDLYFMVGIPAQTLDSVLAMPNYVRKLY
FT                   GLLPRPQRHRLDVFVSPLAPFIDPGSRAFENPRAFGYRLRARTLEEHRRLLEFSRDWVE
FT                   MLNYESDHISRSEIAYAVYQTAREFVKIKAENGVISWDQAKETLERMEMQRNGAFVRST
FT                   IDLYPSRRLLRSVRWKLISLMGFRGLVSIARDLAPLI"
FT   gene            129952..131025
FT                   /locus_tag="Pcal_0133"
FT   CDS_pept        129952..131025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0133"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   pai:PAE0958 histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07571"
FT                   /db_xref="GOA:A3MSF4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSF4"
FT                   /protein_id="ABO07571.1"
FT                   /translation="MGAIFALSLFTGRLLCLMRLPSLDFAYDEPDVGYAKYRLHFNENL
FT                   FLPDEYYREVAAAAEPWELRYYTDPLNRRLASVIERYFSLPEGSVVVTAGADDGLRLAM
FT                   SLALHGGWGLAVVEPTYGMARVVARQVGLRPVAVPLGAGLSLDVDAVVKSSASAVYVCS
FT                   PNNPTAHVVKELEELAARFQGLVIYDAAYAEFAGYWAPKLYEYGNVVEVRTFSKAWGLA
FT                   GLRVGYVVADKRIADVLRSLSLPHPISALSAKVVERALERGRRYVEQSVAQVTEVREAV
FT                   APRIRAEKYVGPVNFITVHVANAEEVASALDAAGFVVRTLGGKPLCRSCIRFTLAPMPV
FT                   MEKFLKALEEALNTGRQ"
FT   gene            131044..131892
FT                   /locus_tag="Pcal_0134"
FT   CDS_pept        131044..131892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0134"
FT                   /product="ATP phosphoribosyltransferase (homohexameric)"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: pai:PAE0961 ATP phosphoribosyltransferase;
FT                   TIGRFAM: ATP phosphoribosyltransferase; PFAM: Histidine
FT                   biosynthesis HisG, C-terminal domain; ATP
FT                   phosphoribosyltransferase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07572"
FT                   /db_xref="GOA:A3MSF5"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSF5"
FT                   /protein_id="ABO07572.1"
FT                   /translation="MLLAIPSKGRLLDPTLKLLEAIGMRLLASDERALVVPTSWRDVNV
FT                   IRARPEDIPYIVESGKVWAGVTGHDYVVESGASVVEALELGFGRGRLVVAVPKSSGIKT
FT                   VDELPPGTRVATKFVNIAYNYFAELGKRVRVVRVTGSVEILPQLGIADAILDVMATGTT
FT                   LEVHGLVPIATVLETSARLIVHPSYVNHELTKKLTTFIQGYYAAQGKKMIFLNVPASRL
FT                   EKVLAVLPAMEAPSVTPLAKGDVYEVFSVVPEDELPDIVIRLKEAGAKDIVVTPIEKLI
FT                   S"
FT   gene            complement(131893..132177)
FT                   /locus_tag="Pcal_0135"
FT   CDS_pept        complement(131893..132177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0135"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /note="PFAM: phosphoribosyl-ATP pyrophosphohydrolase; KEGG:
FT                   pai:PAE0986 phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07573"
FT                   /db_xref="GOA:A3MSF6"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSF6"
FT                   /protein_id="ABO07573.1"
FT                   /translation="MSCHVLERLEEVIRQRIREGNPQSYTYRLYSSGLHNVARKVGEEA
FT                   VETAVAALAEGEERLVQEAADLLYHLLVLLAAKGLALADVCKELERRMK"
FT   gene            complement(132174..133289)
FT                   /locus_tag="Pcal_0136"
FT   CDS_pept        complement(132174..133289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0136"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase; KEGG: pai:PAE0988
FT                   histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07574"
FT                   /db_xref="GOA:A3MSF7"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSF7"
FT                   /protein_id="ABO07574.1"
FT                   /translation="MRRGGLPRDVVKGVEAVVDDVAERGLEAALRYSEQFDGVKPSAPI
FT                   VEPRAGGDPAVVKAALEAAESLRRVYKRLVPPDAVDYYGGFMRLVSWRPVDKAALYVPA
FT                   RYISTLVMLAVPASLAGVREIYVVTPPRGVTEELLAVAKELGVKGVLQIGGPHGLAYAV
FT                   FHIGVDVVAGPGGLYVQAGKYVLSQYVGVDGIEGPTELVVYAEGVAPEVAAKGAMAQLE
FT                   HGPTSFAHVLSPDEELLRAVEEIYRREKTSSMGPLHVKKVAGVEEAARVVDEIAPEHLE
FT                   VWGRRELAFMVKNVGAVSINAPSPYLDYVAGICHVLPTGGTARWRGPVTPLNFLKPIGV
FT                   AEAVGSVDPALAEAARVLAKYEGFQRHFEAI"
FT   gene            complement(133286..134044)
FT                   /locus_tag="Pcal_0137"
FT   CDS_pept        complement(133286..134044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0137"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis; KEGG:
FT                   pai:PAE0989 imidazoleglycerol-phosphate synthase cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07575"
FT                   /db_xref="GOA:A3MSF8"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSF8"
FT                   /protein_id="ABO07575.1"
FT                   /translation="MPAVRVIPCLDMDGKAGVVVKGVNFLGVREVGDPVELAVRYEEEG
FT                   ADELVVLDITATPEGRGTFVEAVRRVATSVSIPVAVGGGVRGLKDADALFKAGADKVSV
FT                   NTAAVKSPGLVEELAREYGSQSVVVAIDAKRVGGGFEVFINGGRTPTGLDAVAWARRVE
FT                   ELGAGEILLTSIDRDGTKLGYDVELIRAVASAVRVPVIASGGAGELEHFYEAVKAGADA
FT                   VLAASLFHFRKLTVGDVKRYLRERGVEVRL"
FT   gene            134123..135562
FT                   /locus_tag="Pcal_0138"
FT   CDS_pept        134123..135562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07576"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSF9"
FT                   /protein_id="ABO07576.1"
FT                   /translation="MQRRVLYGVAIGVVALLLAYVAATVSMPVWISVEVKEEAPLKYRV
FT                   YIKPLYRAYFDKPGPPYIVVVLDNMRRIGVPPMGNVQVWAKGPNVGKYEIRDFEARGNV
FT                   IRIPVNGDFRKALDDWLNSNATDIEVPIQIDIWYGDTHIGFAAAHYVPREVGNMERGEY
FT                   VIKAAVYIIEKPIKKVNNTAARLAPGLDCNYEWRYNTTLIDTRRITLFLLYNQYNYSGL
FT                   VSVLGFITHVSSVNIDFTVLLGHEIGNLDIAVRELAAIEYDIKSNDFQVAFGADVTPEG
FT                   WYTAFLPGRLAVYKYDEYYVCHDGDRVVSTVRTGNIKIQTDVLYLPQGAVSTIDDHTPQ
FT                   KELLDTLSSNANVTVIRTYRLDPGRDLYLERELFALYSSRGKKDIKVGAPLGAVELLRA
FT                   ATKGAGSNPALLIILISFEVEDAGRWWRGPALTIFNKGDIYGPTYSVPEFIDVYGVRVK
FT                   IIARDGSSRQQYLPLAVVVAR"
FT   sig_peptide     134123..134191
FT                   /locus_tag="Pcal_0138"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.952) with cleavage site probability 0.475 at
FT                   residue 23"
FT   gene            135597..136160
FT                   /locus_tag="Pcal_0139"
FT   CDS_pept        135597..136160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0139"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   pai:PAE0990 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07577"
FT                   /db_xref="GOA:A3MSG0"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSG0"
FT                   /protein_id="ABO07577.1"
FT                   /translation="MSYRRETRETLVVVELVPGAVAQVETPIPFLTHMVETFLFYAGLG
FT                   GRVYAEEKRRLDDGHHVIEDVAIALGRALDQLIGDRSAVARYGWAAVPMDDAFALAAVD
FT                   LGGRPYWVVKAKLPNVAIGGYPLPMFPHWVRSLASEARATIHIYARGRDPHHKVEAAHK
FT                   ALGLALRAAVSPASGVQSTKGVLK"
FT   gene            136157..136843
FT                   /locus_tag="Pcal_0140"
FT   CDS_pept        136157..136843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0140"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="PFAM: histidine biosynthesis; KEGG: pai:PAE0991
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07578"
FT                   /db_xref="GOA:A3MSG1"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSG1"
FT                   /protein_id="ABO07578.1"
FT                   /translation="MIIPSIDIEGGRAVKRVQGRRGEYVFVGDPLELASRLSKAPLVHV
FT                   VDLDGAEAGRPVNVGTIEAVAKALGGRCQVGGGLRDEASIGWALGTCKYAVVGTLPFKN
FT                   PALFQRIADLYRSRLVASLDYRRGVVLVDGWRSEGAPLGQAVEHLKRFGPLGGLVVTAV
FT                   EVEGTGAGVALEVATSVLREVAERLYYAGGIKDCRDVENALKAGFDGVIVGYALYRGDL
FT                   RECFPL"
FT   gene            complement(136840..138294)
FT                   /locus_tag="Pcal_0141"
FT   CDS_pept        complement(136840..138294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0141"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   pai:PAE0998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07579"
FT                   /db_xref="GOA:A3MSG2"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSG2"
FT                   /protein_id="ABO07579.1"
FT                   /translation="MSRFQINKISDYIWEIPPGQKPCQKVPVRIYADSVLLEKMKTDMT
FT                   LEQGVNVACLPGIYRWSIVLPDAHQGYGFPIGGVAAIDAEEGVISPGGIGYDINCGVRV
FT                   LRTNLTEEEVRPKLKELVDTIFRLVPPGVGGTGHLRLSPGEFERVLAEGVEWAVQKGYG
FT                   WAEDMEYIEERGSWKLADPSKVSEKAKARGRDQLGTLGSGNHFLEIQVVDKIYDEKVAK
FT                   TFGIEREGQVVVMIHTGSRGFGHQVATDYLLIMERKMRQWGLNLPDRELAAAPLKDKVA
FT                   EDYIKAMASAANFAWTNRHIIMHWVREAFKKVFGSIEKVGLELVYDVAHNIAKLEEHVV
FT                   DDRGTVRKVWVHRKGATRAFPPGRPEIPAKYRDVGQPVLIPGSMGTASWILVGTPEAMR
FT                   LTFGTAPHGAGRVLSREAAIRMYPPHKVQEELAKRGIIVRSAETEVISEEAPWAYKDVD
FT                   RVVETAHQVGFAKKVVRQRPIGVVKG"
FT   gene            complement(138335..138631)
FT                   /locus_tag="Pcal_0142"
FT   CDS_pept        complement(138335..138631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0142"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: pai:PAE2911
FT                   P.aerophilum family 453, possible regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07580"
FT                   /db_xref="GOA:A3MSG3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSG3"
FT                   /protein_id="ABO07580.1"
FT                   /translation="MRWFLNLYGATQDFLNWMHVVDMARAKSAKAINDPRRMQLLQIIK
FT                   ERGPLTQGQLAKLTGMSWGTLQWHLYVLEREGLIKRIRQGALVYYATPEQALA"
FT   gene            138673..139179
FT                   /locus_tag="Pcal_0143"
FT   CDS_pept        138673..139179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1001 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07581"
FT                   /db_xref="GOA:A3MSG4"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSG4"
FT                   /protein_id="ABO07581.1"
FT                   /translation="MPRCDPGGAPPLFFIYLPVCRRVRGAVVSIQVAILMAVILAIALA
FT                   VAGYLMTMFQAAARYTYIAVLQAYVYPGGGGSWVKLCVAAGGSDALKIESVELGGVKAS
FT                   RVEVYVGDSPRAVVRAGETAVVKAFFDVRVEYGQSLVGWLHTAEGFKFPFTPTYTVGEP
FT                   KCPFE"
FT   gene            139209..140462
FT                   /locus_tag="Pcal_0144"
FT   CDS_pept        139209..140462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0144"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit D"
FT                   /EC_number="6.3.5.7"
FT                   /note="KEGG: pai:PAE1003 asparaginase; TIGRFAM:
FT                   L-asparaginases, type I; glutamyl-tRNA(Gln)
FT                   amidotransferase, subunit D; PFAM:
FT                   Asparaginase/glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07582"
FT                   /db_xref="GOA:A3MSG5"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR011878"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR037222"
FT                   /db_xref="InterPro:IPR040918"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSG5"
FT                   /protein_id="ABO07582.1"
FT                   /translation="MYKRVRVVLEGGDVFEGVLLPPTQFSDPDVVVVKLRNGYNVGIKR
FT                   SRIRELVELGDVPPPSFGAAEPPKQVGPGVWVLAAGGTILSRVDYVTGGVYPTLSASYL
FT                   FELLGEVESPVELVEVTAKFSEDFTPATWSLIAAKVGEAFEKGARGVVVLHGTDTMHYT
FT                   AAALAFAFREAPGPIALVGAQRSSDRPSTDAVLNLKAAVAVAARAPFAESVVVMHKTSS
FT                   DSVIAAHRGTRVRKMHTSRRDAFQSINAQPLAEYYPEKDLLQVLEPQYKERGGLSYTTK
FT                   FEEAVALVKFFPGMYPKMLEALLDLGIKGVVIEGTGFGHVGEYLLPAVKKLTDAGVVVA
FT                   MASQTLYGRVNLYVYRRGRELLAAGVVPVEDMLPEVAYAKLSWALANFKREEVPQVLKT
FT                   PVAFEINPRSDPLAFGAP"
FT   gene            140459..140986
FT                   /locus_tag="Pcal_0145"
FT   CDS_pept        140459..140986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0145"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: pai:PAE1004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07583"
FT                   /db_xref="GOA:A3MSG6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSG6"
FT                   /protein_id="ABO07583.1"
FT                   /translation="MSLLSVVDTLCNTPRVGWLQRGVSNAETVCAHSLLATLLAAEVAA
FT                   RLRAEGVDIDVEKVIAAAAVHDLAEAYLGHPSREVRNRLRWEEVEEEVFKREFPHLLEL
FT                   FRWYRYEENLVGRVVAFADKLATLIRACRYRQMGYDTDDLVKSLYKRLQEYDDLAHLLD
FT                   VYVSAYCGGVPA"
FT   gene            complement(140962..141510)
FT                   /locus_tag="Pcal_0146"
FT   CDS_pept        complement(140962..141510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0146"
FT                   /product="ZPR1-like zinc finger protein"
FT                   /note="TIGRFAM: ZPR1-like zinc finger protein; PFAM: Zinc
FT                   finger, ZPR1-type; KEGG: pai:PAE1008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07584"
FT                   /db_xref="GOA:A3MSG7"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="InterPro:IPR042451"
FT                   /db_xref="InterPro:IPR042452"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSG7"
FT                   /protein_id="ABO07584.1"
FT                   /translation="MIYETETRCPVCGAKAFRYVEFLYDVPFFGNVLIQSGVCTACGYR
FT                   YFDIVYADAGRPTRVTFTARDGLDVAKSLLIRSRTGRIYSPDLGFELEPGTQGEAMITT
FT                   VEGFLYKVVDYAERLKVLEPEKADVVDAFIQRVYEKIENGGFTLVVEDPQGKSFISPYR
FT                   PDTVQVEYLDEGQAGTPPQ"
FT   gene            141558..141818
FT                   /locus_tag="Pcal_0147"
FT   CDS_pept        141558..141818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07585"
FT                   /db_xref="GOA:A3MSG8"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSG8"
FT                   /protein_id="ABO07585.1"
FT                   /translation="MQKFDLAVGLSAVVLVALVLGGLWSLVYKPYCGVLGGYVALGALT
FT                   GSLLLLSRWYKSLEVVGIGLLLLYLVAMWATFANPAALYDC"
FT   sig_peptide     141558..141623
FT                   /locus_tag="Pcal_0147"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.608) with cleavage site probability 0.394 at
FT                   residue 22"
FT   gene            141855..142412
FT                   /locus_tag="Pcal_0148"
FT   CDS_pept        141855..142412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE1011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07586"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSG9"
FT                   /protein_id="ABO07586.1"
FT                   /translation="MAKAKSERKRKRGKIFIIALAALIFAEIGYICGTTGICFHWGNPP
FT                   PPDFNAVLQASQAYVFFNGNVTVEKPPVYQTAYVYVLPYQPGIVYPDQLIARIVLDASQ
FT                   GPVYIVPLPVTSAAVVPSDFYELLPTNAKFPVVLLAPNPNNVRIVYDWASGEAHRLGLT
FT                   VDLTRVLRFQIVNGTVQSAIIV"
FT   sig_peptide     141855..141935
FT                   /locus_tag="Pcal_0148"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.803) with cleavage site probability 0.593 at
FT                   residue 27"
FT   gene            complement(142402..143124)
FT                   /locus_tag="Pcal_0149"
FT   CDS_pept        complement(142402..143124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0149"
FT                   /product="isopentenyl phosphate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   pai:PAE1012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07587"
FT                   /db_xref="GOA:A3MSH0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR024192"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSH0"
FT                   /protein_id="ABO07587.1"
FT                   /translation="MYVVKFGGSAITDKTKPYTYRRGRVAKAAAELRGRQAVLIHGAGS
FT                   FAHPHVKAFGLTPLGIALTKASLRRLTAYVVEELAEAGVAAMPVEPSDVFWGRELRRVE
FT                   VLTHALSHGLYPLLHGDIVPSDGGYVVVSGDDMAVEVARLLKPRAVVFLMDVDGIYTAP
FT                   PGTPGAERIRRIAPGLAVEGAGGVDVTGGVRKKVESGLEIARLGIPVYYCHIEDREALR
FT                   EALDGGHPERCTVVEPIQ"
FT   gene            complement(143125..144129)
FT                   /locus_tag="Pcal_0150"
FT   CDS_pept        complement(143125..144129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0150"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: pai:PAE1013
FT                   dimethylallyltranstransferase / geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07588"
FT                   /db_xref="GOA:A3MSH1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="PDB:4DHD"
FT                   /db_xref="PDB:4GP1"
FT                   /db_xref="PDB:4GP2"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSH1"
FT                   /protein_id="ABO07588.1"
FT                   /translation="MDVVSRLHQKYGAEVEKALVRYLSIGLAEDFREAVLYQVKTGGKR
FT                   LRPLLTLAAAEAVSGQWRPALPAAAIVELIHNYSLIYDDIIDRGDVRRGLPTVRKAFGD
FT                   NAAILVGIWYREAIEEAVLDTPKPTLFAKEVAEVIKAIDEGERLDILFEAAGRSDPYFV
FT                   QARWREVTLDDYIKMVSLKTGALIAAAAKWGVLSVSDDRGLAEAAWNFGMAAGVAFQII
FT                   DDVLDIYGDPKKFGKEIGKDIKEHKRGNAVVAVALSHLGEGERRRLLEILAREVVEEAD
FT                   VREAVALLDSVGAREEALRLAARYREEAERHLAKIPNNGTLKELLDFIVAREY"
FT   gene            144191..144907
FT                   /locus_tag="Pcal_0151"
FT   CDS_pept        144191..144907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0151"
FT                   /product="protein of unknown function DUF92, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF92,
FT                   transmembrane; KEGG: pai:PAE1016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07589"
FT                   /db_xref="GOA:A3MSH2"
FT                   /db_xref="InterPro:IPR002794"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSH2"
FT                   /protein_id="ABO07589.1"
FT                   /translation="MPSIVALALLALKRGYLTPRGAASAVAVGLAVAAASLSLFAVLTY
FT                   FFISSSLLTKLRAEWKREMGLKDVSGRSLRQVVGVGTPIAVFSLAYLASGDPRLLTAAA
FT                   TAVAVAAADTWASEVGVAYGGAPRYILAPWRRVDPGTSGGVTPIGAAASAAGALTTALL
FT                   AHALGLGDAWKIALLGYLGEVIDSVLGASLQVKYLCGSQLSETPRPGCVKRGLLSNETV
FT                   NLVSGLAVGTLAVLTP"
FT   sig_peptide     144191..144316
FT                   /locus_tag="Pcal_0151"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.954 at
FT                   residue 42"
FT   gene            144972..145270
FT                   /pseudo
FT                   /locus_tag="Pcal_0152"
FT   gene            complement(145355..147193)
FT                   /locus_tag="Pcal_0153"
FT   CDS_pept        complement(145355..147193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0153"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S14, ClpP; peptidase S49; KEGG:
FT                   pai:PAE3679 protease IV, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07590"
FT                   /db_xref="GOA:A3MSH3"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSH3"
FT                   /protein_id="ABO07590.1"
FT                   /translation="MRALWAVSLLALVLAAAALVGWFSLQVSLGEVKAEVGKLGKDVAT
FT                   NLNSLEKRVANISASVDKLLNATRGLEERVSKLEAKKAAEKEIVVVPVDFAIYDYEVDF
FT                   LVKYVKRLEFDDRVAGVVLLINSPGGAVGATERLYSTIAGLNKTKYAVIAGLGASGAYY
FT                   TAVAAEKIYATPSSWVGSVGVIALIAPEDYLAEVPDWIYTTGPWKYYGKDLLALYDDVE
FT                   KTRENFVNAVLKGRGDRLKDLKAVETAEIFRADEALRIGLIDAIGGLWDAVRDMAKELG
FT                   LKNYTVVDIYERHNATRYTGIVIPLLGGKIDAKTLLRLSPEPIFYIYPGAVQFDGFPNA
FT                   TVPPVQVAVEERRGAPYVVLDMSHGNAVPLPLLEPLAAELVPRGYGIRVANSESELVKL
FT                   LDNATGLIVVNPTQPFSEEALSAVVNATRRGVRVLYMVDVKSPVFLSYGFIIVFTSYNA
FT                   PLYVHNLLAYFNATVVHRAVYNDTAAGAKTFTENWQFLHVTDFPNSTLFRGVRRLVLFG
FT                   ATPAFTRAQYRVDVRGAVRGYGPGNYTVAFAVGNFTYVGSVRSFTPYFIQLGDNKKFFS
FT                   NLVEWLVEPRPIAPPPKKAETTPTYPYYPVPIPPVK"
FT   sig_peptide     complement(147131..147193)
FT                   /locus_tag="Pcal_0153"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.334 at
FT                   residue 21"
FT   gene            complement(147598..148722)
FT                   /locus_tag="Pcal_0154"
FT   CDS_pept        complement(147598..148722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0154"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="KEGG: pai:PAE3584 citrate synthase; TIGRFAM:
FT                   2-methylcitrate synthase/citrate synthase II; PFAM: Citrate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07591"
FT                   /db_xref="GOA:A3MSH4"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSH4"
FT                   /protein_id="ABO07591.1"
FT                   /translation="MAYFPGLEGVVVKETEICHIDLENSKIYYRGYDLEELAERSTFEE
FT                   TAYLLLYGKLPTRGGLEQFKAVLRGNRAPPQHVTAVLQHLPKSAEPIDVLRTGVSAMAH
FT                   GEDLRDRSPEAELARGVRIMAAMPYIVAAWHRIRTGQQPLSPDADSHAEYFLKALRGSD
FT                   VSPLEARAMDVMLIIYAEHSMNNSAFTAVTVASTLSDMYAAVTAAIASLKGPLHGGANV
FT                   DAALMIEEIGDEGNVEKWVDAALAAGRRIPGFGHRLYKRGPDPRLRVLRRLAKELAYAK
FT                   GDTKYYAIAQRLEEYVTAKLAAKGIYPNTDLYAAVIFKYLGLPVDINLPTFAISRVAGW
FT                   VAHVVEYRRKNRLIRPTEKYTGPIGLKYVPIEER"
FT   gene            complement(148724..150673)
FT                   /locus_tag="Pcal_0155"
FT   CDS_pept        complement(148724..150673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0155"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   pai:PAE2865 acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07592"
FT                   /db_xref="GOA:A3MSH5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSH5"
FT                   /protein_id="ABO07592.1"
FT                   /translation="MRSFFPNYELSLKDPETYWRRVLEASAEDIYWAKWPDKIFEWEPP
FT                   KPFKWFVGGYTNAGFSAVSYKIRKYRDKPAYIYYSPELGVERKITYWELYQLVCDYAAA
FT                   LRAAGVRKGDRVMVYMPNSIEAVAVILAAARIGAISTTVFAGFSPKAVADRIELTEPKI
FT                   IFTQDYSLRRGRRVPLKENIDEALKISPWRPEKVVVKRALPEAEVAMEKGRDLTLDEFL
FT                   ELGKYTDCSPVFLEANEPLFIMPTSGTTAKPKPVVHVHGGYQVWIWHGAKLVYGLEPGD
FT                   VVFNTSDIGWIVGQSYIVFAPLIIGATSILFDGAIDYPRPDVFWEVVEKYRPTLIWTSP
FT                   TAARLLMRLGVEQARKHDLSSVRRVVTAGEVLNPEVWRWLYEDVFQRRVPVIDHMWQTE
FT                   TGGPIFGYPYALVKDMGYGMEYVKIKPGSAGQPLPGVEFEIVDEKGNPLPPMHKGIVVI
FT                   KRPFPGLTPTLWKDHERYLKDYWQRFEGRLVYYTGDAAHVDEEGYIWFGGRADEVIKIA
FT                   GHRIGTIEVESALLTHPAVAEAAVVGVPDPLRGEAIAAFVVLKPGWRPTEELKRELIEH
FT                   VRRTFGPIAVFAGVEFVNMLPKTRSGKIMRRVLKRVWTGEPIGDISTIEEEASVEEVKE
FT                   AVSRMKILAETSRE"
FT   gene            complement(150788..151234)
FT                   /locus_tag="Pcal_0156"
FT   CDS_pept        complement(150788..151234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0156"
FT                   /product="phosphohistidine phosphatase, SixA"
FT                   /note="TIGRFAM: phosphohistidine phosphatase SixA; PFAM:
FT                   Phosphoglycerate mutase; KEGG: pai:PAE0518 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07593"
FT                   /db_xref="GOA:A3MSH6"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSH6"
FT                   /protein_id="ABO07593.1"
FT                   /translation="MIYLVQHGKAFDERVDPERSLTPEGIEESRRVATHLAKVGVKVAV
FT                   VYHSGKKRARQTAEIFAQVLGARAEEKDGLNPNDDPAIWAERLSTLDEVMIVGHLPHLS
FT                   RLASLLVVGNTEVPIVEFRYSGVVALTRTPKWVVKWLLTPDILP"
FT   gene            151289..151573
FT                   /locus_tag="Pcal_0157"
FT   CDS_pept        151289..151573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0157"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /note="PFAM: thiamineS protein; KEGG: pai:PAE3375
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07594"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSH7"
FT                   /protein_id="ABO07594.1"
FT                   /translation="MRVTVKIFGPKYFGLPQYDVVTHVFDLPDGATVGDVVDLLEKMYP
FT                   GLRGRILRGEEIIPMHDIWVNGRSIQFLQGLATRLKDGDVVQLVPPFGG"
FT   gene            complement(151570..152514)
FT                   /locus_tag="Pcal_0158"
FT   CDS_pept        complement(151570..152514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0158"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pai:PAE3376 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07595"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSH8"
FT                   /protein_id="ABO07595.1"
FT                   /translation="MYFSRIKVPLPGMELGHVNVYVVKCGDGFGLVDVGLATYEAALAL
FT                   LRGLKAIGIKPQEVAKVFLTHFHADHITLAQFLAEVASPDFYIGAEELGWAAPSFDELA
FT                   KMYAEEYKRHGAPPEVYEAYLKLHPMSRYRRAFEDVWKLPWRGVRDGEELDCGLRAVHT
FT                   PGHTPGHTVYMSQGAVFTGDHVLPKITPNISWYPKPGFNPLKEYLSSLRKTRLEARGLP
FT                   AHGEEIPNLADRVDQLIQHHEERLAEVLSVLKEPMTTYEVAKRITWDAGPFDQFDVYNK
FT                   MFAVGEAYSHLLYLEEMGKVRRIEGEVVRWAPA"
FT   gene            152539..153228
FT                   /locus_tag="Pcal_0159"
FT   CDS_pept        152539..153228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0159"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="PFAM: sugar fermentation stimulation protein; KEGG:
FT                   pai:PAE3378 sugar fermentation stimulation protein,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07596"
FT                   /db_xref="GOA:A3MSH9"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSH9"
FT                   /protein_id="ABO07596.1"
FT                   /translation="MHFPLPQPDVSATFKRRLNRFLGVAEVEGEEALVHIHDPGRLAEL
FT                   LFPGSTVWLRKKAGGKAPYYLLAVELPEELVLVDSAMHNKIATWLVEEGHVFKGYSVAK
FT                   TEPSYGRGRFDLLLRRPDGGLALVEVKGVTLEVGGVALFPDAPTARGARHMEELARAAA
FT                   EGYEAHVLFLVLRRRARLFSPNWALDAKFAEALAKAADAGVKISAVKLEMFKWGLKFAG
FT                   ELPVKLR"
FT   gene            complement(153208..154056)
FT                   /locus_tag="Pcal_0160"
FT   CDS_pept        complement(153208..154056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0160"
FT                   /product="protein of unknown function DUF1028"
FT                   /note="PFAM: protein of unknown function DUF1028; KEGG:
FT                   pai:PAE3380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07597"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR014927"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSI0"
FT                   /protein_id="ABO07597.1"
FT                   /translation="MTFSIVASDGVDVGVAVASKFVAVGAVVPHAEAGVGAVATQCYAN
FT                   PRLGRVILALLQHRSPREALEKALAQDAEREIRQVGVVNARGEAYVHTGGKCPYYAGHI
FT                   VGNGYAALGNILAGPEVLEAMAKAFETKRGELVDKLLAALEAGDRAGGDRRGRQSAALL
FT                   VLRPGGGYLGLSDTYVDIRVDDHPNPVEELKRIFHIWELTLLQREDPSDVVSKRDVAAE
FT                   VQRALKKLGFYRGEVTGVWDEATEEAFRDWAGYENFENKIRDDDKIWGTVYRYLLSKLN
FT                   G"
FT   gene            154093..154902
FT                   /locus_tag="Pcal_0161"
FT   CDS_pept        154093..154902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0161"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pai:PAE3381 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07598"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSI1"
FT                   /protein_id="ABO07598.1"
FT                   /translation="MELRKGVRLLRGSPNTLVVGEYVVDPGQPAERAAEVLQAAGPAPK
FT                   VLLTHFHADHLTAVPPGAEVYAPWGEELFVASVRARLFFTHGVYVNNAVYKGGDIKVSG
FT                   VVKDGERVGPFEVVSLPGHTFGHVGYYVEGVLYAGDALFGEKVLEKYGAPYLMDVDAFL
FT                   ASLDKIMALEPEVLVMGHGPVVGSRKRAAELIEANRRYVERAVEAVAKLLPGDLTKLAV
FT                   GLLKEVGGERGWENVLLTMTTVRAILSKLSSEGRVYLDEEGTWRSNL"
FT   gene            155021..157759
FT                   /locus_tag="Pcal_0162"
FT   CDS_pept        155021..157759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0162"
FT                   /product="pyruvate phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="KEGG: pai:PAE3383 pyruvate, phosphate dikinase;
FT                   TIGRFAM: pyruvate, phosphate dikinase; PFAM: PEP-utilizing
FT                   enzyme; pyruvate phosphate dikinase, PEP/pyruvate-binding;
FT                   PEP-utilising enzyme, mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07599"
FT                   /db_xref="GOA:A3MSI2"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSI2"
FT                   /protein_id="ABO07599.1"
FT                   /translation="MGKYVYSFKEADYRNKKLFGGKGASLIQMSQLGLRVPPGFIITTE
FT                   ACKKFYEPRREEIAELEAALLKNPPPEVRDQVIEKLHKVIDSLELPQEIWREAVEYMKR
FT                   LEEETGRKFGDPNAPLLVSVRSGAAVSMPGMMDTVLNLGLNDETVKGLAKWSGNEWFAY
FT                   DAYRRFLQMFGKIVLSIDEKLFSSAWEEIKRKYGAKEDPEVPLEGLKEAVERFKQIILR
FT                   ERGGFPQDPWEQLRLAIKAVFKSWMSPRAIFYRIIEKITPDVADCTAVNVVTMVFGNVG
FT                   WDSGTGVVFSRDVATGENKLYGEFLPVAQGEDVVAGIRTPMDIEEFRKRFPHLYDELYR
FT                   GVKLLERVNKDVQDVEFTVEKGVLYFLQARNAKMTALARVKTAVDMAKEGIITREEAIL
FT                   YVKPDHVLQLLYPRIDPKAKAKPVAQGLPASPGAVSGQVVFHPDDAVRWAAEGKRVILA
FT                   RVETKPDDVHGFYAAVGILTSRGGMTSHAAVVARAIGKPAVVGAESVEIHEEEKYLKIG
FT                   DIVVKEGEWITIDGHTGNVYIGVVPTIEAELIPELEELLSWADQVRRLGVRANADLPDD
FT                   AAIARKFGAEGIGLLRIERMFRKPERLELLRRIILAESAEERRPYLEKLYKALKEDFKE
FT                   VFRIMDGLPVIVRLIDPPLHEFLPKPEEVLEQIYQRKMRGEDASELEKLYKRVKALQEA
FT                   NPMLGHRGVRVGVTHPDFYYYLNRAILEAAAELKKAGHNPVVEIMIPQVADAREIVFVK
FT                   EKSIIPALRDVEKEFGVSLNVKIGTMVETVRAALTIDEIAKHVDFISFGTNDLTQAVFS
FT                   FSRDDAENKFIPQYLELEILDANPFETLDVKGVGKLVEYAAATAKEVNPSIEVGVCGEH
FT                   GGDLKSIYFFHKTKVDYVSASPFRVPLARLAAAQAAILQSK"
FT   gene            157944..158210
FT                   /locus_tag="Pcal_0163"
FT   CDS_pept        157944..158210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07600"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSI3"
FT                   /protein_id="ABO07600.1"
FT                   /translation="MLNFIETFHREVAKRLDAVDSAGEAAGLMEWANGRVGKCDVYFLW
FT                   FPATKRLVYAVKCPAGLREGEVEAKSHVEAVAHVEKIIASLRK"
FT   gene            158207..158905
FT                   /locus_tag="Pcal_0164"
FT   CDS_pept        158207..158905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0164"
FT                   /product="putative ATP binding protein"
FT                   /note="TIGRFAM: putative ATP binding protein; PFAM: protein
FT                   of unknown function DUF71, ATP-binding region; KEGG:
FT                   pai:PAE2672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07601"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022427"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSI4"
FT                   /protein_id="ABO07601.1"
FT                   /translation="MRVAVLYTGGKDSHYALLKALEEGHEAACLIIALPRRADSYMFHT
FT                   VNIRWSLIHGDAMGIPHFAVEVSGEKEREVEELGELLAQLRRDCRFDALVSGAVASRYQ
FT                   KERVDKLAKLLGVRHLAPHWGRDQEELLREEAAHMRFIITAAMAMGLGPQWLGRAVTPD
FT                   AAEELIALSRRYGFSPVGEGGEYETYVVESPLLRVEVSGTAHWHPSGWGYYEIKEAKAV
FT                   RREIRSSHAP"
FT   gene            159043..160866
FT                   /locus_tag="Pcal_0165"
FT   CDS_pept        159043..160866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07602"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSI5"
FT                   /protein_id="ABO07602.1"
FT                   /translation="MSPSKVAGDGWDELCRHLRNIHHRYMELARFHSERCNFPGAHCKR
FT                   PWGREYTEDDLKLMWKYIEYTEPLCCKLMKGLAGVEYRIRELGIESLKRHGGLVKRSVA
FT                   HSEITKWHLNKPVLVYLTLLDTEMRVTWRELDETSLRSQQKEFMQFVDGAHGARDTRVG
FT                   VFDIDVDYKRLWLEIPLVEPVSRMLGQRDRAPVALFRNLGWLLSDDRRGSLKHSASNPG
FT                   QIALRLFDWIALAKYAIEVLNLSPNKPLVFKLAVRQATKTVMSISPTVEMWPVGTAAEV
FT                   IRGLYKWFGITLGRTEGVLVRGYAVLKALREAAFKRNGRVYVVDDAGAWIAFSNAVGTL
FT                   VLGDGNMYRTELRIAAKTTPKKTFKGETSLASELAEAVKGILAGPFIRLRPWHMRLLLP
FT                   IAPSPAFGKALNLYTSLARNPVAALVELGNAKYLLYRYDNRFGVKGVTAVELYETLKKL
FT                   DIEVKLRGNAVKFTPKQLEELAQRGVSVRFLDEIEKVAAREMIRRLEKAKKRAGRAMKP
FT                   QLDVESVRRVLVEMAKIARIIVAQYKRGEYIRIIPHDKTKACEIKAMLLSVGIRSSLLR
FT                   HKGEVRVYEKRSLEIIKTALLSIKAEAPAGI"
FT   gene            complement(161185..163056)
FT                   /locus_tag="Pcal_0166"
FT   CDS_pept        complement(161185..163056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0166"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   pai:PAE2481 acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07603"
FT                   /db_xref="GOA:A3MSI6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSI6"
FT                   /protein_id="ABO07603.1"
FT                   /translation="MWKPEREHLEESNVAKTLAERGEPLEKFLEYTYTGDFWSWFESHV
FT                   LGLRWARRYEKVLDLSRGVQWPRWFVGGFLNIGDQVEESAQPLVKWEGEDGSAAEWSYS
FT                   YVLYKARAVASWLKRAGLRKGDRVAVYMPMVPEIVPVMLGIIRAGGIFVPLFSGFGREA
FT                   IRIRLEDSEARFVFASDVSYRRGREVDMLAELEAGLAKSVEAVVLHARARERKDYVDLG
FT                   EVFRTGGDYVEVTEAEDPMMLIYTSGTTGKPKATVHVHGGFPIKAAADVYFHFDLKRGE
FT                   TLTWVTDMGWMMGPWLVFSAYLLRGSMAFFEGAPDYPKDRVWKFVERFKVKVLGMAATL
FT                   TRHLRTIGAEPGEGAGELKAFGNTGEPIDAESWWWLHKAGRGRAPIINYSGGTEISGGI
FT                   LGCYVVKPIKPTSFNGPSPGTKAAVFTEDGKPAPPGVEGELVVLSVWPGMTRGFWRDPQ
FT                   RYLETYWSKWPGVWAHGDAAVVDEDGYFYIVGRADDTLKVAGKRLGPAEVEGVLNSHPA
FT                   VAESAVVGKPDPLKGEVPVAFVVLKQGFQPSEELKRELAALAEKALGKAYGALEEIYFV
FT                   KELPKTRNAKIMRRVIRAILLGKSPGDLSALENPTAVEEIKKAIGRQ"
FT   gene            163103..164233
FT                   /locus_tag="Pcal_0167"
FT   CDS_pept        163103..164233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0167"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   pai:PAE2491 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07604"
FT                   /db_xref="GOA:A3MSI7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSI7"
FT                   /protein_id="ABO07604.1"
FT                   /translation="MLDEEHRLILKSVREFTELHVRPRAREIDRGVYPREILRKLGELG
FT                   LLAPTIPPEFNGGGSDTLTQVLVVEELARASPGVATIMEIQSSMIAENIYAMGNPRQRE
FT                   ELLPKFASGELICAFALSEPCCGSDAGAIETRAVRVGGEWRISGVKMWITSGLYADYYL
FT                   VFARTGPKEARHKAITAFLVKRGSCVEATPIEVMGVRGTGTAEVKFNECPANDDDIVGK
FT                   INEGWAVVVHALNVGRAAISGVAVGIARGAFEEALSWARGRRLFGKTLIEFQNTQFELA
FT                   EMYAAIETARTLTYYAAYLYDVKSPDFVAMAHVAKLQTARIAVDVARRAVQLEGGYGYS
FT                   KESKAEMFYRDAKILEIGEGTNEVMKYVLFKLLEKR"
FT   gene            complement(164230..164562)
FT                   /locus_tag="Pcal_0168"
FT   CDS_pept        complement(164230..164562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07605"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSI8"
FT                   /protein_id="ABO07605.1"
FT                   /translation="MDLKTLVASALAAVESGDVETIYSLVVIALRELKQKAELTPIAVE
FT                   AVLDELVAEGYAIVYEEATLDFKHKYRKYMATDKIATIAKPLPPTAQKVASMKYVTPAF
FT                   YLLLNS"
FT   gene            complement(164590..166293)
FT                   /locus_tag="Pcal_0169"
FT   CDS_pept        complement(164590..166293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3399 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07606"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSI9"
FT                   /protein_id="ABO07606.1"
FT                   /translation="MYVLSLRRGEVYMGGVKLVPTPLVEEVRKLLKEGSSVLVLGPHGV
FT                   GKSAAVFTAMYTAVGEGAAAIDLSVDTATFAEYLKVAERAKWAFGFFDALPPQFYEEPD
FT                   VWVEYATLWRDGCQRIAARSAYLQRRGYPVVLVLPRELAVRCGAYLRKFVKVRVGQSED
FT                   VARRIFEENAEVYCGDSYAEYVAAAVSKWGEGGYYMALYAAKALRYCDEDPEGLVEVAR
FT                   ASFVEKLKKYVKAVYAGPRFADVVAHRRLPGPLLSEVAHYEEVEAKVRVAERLVSLARK
FT                   IPSPHREYVEVLALQAADGLRRFTRPGWYVRSLRRVGPLCEEALVKVAEELGGGRREVD
FT                   LRLLLKGFVIAHGAYSDLAEAVLRLALGESPCVGKLARLCRGGAMGEELVNAIVHPYRL
FT                   SLDFPPLPEGPAYYASVRAEELGEDKWVEFLAFLNEEAKRRRVDVTPFRDYVELALSRG
FT                   GPEARGLALSLVEAAAVVPRDLIVYALAEASKMGRASGALVDKYVQYVGDAEALYKACG
FT                   EACRDVVVEVALAAAARARGCEALRQLEVALTAAGYGRLVEKYRPHQFCT"
FT   gene            166324..167133
FT                   /locus_tag="Pcal_0170"
FT   CDS_pept        166324..167133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3402 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07607"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSJ0"
FT                   /protein_id="ABO07607.1"
FT                   /translation="MFKIYITFAKMYVSSVLEAGVAGSRYLRLLLKQNEVKVDDALGKL
FT                   YHLLAELGYFVKRGDKYRRTNKAPPPIPSKVLGAIFDDVIVPHLLGEGVRPSHETLFAA
FT                   TAIFQGLRARAAGKLGKMPLVLVAGWLPCGFSTEVAAATGADIVILDENWEVLALEEER
FT                   VSILPLELERVLEPVSPSLFIAFEVGRLEDLALDKYGKFSAAVICHRGVDAKRAREVAE
FT                   KVYKVRFLGALGLFADLLAEALGLGQVGECAGKIYYKDADLCIMDAT"
FT   gene            167123..167611
FT                   /locus_tag="Pcal_0171"
FT   CDS_pept        167123..167611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0171"
FT                   /product="Miro domain protein"
FT                   /note="PFAM: Miro domain protein; KEGG: pai:PAE1958
FT                   conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07608"
FT                   /db_xref="GOA:A3MSJ1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSJ1"
FT                   /protein_id="ABO07608.1"
FT                   /translation="MPRRKYAVSFLGVGGVGKTTYIYRLLGLSKEPRVTRRPRFYVLRV
FT                   GDMELFLLDAPGQYAAEVAALYNEAVRKYAAQIDLVAYMYDLTAPHTLNDLFQIEVRLA
FT                   FNPRKILIGNKRDLAEELGIYTEGEEAAKALGATRVYYASALKDDPNTLLHIILENLQ"
FT   gene            complement(167603..168544)
FT                   /locus_tag="Pcal_0172"
FT   CDS_pept        complement(167603..168544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0172"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   pai:PAE3404 acyl coenzyme A thioester hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07609"
FT                   /db_xref="GOA:A3MSJ2"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSJ2"
FT                   /protein_id="ABO07609.1"
FT                   /translation="MDVLDTLTEYVAWVSQRHVNPLGNLYGGYMLHWLVDAGSITAMKF
FT                   AEGNVVLGFLDKTHFVSPVRLGDLVTYRGWVVNVRRSSMGVLVEAYVSRGGEARLATVG
FT                   RMVFVKVDGEGRPVPVGKSLTCAGEVKRLCEYFQEWRARVDEALRREERADPGWEALSH
FT                   FIAMPEDSLDGVLMYGGRLLFRLDEVTSIAALRFYPSIYVTASVNSMAFRRPIYVGDIV
FT                   SIRAGVTYVGRTSVEVGFAVEALGVRGRRLVADGYFTFVNMSGGRPSELPAGPQGDEEA
FT                   RRRKEESVREAQMLKTLKPPPARNLPWMTQLL"
FT   gene            complement(168604..168716)
FT                   /pseudo
FT                   /locus_tag="Pcal_R0002"
FT                   /note="tRNA-OTHER10"
FT   tRNA            complement(168604..168716)
FT                   /pseudo
FT                   /locus_tag="Pcal_R0002"
FT                   /product="tRNA-OTHER"
FT   gene            complement(168843..169460)
FT                   /locus_tag="Pcal_0173"
FT   CDS_pept        complement(168843..169460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0173"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="PFAM: ribosomal protein L18P/L5E; KEGG: pai:PAE2101
FT                   ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07610"
FT                   /db_xref="GOA:A3MSJ3"
FT                   /db_xref="InterPro:IPR005485"
FT                   /db_xref="InterPro:IPR025607"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSJ3"
FT                   /protein_id="ABO07610.1"
FT                   /translation="MARGARYKVPFRRRREGVTNYRKRRKLLLSRKPRLVVRKTNKHLI
FT                   AQIVIARPHGDETVVGLDTRVLSKFGWKGDENNTSAAYLLGLIVGYKARAKGIKEAILD
FT                   IGLHRPTPGARVFAVMKGVIDAGVEVPHGEEVVPSEERIRGEHVAEYAKRLKEEAPEAY
FT                   KARFSRYLQRGLPPEELPSHFEEVKKKIVEYYEQKLAKAVAR"
FT   gene            complement(169462..169905)
FT                   /locus_tag="Pcal_0174"
FT   CDS_pept        complement(169462..169905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0174"
FT                   /product="LSU ribosomal protein L19E"
FT                   /note="PFAM: Ribosomal protein L19e; KEGG: pai:PAE2100
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07611"
FT                   /db_xref="GOA:A3MSJ4"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR033936"
FT                   /db_xref="InterPro:IPR035970"
FT                   /db_xref="InterPro:IPR039547"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSJ4"
FT                   /protein_id="ABO07611.1"
FT                   /translation="MVDVKRLAAEILGVGVSRVKISPEAVGRLEEVVTKDDVRALIDEG
FT                   LIWAEPEKGNSRGRWRELHEKKKKGRRRGQGSRKGRRLDEEEAWVNKMRVMRRFLNTLK
FT                   RQGKLDPATWRQLYRMVKGNYFRDLRHLKTYINEHKLTKEPVK"
FT   gene            complement(169908..170369)
FT                   /locus_tag="Pcal_0175"
FT   CDS_pept        complement(169908..170369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0175"
FT                   /product="LSU ribosomal protein L32E"
FT                   /note="PFAM: Ribosomal protein L32e; KEGG: pai:PAE2099
FT                   ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07612"
FT                   /db_xref="GOA:A3MSJ5"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="InterPro:IPR023654"
FT                   /db_xref="InterPro:IPR036351"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSJ5"
FT                   /protein_id="ABO07612.1"
FT                   /translation="MVVVPRRELPQPLKRLLRLRLQMKRRKPEFVRIDQWRYKRIEDSG
FT                   WRNQRTLDNKIRRKWKGWPKPVEVGYRKPAAVRGLHPSGFVEVLVHRPEDLAGLDPKVH
FT                   AVRIGRTVGLRKRLEIVKKARELGFYVLNPGKEVVELLKKELNTAQPQQ"
FT   gene            complement(170411..170803)
FT                   /locus_tag="Pcal_0176"
FT   CDS_pept        complement(170411..170803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0176"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: pai:PAE2098
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07613"
FT                   /db_xref="GOA:A3MSJ6"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSJ6"
FT                   /protein_id="ABO07613.1"
FT                   /translation="MVMLDLLSNALTAIKNAEAMGKRQVVIWPVNKLIYYTLRVLQRYG
FT                   YVGEIEYIDDGRGGKYVVQLLGKINDIGAIRPRFPVKYREIVEWEQKYLPARQIGILVI
FT                   STSQGVMSHLEAKEKKIGGVLLAYVY"
FT   gene            complement(170834..170998)
FT                   /locus_tag="Pcal_0177"
FT   CDS_pept        complement(170834..170998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0177"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: pai:PAE2097
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07614"
FT                   /db_xref="GOA:A3MSJ7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023676"
FT                   /db_xref="InterPro:IPR039744"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSJ7"
FT                   /protein_id="ABO07614.1"
FT                   /translation="MPSTKPPKERPYGKSKIRCLRCGTREAVIRKYGLYLCRRCFREVA
FT                   PVLGFKKYY"
FT   gene            complement(171030..171929)
FT                   /locus_tag="Pcal_0178"
FT   CDS_pept        complement(171030..171929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0178"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: pai:PAE2096 bacterial extracellular solute-binding
FT                   proteins, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07615"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSJ8"
FT                   /protein_id="ABO07615.1"
FT                   /translation="MKSVVASIVALVVGLLLGYLLGVYTAPQATTPQAPAQTATTAPAT
FT                   ATATAPSTTPQAASQCPVSVDVIKKRGKLILGTDATWPPWEWVRGNEIVGWDIDIAREI
FT                   AKALGVQLEVRDMRFAGLLEAVRNGDVDLALSAITWTSEREKVLEFSMPYYLESVVVVT
FT                   LAKRTDINRVEDLYGKTVGVQIGTTHEEWAAENLEKPGKAAVRRYDKVYPYMVEVLRRG
FT                   DVDAIILDRSIATALVRKFPDLKISFEIPGTAGYISVAMPKCAQDLKLVVDQVIENLMQ
FT                   TGRLDEIFQRNFELFLQS"
FT   sig_peptide     complement(171852..171929)
FT                   /locus_tag="Pcal_0178"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.674 at
FT                   residue 26"
FT   gene            complement(171971..172792)
FT                   /locus_tag="Pcal_0179"
FT   CDS_pept        complement(171971..172792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07616"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSJ9"
FT                   /protein_id="ABO07616.1"
FT                   /translation="MPQRLMRRVVTIAVAAVFLFLFLGPVFERLAEYEVFLRLEGMPSD
FT                   FSAWARVWGKYGFFDMYVTVEGKDRRGYGEFVYRGKRLVVVFDREIGYERTCEAGGRGL
FT                   DCFSSRATLADLIDKLRSVPPGSYKKLNETAGKVCYVASGAWREEFCLDKRWGYVSSSS
FT                   GPDSSFVVYRFEPVFNRSAWFNALYESLKVEVVEGVRLEAVRIGGDFVTVVAAAKRDAE
FT                   VELRIAASGDVTACTRALKAGEVAALTCPLPGSPATLTAVVDGVSANITLP"
FT   sig_peptide     complement(172706..172792)
FT                   /locus_tag="Pcal_0179"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.874) with cleavage site probability 0.621 at
FT                   residue 29"
FT   gene            173179..173928
FT                   /locus_tag="Pcal_0180"
FT   CDS_pept        173179..173928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07617"
FT                   /db_xref="GOA:A3MSK0"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSK0"
FT                   /protein_id="ABO07617.1"
FT                   /translation="MKELRPVLRPSPLLRLTRQISASFTRALPGAGIHQHVVVSFSEWR
FT                   LISEILSLIGGVLLLLTSVYFFTLLLSSPDARSNLAVLGFVGLLFLLGIGLAVFSVSHL
FT                   KDVVRLWWCGRKLVKSDDFGGLLCRPGRIRFWRTTKGTEFTEFEPSGDPRLGPPEPGPY
FT                   YFNRSSGGFVYGCRVEEGPCRGLLLAVFDPSKACSLQGEVSASSKEGDWARGVVEPAGP
FT                   GLVRARLECNLVRARGRGLCYMSIRMR"
FT   gene            173958..174173
FT                   /locus_tag="Pcal_0181"
FT   CDS_pept        173958..174173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07618"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSK1"
FT                   /protein_id="ABO07618.1"
FT                   /translation="MEAVVDLRGFEKPVFVVGAGEISIDSIKELTETKIAGLCASIYMR
FT                   LVLDKPHAVDVEAKKRISPVNVPQQT"
FT   gene            174542..175639
FT                   /locus_tag="Pcal_0182"
FT   CDS_pept        174542..175639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0182"
FT                   /product="D-proline dehydrogenase"
FT                   /EC_number="1.4.99.-"
FT                   /note="PFAM: FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   pai:PAE2095 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07619"
FT                   /db_xref="GOA:A3MSK2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSK2"
FT                   /protein_id="ABO07619.1"
FT                   /translation="MKVAVVGGGIVGLFAAYFLRREGAEVVVVEQGEVGGWSRAAAGIL
FT                   EFTRFVINRINVRSYPLNYFKMALRGNARVKTWDWRWISAYLRAWGREPPQEMWEAVKA
FT                   LGEFSRRHYRAMAEERNDFDYAEEPLYEVGVDVGKALEEAKRDPLAPRVEAGECCGREA
FT                   LVYLDAAKLSTDAFVERMKRELEGVEFVRARAAEVAGGEVWLEGGGVVKADAVVVAAGY
FT                   WARRLGIPVAPFKGYGFRTTAKAGKMFVDMSKGVAVVPLSRWTKVTGRFDLDGTGDHRP
FT                   AERVLKRAREALGDFQAVDMAVGYRPCTPDGFPVVDRVGSVVVATGACRLGWTYGPALG
FT                   RLAADLALGKRGLDALSAARFFRRL"
FT   gene            complement(175626..176159)
FT                   /locus_tag="Pcal_0183"
FT   CDS_pept        complement(175626..176159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2087a hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07620"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSK3"
FT                   /protein_id="ABO07620.1"
FT                   /translation="MFLEFDDPFSLSSQISTSLPLVFIIGGEAVEATARRVVYHWNGYP
FT                   TLVLHVETPLAYKVVEASVWQNQWFNDAVRVKTPRETADFLSAFYLFDTFKIVARDAAR
FT                   VVKEVWFKARRGCLFAESALPGFVWSFALAAARFGIDPALKSLEKFAEEHGVEVNWGRV
FT                   PLVRAVASALLTGV"
FT   gene            complement(176159..176812)
FT                   /locus_tag="Pcal_0184"
FT   CDS_pept        complement(176159..176812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0184"
FT                   /product="3-Cys thioredoxin peroxidase"
FT                   /EC_number="1.11.1.15"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   pai:PAE2085 peroxiredoxin, probable"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07621"
FT                   /db_xref="GOA:A3MSK4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSK4"
FT                   /protein_id="ABO07621.1"
FT                   /translation="MSEAKGPYLGMKIPEDLCFNTDHGPKCFKDYKGKWLLLFSHPADF
FT                   TPVCTTEFVAFSRKYEEFKKRGVELLGLSVDSVYSHIEWKRQIEQNWGVKVPFPIIADV
FT                   DMKVANLFNAIPPGQHLTVRTVALIDPELKLAWFAAYPYTNGRNIDEILRIIDAIQFSY
FT                   KYGVATPADWKPGEPVIVPPPATVENAAKRLSEPGIECKTWWFCTKKYEAVVKA"
FT   gene            complement(176911..177438)
FT                   /locus_tag="Pcal_0185"
FT   CDS_pept        complement(176911..177438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0185"
FT                   /product="Protein of unknown function DUF429"
FT                   /note="PFAM: Protein of unknown function DUF429; KEGG:
FT                   pai:PAE2091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07622"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="InterPro:IPR018036"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSK5"
FT                   /protein_id="ABO07622.1"
FT                   /translation="MFKLTAILNVAVVGIDLAVRRPTAVVALRGCEVFYMGLAGGDGEV
FT                   LRVASLARPRVVAIDAPLSLPEGGRGLRDVEVELRRRGYKLLPPLMGPMRLLTERGIRL
FT                   SQALGAEVVEVHPLTSLRAMGLSRRRVAEWLGVGHGDLVDAAAAALTALAYLQGRYERI
FT                   GPFVLPTARVCL"
FT   gene            177439..178170
FT                   /locus_tag="Pcal_0186"
FT   CDS_pept        177439..178170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0186"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   pai:PAE2089 short chain dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07623"
FT                   /db_xref="GOA:A3MSK6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSK6"
FT                   /protein_id="ABO07623.1"
FT                   /translation="MPTAVVTGGSTGIGAATVKALAKAGYNVAFTYLRNRDKAEEVTRE
FT                   AASHGVRVIHRAADATSWEEMAQFAEEVKRQFGRVDALVANAGGLPERRTLDESALDYW
FT                   RRVVDLNLTSAYIATKLFTPLMEKGVVIYVSSVAAYTGGGRGAFAYAAAKAGLLGLTRA
FT                   LAKELGPRGIRVVAVLPGLIDTPFHQKAGTGDIHAWAANAVYLRRVGTPEEVAEVIAFL
FT                   ASEKASYINGAFIDVNGGWYG"
FT   sig_peptide     177439..177507
FT                   /locus_tag="Pcal_0186"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.801) with cleavage site probability 0.777 at
FT                   residue 23"
FT   gene            complement(178359..180158)
FT                   /locus_tag="Pcal_0187"
FT   CDS_pept        complement(178359..180158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07624"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSK7"
FT                   /protein_id="ABO07624.1"
FT                   /translation="MECQRQLEGYRRYVELARFRSGKCRLPGRACGYAEADIRLMWQYI
FT                   EDTASLCGNLIKALAEAECKFRELGIKGLEKGYRVGVTRPDKSRPDHEIVTLYLKKPVY
FT                   ATIVLWEKRLYIFYDDVPIGNGLRGEELEETARKTGRAGVPVETYEVDEEYKRLWLEVP
FT                   LPKSASKLLGGRDKTPIVLFRNLGWLLSDDWRKNLGHAAGNPGQVAVRLFDWIALAEYA
FT                   MERGITPKAPLAFTLRIRKVTKTRHGDNPTVEAWPTGATYEALFVAYDWFGITLGSTEE
FT                   VLMRGYSALKALREDAFKLDGRMYVVSNVGAWIAFSNAVDMLVVGDGYVLPYEVRIAVK
FT                   TTPRATLAGETSLLEELADAVGGTTAGDYVRLQTWHMRLLLPTQPTPALEKTARLFETL
FT                   ANYPAAAIVEVNGITYLLTHNGGGEFVIGRGRAVELYNALERLGIKERFKRNLLLLTYA
FT                   QLEELARRGFTVRFLNDMEKDAVREVRPALPTPDLDAVRRVLEEVAKMARIVAATDRGR
FT                   LYIRIIPHDKSKVEEIAAKLRAVGIRATILHKKKEVRIHEQKSVEIIRRIAPHFFHPLY
FT                   IPLHKALLLIHYQTILASPFTKN"
FT   gene            180870..181208
FT                   /locus_tag="Pcal_0188"
FT   CDS_pept        180870..181208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07625"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSK8"
FT                   /protein_id="ABO07625.1"
FT                   /translation="MTVASREPHVEAAERELTHRLYSLGIDVEPSVLAAYVERYGEKAF
FT                   NAVVRDVAKALAASYRVPYAAGEAEELMKEVCPRTSVSRPQGGKGGGGQGRRRERSLKA
FT                   HSTTIGYT"
FT   gene            181846..182508
FT                   /locus_tag="Pcal_0189"
FT   CDS_pept        181846..182508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07626"
FT                   /db_xref="GOA:A3MSK9"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSK9"
FT                   /protein_id="ABO07626.1"
FT                   /translation="MSVNRALLAILIIYHVLFLAFLPVGKPPYSEALLGYLAAYPLIYL
FT                   IYLIAVSPHGKDIEVGPEVAVGFALVYLLIYAPLLAIGRGWDEEPGAWAEYIVSFLIAI
FT                   FGALVYALLDPNVKPQDRARLIRAVAPLLVLHAVYALAALFADRPVLWYFATYPAALAA
FT                   AAAGGGRLPTLAATAIYLAAYLLDAVPLLLLLIAVPVAWRPAAERADLHAAAERRQG"
FT   gene            182799..183965
FT                   /locus_tag="Pcal_0190"
FT   CDS_pept        182799..183965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0190"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pai:PAE2559 tetracycline resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07627"
FT                   /db_xref="GOA:A3MSL0"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSL0"
FT                   /protein_id="ABO07627.1"
FT                   /translation="MAGPRAVRYVLLTAAVLHMMGFSAVVPVTSTLVKSLGGDSVVQGL
FT                   LASAFTLAQLVSAPLWGWASDRLGRRVIIAVGLGLAAIGHAGLYLARDLPTAFVARAVS
FT                   GLGGGTLPVIQAAVLELSRPEERAASMAQFGAALGIGFVAGPLLGGALSILSPRDPFLA
FT                   AAVLSATAALWSTAVYESAPTAAPQPKAEGRGAGVNPLYLVVFFLLNASYAQLEAFISF
FT                   YGGDLGLRPMYVGIAMSLASAAAVTAQTVVKRLEKERPTDSDIAIGLAVMAAGLATAAV
FT                   PTPYTYFTGVVVSAAGQVIATAFISKAVATSANRVGLAFGEMQAAGSLGRLAGPVDEGL
FT                   LYKTLGPTPSFLEGAGLAAMGLLLIIGATRLNLTPTLPTLSQDKREKA"
FT   gene            184299..184410
FT                   /pseudo
FT                   /locus_tag="Pcal_R0003"
FT                   /note="tRNA-OTHER1"
FT   tRNA            184299..184410
FT                   /pseudo
FT                   /locus_tag="Pcal_R0003"
FT                   /product="tRNA-OTHER"
FT   gene            complement(184431..185123)
FT                   /locus_tag="Pcal_0191"
FT   CDS_pept        complement(184431..185123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0191"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: pai:PAE1128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07628"
FT                   /db_xref="GOA:A3MSL1"
FT                   /db_xref="InterPro:IPR010397"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSL1"
FT                   /protein_id="ABO07628.1"
FT                   /translation="MSVVLGDITGIDILLAFVDAVESVGMKFEHAKWLFIAGLIAGVIG
FT                   NFTFEYDYGATFLLSNAVWLAGVYYLAEWYRSRDIFKNSLYSFIVSLIYMYVIYADFLK
FT                   EFAEVRELEKKGVLDIAVALGLATDPLLLYLGFLILSWPFLVVSSYFLRRAFRRLGEVG
FT                   GVGAFNTAAKLIWIGAWISVIFVGYFIIMVGYIFSLIGAFGLKQPQKQATDQSPPPPGN
FT                   AGFEIVVS"
FT   gene            complement(185454..188873)
FT                   /locus_tag="Pcal_0192"
FT   CDS_pept        complement(185454..188873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSL2"
FT                   /protein_id="ABO07629.1"
FT                   /translation="MSCEFYERLAAGPLGRLLTERGDRFFKVVKLLAGALPFVSSLAEV
FT                   AELVADLSRPGLAGELVELIKAAKSTGRCDEEVKRAAEKLGVSEEWLRTLVKNLAALPE
FT                   VDLAKLEERLKRLGEGLELLRRLSPHLLDLGQVFVEEGGRLLVNSPFGPVEYVEVGVED
FT                   EVRRALSSGRVVVVCGPRGVGKSTVALKAIYDFAKAQPDRAVVVVRVGEDWKEALRAAA
FT                   RLRDGPFVPVLYYDTLEVGGYRRRGEGIDVMYSAMAHAKPLADFLHDAALLRVPTVVVL
FT                   TEEDYRAYEDVANLVGAEAVCMGGEAEALVRGILRGVPDAVAEAVLERYRGEFYAVAAA
FT                   LARALYEEWRDPAKVAEAVKRLDVYSLALAYLWHVVLGGDEATARQVAPLILATGLFGP
FT                   HPPKLAKAVIRVFGKEPEEAVVLWFSQPLHGTLYETIRKVAHGAVYRRFGVGDDELCQG
FT                   SAEGPCRLVEICAEALVGVPRRRYSGIEEMAVEYAKVIAEKFKAPGPAGMRQIDYLIDN
FT                   FLQAFNGVAEDGRWKIRYETKTPWGIEIVESVVDELDILSALYGLAVLPDWSRLLKPLE
FT                   DWFFVGDERTNAVGPYLFFNLKEGSRKLAKRAVVIAKEVEERGFYTHVDLWRAVGIAAT
FT                   GDWSNATDEELENVVRLLDYVFGRFASVSTQLLHGVEPPLAEAWRRVESGRASSRLADW
FT                   LAMATHNVARSSPVGLLFFFTIAKDSQAPLAQRFAALYNAGSNVAKLWLLNTLLYALVS
FT                   PVGLIVAAGSLNTQVEPWETFKELAKRVEEFVSRLNDVEKAYAVALLHPRLAYWYSLFD
FT                   EVSKAEKFADKAVGALEELKRSYTEDRVSTEEKLWEYLRVMQIRPDLRKELSGLSAYVH
FT                   YHVAFAYMVADDLEKAAKHAKLSYELAMESGEVYYEVASCSLLARLKAVKEGAPPVEEF
FT                   ERAWLRALQDVNSLGVEAIANALGHYVVALASVGRLSDVKKVLEEWGWALERDLDASAL
FT                   TYGVLSLLDGRYLGKAVEYLPEWARANLPKFVEVLYEAVDAGLFAEGDAEAATRSIEEK
FT                   YGQEAEKALTWTTLDSGKLFLSALVGLAYCERGEEWGLNLAKVTSRHGSSSNGLHGRLF
FT                   RELAKALEETTVGNCITDEVLKAAYKLYYSQV"
FT   gene            190639..192069
FT                   /locus_tag="Pcal_0193"
FT   CDS_pept        190639..192069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07630"
FT                   /db_xref="GOA:A3MSL3"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSL3"
FT                   /protein_id="ABO07630.1"
FT                   /translation="MGGCFPTEGDFAILELVEVKKRYPIVKINAVPYLVEAVHRYFKEA
FT                   EGRGCVVDEGLKRYVAERIRSLLEKHGVDLRTMLTYDLHGVNKDVLDVLKMLGLEQAPP
FT                   PRPTAAPHLPVPKKSRAAVSAPPPPPPSPQSAKPILPPPMPPRGYKPPQRRRNGVDISF
FT                   ALKFFAFVAAVIVAAVGLPMLYLIVFEHATITPTFANTLDDPAVRVAFETLNRYRVENG
FT                   LPPLEFITLKTPLFRAEYIYNHSRMRHYDVEGRHPNYYYTLLDGGVYAVEENLAKTMCG
FT                   PCIARDVVKQIYAMVYDDWLSLWGHRDSLLDPCNNKVSIAVARDFNTIYTVVYMVAVWA
FT                   NWIEPPRYYNGTFSFKGYVYLPPRGNFYEIFIYRDVPSPLKYDDVSYNIGEPYAAVLPP
FT                   TVSIEYLNVTNIRADRYVLRREGDRWYVDVAFRFEPPDNALYTVVMFANSTGVKWEPKS
FT                   PWGWDRLRRCEIFEYTIG"
FT   gene            192399..195086
FT                   /locus_tag="Pcal_0194"
FT   CDS_pept        192399..195086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0194"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07631"
FT                   /db_xref="GOA:A3MSL4"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSL4"
FT                   /protein_id="ABO07631.1"
FT                   /translation="MLLGTTMWRTKLLLVLAFLLLLSAVASAQIKWAKHINPTSGIDKG
FT                   YGTCLFGNYLVIVGRAGDSPFLALLDRESGEVVKMWSRGSGWFINCIAVGDSLYAAGYV
FT                   EERDEYYQIYVFDRNLNVINRVQVNNAGLRDIIYWDGYFYIGGYVWKDFGGQYKPVWYI
FT                   EKRAPDLSLVAYREIYDANWEDSDVYNVGVNPVTGDVWAVGYYTVGGVERPLVAILDKN
FT                   LNLKRLIQLPGYTGFFGGICFDREGNAYVSGNRTTVKYDKSGNYIKRYSGGGLITCIKD
FT                   RLYSFAHVNATVIVPMHQLVYSVIDMETMERIKQVDLPASSIGIFNLTTVYAPGRPSFD
FT                   GRYVYAAGVLDLGFRTEGGMITRDTEIVVFAVPVVSTVKVVDSSGRPLAGFVVRGVTDS
FT                   YSLVNSTGADGVASFWGLAPDVVYVFDRSGRLVWVGNVTSLVATVTVRLANSLPATSPA
FT                   DLRGYLVLKRVLFIDGSTRDVKYNFQLANGVLTVEGDVPLDVPYPVEVYVTEFSIGSAT
FT                   LVLRGGAYLAYSGTARDLANGLDFGNLFTRLEVSAVDSTGAARSDWAVQLIYQGAKLAE
FT                   GRGALTVVVPRTSVLGQPYVAKVVTTALAPDGLAATREQLVAAEGDRREVRLVVNTTRV
FT                   TVLAVDGFGQRRDWPVEIENVARGVGYVSAELLDGAVYTAKASGLGFTNVTKFVARGPE
FT                   MSVAVKIPTARLTARVVDGFGNVRSDWPVEVVGVGSGQGSVAAEVLAGRYMVRATAFGR
FT                   EFAREVEVAPGQNVVAAVQVPTARLKIYVVDDDRKPIDQYVTSVEVSGPVAQSFSRPPG
FT                   DIEVLAGQYTVTVTALGKLASSQAVLQPGQYATVEVLVPGTAGIDIGGTRITYSTLYTI
FT                   LGVAVAVAVIGFVVVRLRSRGKGH"
FT   sig_peptide     192399..192485
FT                   /locus_tag="Pcal_0194"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.981 at
FT                   residue 29"
FT   gene            complement(195289..195858)
FT                   /locus_tag="Pcal_0195"
FT   CDS_pept        complement(195289..195858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE1102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07632"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSL5"
FT                   /protein_id="ABO07632.1"
FT                   /translation="MDTSILYALCPQTPRDATIRKRIIDLLRKSDKVYVPDLALLEARE
FT                   VALSRGKSHQEAIRLTQELFKCANEAIFPLGVGEIEVVAVEPDDLAYDPHVGFYDATIL
FT                   TMGARRGFYVVTAERDLRYFSFARDVGAKAVNDCLWRLAKYYHHAAERHVGSRDPTTIV
FT                   KWINERGHRIRKWEEKYGECIETVET"
FT   gene            complement(195927..196469)
FT                   /locus_tag="Pcal_0196"
FT   CDS_pept        complement(195927..196469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE1101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07633"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSL6"
FT                   /protein_id="ABO07633.1"
FT                   /translation="MLAERSVALDEVEKTIAAIVHYFGNVSLRLLNKAFAYVALKRPEL
FT                   AQHVVVGEHGYIIEGWRERLAKLEAAGLVHVVGGGKWPRIEKAGSFEIPSDLLPILERV
FT                   KKIVEKYGVEGLRRLVEKKTLLSGVKYEFIGHKMTEVLEYARQVREEIKRNRERCPGCP
FT                   SVEEFLRIRRRLEHVSD"
FT   gene            196661..197377
FT                   /locus_tag="Pcal_0197"
FT   CDS_pept        196661..197377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07634"
FT                   /db_xref="GOA:A3MSL7"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSL7"
FT                   /protein_id="ABO07634.1"
FT                   /translation="MPSWRVHRALVLLAAREVGLPEGLLGGLLRGVVEPDEVPDKVLVS
FT                   GRRRSYFRRVGHHGQLHRALVEYYYNLACFYRARGDLYSAGRALGRAAHYLQDAAVKTR
FT                   KWLIFDVHDEVEAEMGRLVGSLPHVCSRPAGDAAVSLCKAYADTVQLFRRFVSEPVVDR
FT                   ATGRRLLWRGRLKKWSAIAALGSALVASVFAALAWGFLASVAGLYLALRWTPGEYVAAM
FT                   RAGVHRVEPPGYETAM"
FT   gene            complement(197503..198108)
FT                   /locus_tag="Pcal_0198"
FT   CDS_pept        complement(197503..198108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07635"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSL8"
FT                   /protein_id="ABO07635.1"
FT                   /translation="MEFYLTEDGVAIYHKGRRIVAPVLYLTPTLHYVQHVAPHVAKRLA
FT                   DMGIDKFYTDDEAAGRIIELACGGKCRYAKDGADIEQVMEYAYYNYLADKVVAAAIHAD
FT                   TLVLPCADKPLAKALARRAREAIPGITLIAAGRGCPDADHHHDPTPLQTPIPLGPTSRA
FT                   VLATAIWAIDEGLAEAPVAPLLDAQCTQSALQVPITHP"
FT   gene            198141..199358
FT                   /locus_tag="Pcal_0199"
FT   CDS_pept        198141..199358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0199"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   pai:PAE2070 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07636"
FT                   /db_xref="GOA:A3MSL9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSL9"
FT                   /protein_id="ABO07636.1"
FT                   /translation="MDFELSREDRLFLESVKSFAERVIAPRWVDLDEGKWPIEEAAARL
FT                   GEAGLLGIPLSSKYGGQDGTFLQAALAVEELAYADPSLAVPVYVLLETAWPYMVQRYGR
FT                   EEAKEEVLPEVARGRAFVGIGSTEPQGGSDVASVVTKAVKEGDLWKLYGEKNMVTGVAT
FT                   ILNLPYGGGVVAITRTGRVEDKHRGITTFLALLKRRGRVTPGFTHRDWDEIGRHGLPTG
FT                   YLTLEGLPVEEVFMLGELNGGFKVAMEGFNLARTVIGAASVGAARWLLDRGLEWIRQRV
FT                   VFGRPIASYQAVSFRFAELYARLQAAQLAVYKAAWVADRFYRGDSAFTVQDVATAGAVA
FT                   KLLAVPLAVEVALEVMKWFGGASYFKETNVARALLGVLSYYVGAEGAENIMKLIIARNV
FT                   VGREFV"
FT   gene            199355..200047
FT                   /locus_tag="Pcal_0200"
FT   CDS_pept        199355..200047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0200"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; SMART:
FT                   helix-turn-helix domain protein; KEGG: pai:PAE2071 adenine
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07637"
FT                   /db_xref="GOA:A3MSM0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSM0"
FT                   /protein_id="ABO07637.1"
FT                   /translation="MKRVEGLRVQLDAVAYLKSVKKLLGVTYRELSALLDIPESVLSRY
FT                   ATGDMLPSVATAEEMLARLEKAYPVPEVVRAKVKVYESYVDMSFAYLPEFWQLYEVYLA
FT                   RRFAGVEVDKVLTAAVDGIPLAVAAASRFEAPLVVAKTYKEPGVENYEYTYLREGRPAT
FT                   LYVPSPLLRRRDRVLIIDDIARTGRTLRALAELAARAGAVVVGASVLVAKSGFSAGVDF
FT                   PVDVLYTY"
FT   gene            200075..200491
FT                   /locus_tag="Pcal_0201"
FT   CDS_pept        200075..200491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0201"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   pai:PAE2072 conserved protein with 2 CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07638"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSM1"
FT                   /protein_id="ABO07638.1"
FT                   /translation="MITVSDVLKRPPVTLPESATIRDVATALSQNRVGLLVLVSKDDPK
FT                   RPVAVVSERDVLRAVAQRLDLDGPAMSIANRPITVLDTDPVYVAAEKMRAHNIRHVVVV
FT                   DKEGRLVGVLSIRDICFERAALLELAAREAPATP"
FT   gene            200503..201315
FT                   /locus_tag="Pcal_0202"
FT   CDS_pept        200503..201315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0202"
FT                   /product="ExsB family protein"
FT                   /note="PFAM: ExsB family protein; KEGG: pai:PAE2074
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07639"
FT                   /db_xref="GOA:A3MSM2"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSM2"
FT                   /protein_id="ABO07639.1"
FT                   /translation="MAKCKAVAVVSGGPDSTCYTALWMKRGCDVHALSFLYGQKGAVEV
FT                   EKAQAVLKRLDELAAKRGWGRVVEHKVVDLSSLGELWRGTQLTDAGVAVEREYAPTVVV
FT                   PIRNVVMAAVATAYAYTLRAVSGAKVYVILGSHYDDIRPREDTWEPLYPDCSPECFEAL
FT                   QAAFRICHFRGERDVELWTPSREGLRKSQLLKLCYDEVGNLVYETWSCYLSDEAHCGRC
FT                   ESCRNRHRAFLEAGLPDCTAYLSPPGDGFEKRGNFYIHVSCTHRQSRL"
FT   gene            complement(201294..202070)
FT                   /locus_tag="Pcal_0203"
FT   CDS_pept        complement(201294..202070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0203"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: pai:PAE2075 nitrilase,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07640"
FT                   /db_xref="GOA:A3MSM3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSM3"
FT                   /protein_id="ABO07640.1"
FT                   /translation="MFKLGIAQIGPGAVDTVAKMAAGSEPDLILLPEYSNFDPTGLPPE
FT                   EVYQRADELQTFADKLARIAAEAGAYVAGAFLERGPKPKVYNTTLLVDPSGKVRGLYRK
FT                   THLFDAYEYRESAFVEPGGELSPVYEVKGARVAFAVCFELRFPEVFRELALASAQIALV
FT                   PAAWYAGPLKEETLHVLARARAIENGMYVAVAALYGQRFTGRSLVVNPFGVVEAELGVG
FT                   ERYRVVELDLSLVEKARETVPTLRLRRPQLYKRLCR"
FT   gene            202132..203901
FT                   /locus_tag="Pcal_0204"
FT   CDS_pept        202132..203901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0204"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="PFAM: aldehyde ferredoxin oxidoreductase; Aldehyde
FT                   ferredoxin oxidoreductase-like; KEGG: pai:PAE2052 aldehyde
FT                   ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07641"
FT                   /db_xref="GOA:A3MSM4"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSM4"
FT                   /protein_id="ABO07641.1"
FT                   /translation="MYGYSNRLVKVDLSSGKVVVEPLEVGVARRLIGGKGLANWLLYQY
FT                   GIWRFDPLSGDNAIVFATGPLAGSMLPMTTRAWAAFRSPLTGILGGSNVGGTLGSVMKY
FT                   AGVDALMIVGRAERPVYLVVRGDGVEIRDASHIWGRDAIETEEVLKRDHGRDAAVLAIG
FT                   PAGENLVKFASINHEYWRQFGRTGGGAVLGFKRVKAVVFLPVRREVEVARPEEFREFAR
FT                   RFVKRFVEDAGIRAYREGGTPRLVEVAASTGFLPSKYWAEVTIEGWEKIAWPSIRAGYF
FT                   LGPGACLHCPAACHRLVESKKFGVRVDLEYETIYALGSLLGITDLDCIIRLNDLADRLG
FT                   MDTISLGNVVGFAIRMAERGAISLGVGWGDCEGVERLVLDIAYRRGVGDLLAEGVRAFA
FT                   ERIGALDEAVHVKGLEPAGYDPRTLRGMALGFAVAGRGADHLGTMAYAIDIAGRAGGRL
FT                   SLSEEKVRAIIEFENLGAVMDSAPLCKFGRSVYTFDVIAEALRAVTGFDYTGREVAEAG
FT                   ARIVTLTRLINVKMGVDKRADLLPKPWLRPVKFEGVEYSIDPAEFEKALEKYYELRGWD
FT                   KEGIPGEEALKGL"
FT   gene            complement(203888..204577)
FT                   /locus_tag="Pcal_0205"
FT   CDS_pept        complement(203888..204577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0205"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   pai:PAE2078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07642"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSM5"
FT                   /protein_id="ABO07642.1"
FT                   /translation="MEVYVGTSGWLYSWNLGKSLKWYVENSGLNAVELNASFYRYPTPR
FT                   QVAQWAEVGKTLRWAVKVHRGVTHLGRLSDRAVERLGNFLSLFKPLDPLVDFYLFQLPP
FT                   TFRPSGENMRRVEAVAALLGRRAAVEFRHPGWFTEATAKWAERAGFVAVSVDSPEASWI
FT                   VATGGVVYLRMHGRTFWYSHYYDEEELREVARRIVETGAERVYVFFNNDHAMLENARAM
FT                   ASILRGL"
FT   gene            complement(204580..205761)
FT                   /locus_tag="Pcal_0206"
FT   CDS_pept        complement(204580..205761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0206"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: tvo:TVN1161 predicted carnitine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07643"
FT                   /db_xref="GOA:A3MSM6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSM6"
FT                   /protein_id="ABO07643.1"
FT                   /translation="MPIYPLKGVRVVDLTSAMAGPFATMLLADLGADVVKVEPPEGDHA
FT                   RDWGPPFYAEKYSAYFASINRGKRSIVINLKEEKGREVLYRLVKSSRVFIESFRPGVAE
FT                   KLGIDYRTISKINPDIIYCSISGFGQYGPYRDLPGYDLIALAMSGLMDLTGEPDRPPVK
FT                   FAVPITDIVTGMYCVIAILSHLYAGVGGYIDMALLDSAISLLTHQAGYYFASGKDPQRM
FT                   GSAHPTIVPYQAFKARDGYFILAVGNDHLWKMFCEAIGRRDLAEDERFKTNYDRVKNRD
FT                   LLIPLLEEIFSKEDVAYWVERLRKAGVPVAPVYKVSQVVQDPHVKARGMVVETEHREIG
FT                   KILTLANPIKATAIDVGNYTPPPKLGEHTEEVLKELGYTEGEIAELKKRGAVA"
FT   gene            complement(206229..207344)
FT                   /locus_tag="Pcal_0207"
FT   CDS_pept        complement(206229..207344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0207"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: tth:TTC0953 immunogenic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07644"
FT                   /db_xref="GOA:A3MSM7"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSM7"
FT                   /protein_id="ABO07644.1"
FT                   /translation="MKLIQRSMDKKVGILIAIVVVIIAAVLAVWLASTPPPTTTPKPAT
FT                   PSPTTTTTQPTTTQAPTVSRITIATGGIGGVYYYYGSIIASILNNYTDIRANAIQTAAS
FT                   IDNLLLIRDRGVEYCATTLPDSAYLAYTGQHPKFANKTAPIAILWAMYPNYLHIVTKAS
FT                   TGIKTIYDLKGKRVSTGAPGSGTEVNALSVLQLVGIDPAKDFAKWEKLGVQESAKALAD
FT                   GTIDAFFWSGGLPTGSIVELSALLKQRGDQIVLISIPDDVIKAYAEKYPGVAARGVIPA
FT                   SVYGAPQDAVTLAYWNFFVCHKDLPADVAYKITKAVFEHLDILQKSVAAAKDTNLKNAL
FT                   IALGGKIPYHQGALKYFCEAGLQQACQALSK"
FT   sig_peptide     complement(207258..207344)
FT                   /locus_tag="Pcal_0207"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.815 at
FT                   residue 29"
FT   gene            207404..209422
FT                   /locus_tag="Pcal_0208"
FT   CDS_pept        207404..209422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0208"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="TIGRFAM: TRAP transporter, 4TM/12TM fusion protein;
FT                   PFAM: TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: tth:TTC0952 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07645"
FT                   /db_xref="GOA:A3MSM8"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSM8"
FT                   /protein_id="ABO07645.1"
FT                   /translation="MKYAFNLALIVKVLAILGALYQLALVIYPYFLHGVPIFDYTQLVR
FT                   ATHIFFLLIVGYLRLAAIPLQYRFRLSGIVLYLLTLPFLFELFYILPLPLFVSAVAVWL
FT                   LAFMPVCIRYVAAALGVAALAPYIYIVVNYQELIYRAITPYPLDVLMGWIELLLVAGLV
FT                   YRFIGPVLPGLVYVFMLYTRYGSSLPGQWASPGLPLDLIIAKIYIETEAALWGIVTNVS
FT                   VMYIAYFMIFTALLAALGFGEEVARIAMKFIGKRPWGVGNAVVAAGVMMGMVSGSGAAD
FT                   TAFIGGTFKDLFKRAGYSPYVAAGLVANAGTLAIITPPIMGSAAFIMVEILGIPYLWVI
FT                   VMAIVPALLYAWSIASYNRYYAKAANLRPVEVEVSGLKYYVFAPIALIVALIALGFSVR
FT                   LSVTVAIFFTIGMALALPSFRPRATRIWSGLAEGILSLAPIGTSIAMANVMMSMVVLSG
FT                   LANTFSQALLNIVANNLLVAILFASVFTLIISLGMTPTAAYVLSSVLLAPALIKLAEVS
FT                   GVPTIVATLATHMFLFYYAMMADIDPFTGLSTYAAAGVFGLRPIRVGIRAISVAAAKYF
FT                   FPPLSLISYNAAAIYVLPILLTSPPLTAAYLIGVRVAAVAAGVWLLSIANAGFYRKPLP
FT                   LVARLIIAALGIAMIIPNELVNLASFALALAILRLRY"
FT   gene            complement(209444..210043)
FT                   /locus_tag="Pcal_0209"
FT   CDS_pept        complement(209444..210043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0209"
FT                   /product="pyridoxal phosphate synthase yaaE subunit"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   pai:PAE2820 glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07646"
FT                   /db_xref="GOA:A3MSM9"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSM9"
FT                   /protein_id="ABO07646.1"
FT                   /translation="MKIGILALQGDVEEHRYALEKAAAELGLSVKVVEVKNAQDLADIS
FT                   TLILTGGESTTIGKLAKAKGLEDNIKKATLPILATCAGLIYLAKEAVDRRVGKTRQSLL
FT                   GLLDVSVVRNAFGRQRESFQTELEVRGFGKVNAVFIRAPAVVKIGPSVEPLASLRHVDY
FT                   GEVYAAVRQGSVLATAFHPELTTTAFHKWLIREAKR"
FT   gene            complement(210040..211050)
FT                   /locus_tag="Pcal_0210"
FT   CDS_pept        complement(210040..211050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0210"
FT                   /product="pyridoxal phosphate synthase yaaD subunit"
FT                   /note="PFAM: Vitamin B6 biosynthesis protein; KEGG:
FT                   pai:PAE2819 stress induced protein, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07647"
FT                   /db_xref="GOA:A3MSN0"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSN0"
FT                   /protein_id="ABO07647.1"
FT                   /translation="MSIVPAVVELEKIRDFFYRLAEARDRLREAGFRHPAEVPLAVGTP
FT                   LVKLGFIAMLRRGVIMDVTNVEQAQVAEEAGAVGVMVLDKLPYDVRKAGGVARMADLKI
FT                   IEEVMDAITIPVSAKVRIGHFYEAVLLEQIGVDLIDESEVLTPVDEQHHINKWLFKTPF
FT                   VNGARELCEALRRISEGASMIRSKGEAGTGNVAEAVKHFKAIYGAVRDLTAHRDDEEYL
FT                   RDYARRCQVPLEVVKLTADMGRVPVITFAAGGIATPADAAFMMWLGADGVFVGSGIFKS
FT                   QDPERRAEAIVLATAYWDDPEAVAEAQKMVSEKASMMGIDIRALKPEELLQTRGV"
FT   gene            211280..211609
FT                   /locus_tag="Pcal_0211"
FT   CDS_pept        211280..211609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07648"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSN1"
FT                   /protein_id="ABO07648.1"
FT                   /translation="MALGAVAFQPWPGVSHLELGRHLVECIKKMLRVGGELKWRDVVRR
FT                   GRPEAILALIQAAAEVRYTAFHYTGEAKLAARLEELVRGADLVVLDNQLLPRGLKVGVK
FT                   TVERD"
FT   gene            complement(211626..212966)
FT                   /locus_tag="Pcal_0212"
FT   CDS_pept        complement(211626..212966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07649"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSN2"
FT                   /protein_id="ABO07649.1"
FT                   /translation="MVTRRKFLTWGILGLSAAVGGGLAWKLLTEGGEAADSSPVREKSA
FT                   WFEALAEEPSDDKVVLEFVDEADNPVDFTAFLLWEPDGEVEEVAIRGGRLELDKKRVKE
FT                   RVDRWRDWLKERDQPLETENTLFAVLPTSLTAEFLPYADIVAKPKLKNKKYKIHGQQKK
FT                   QNKSSYFATCPEAKVVYVSDINLSNYVPAVALRDTSSKAFGEYIDFSYIVNGSALKFNV
FT                   YGGLSLGFGTQMRITGEQSWSTGNLNIEGGRTYIFKGLDESAAIMFYSTIWRYIVYDVY
FT                   DLNTCGVVDERADLYLLNLGFENGSIALRSVGNLPAEIFSSTQISESRYLQGIDGKGGD
FT                   ANMLRWVDMLVNEPLIDVSGSIHVGGWPVGGIINKLGYPYSELIKRLHVGFGFQVYGGK
FT                   ANYVSTVVTDANAGVSYILGIHRASYTHYLKDYVFRPLNIMGTLLDS"
FT   sig_peptide     complement(212892..212966)
FT                   /locus_tag="Pcal_0212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.964) with cleavage site probability 0.472 at
FT                   residue 25"
FT   gene            213108..215330
FT                   /locus_tag="Pcal_0213"
FT   CDS_pept        213108..215330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0213"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor aEF-2; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: pai:PAE0332 translation elongation factor aEF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07650"
FT                   /db_xref="GOA:A3MSN3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004543"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSN3"
FT                   /protein_id="ABO07650.1"
FT                   /translation="MSSAVRIVEKQLDEILAIARNPAQIRNAGTLAHVDHGKTTTTDSL
FT                   LMGAGLLSPKVAGKALAMDYVPIEQLRQMTVKAANISLYFEYGGKPYLINFVDTPGHVD
FT                   FTGHVTRSLRVMDGGLVVVDAVEGVMTQTETVVRQALEEYVRPVLFINKIDRLIKELRL
FT                   SPQEIQQRILSIVKDFNALIDMFAPPEFKDKWKIDPGKGQMAMGSALHKWGITIPMAQK
FT                   AGIKFSNIVDAYEKGYVDKLAEEFPLYKTLLTMIIEHVPPPNVAQKYRIPRLWRGDLNS
FT                   EVGKALLEADPNGPTVIAVSKVNKDPHAGLIATGRVFSGTIREGDEIYIIGRKMKKKVL
FT                   QTYIYMGPTRIIVPYMPAGNIVALMGVDEARAGDTLVTPSLADIPPFERMRYISEPVVT
FT                   VAIEPKNPAELARLVEALKDLVIEDPTLDLKIDQETGQILLSGVGTLHLEIATWLLKER
FT                   TKVEFSVSPPLIRFRETVRERSQVWEGKSPNKHNRLYFYVEPLDETTVELIATREITEE
FT                   QDPRERAKILREKAGWDTDEARGVWAIDDRYFNVIVDKTTGIQYLREIRDYIIQGFRWA
FT                   MEAGPLAQEPIRGVKVVLVDAVVHEDPAHRGPAQIMPATKNAIFAAFLSARPTILEPLV
FT                   RLDIKVAPDYIGAVTSVINKHRGKILDMTQQEYMAFLRAELPVLESFTISDELRAAAAG
FT                   KIFWSMQFSRWAPYPESMLADFVKQLRKKKGLKEEIPKPTDFVEAF"
FT   gene            215423..216436
FT                   /locus_tag="Pcal_0214"
FT   CDS_pept        215423..216436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0214"
FT                   /product="ABC transporter, periplasmic binding protein,
FT                   thiB subfamily"
FT                   /note="TIGRFAM: ABC transporter, periplasmic binding
FT                   protein, thiB subfamily; PFAM: extracellular solute-binding
FT                   protein, family 1; KEGG: pai:PAE0331 thiamine-binding
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07651"
FT                   /db_xref="GOA:A3MSN4"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSN4"
FT                   /protein_id="ABO07651.1"
FT                   /translation="MSIRALLATLIVVAVLIVAFLALQSLQQPPKRLVIVGPAGISDLG
FT                   KALAKKFSEKYGVNATFVPLGGAVEMVNELVRAKDNPPWDVAIGVPEFYYTVLIEQGVL
FT                   YCPGLKVEGVPAEEFWDPHGCVYPLDKSYIGIVYNESALAKLGLPPPQTLDDLLKPEYK
FT                   GLIAYPNPVQSGTGLAVLSWIMSVKGEEEGWRFLKQLAGQIAKVGYPSGFTSLRNALKR
FT                   GDVVIALSWYSHAIDPGTPHMRAATYSAFLYREGVAVLKNAKNRDLAVEFVKFALSKEG
FT                   QDLVDPYNYMLPVRPDAVVENNKGLPQPQTVVVYNPALGSKADEWRLRWQREIASG"
FT   sig_peptide     215423..215506
FT                   /locus_tag="Pcal_0214"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.515 at
FT                   residue 28"
FT   gene            216409..217833
FT                   /locus_tag="Pcal_0215"
FT   CDS_pept        216409..217833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0215"
FT                   /product="putative thiamine transport system permease
FT                   protein"
FT                   /note="KEGG: pai:PAE0329 putative thiamine transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07652"
FT                   /db_xref="GOA:A3MSN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSN5"
FT                   /protein_id="ABO07652.1"
FT                   /translation="MAERDSLRVIPLLFLTAFLAPYLILLARYGIAFAVDEYTLWVFFF
FT                   TLAQALASAAFSVVAGLALLPIYVRAPALKPVVMVPFFAPALSTVDALIRMLGDVMYSP
FT                   WGIVIAHVVYYAPYAALLMESNLRSIPADILDAAEIYARRLSTKARVIFTELKPSLAYS
FT                   FYTIFVFSFLTFTTPLLLGGRYPTLELLVYLYATSFASTQLVSTVVLITLLSSLALALP
FT                   FFKLPTLPPAEPSPRAPKLGLPAVLPSLPLALFYLALAAYLVLPAASPRGLEGAWTPLV
FT                   NSLLVALASSAISLALAVSFLFSDVVGSRLPAVSYVAAISLSKSLFAIGFFHLAQPLYG
FT                   TLPILLVAHVFVITPLVYSIVKPAFEKIRQDAREACLLYLGPVRCVARILSEALGPTIV
FT                   QAWLVALASSISETTLAFILTTGAASTLSAEAARLLTSRAPDLIETGHFYSSLMAVIVL
FT                   ATLALSRLVKTKPYAF"
FT   gene            complement(217821..218747)
FT                   /locus_tag="Pcal_0216"
FT   CDS_pept        complement(217821..218747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0216"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pai:PAE0328 thiamine transport ATP-binding protein;
FT                   TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07653"
FT                   /db_xref="GOA:A3MSN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSN6"
FT                   /protein_id="ABO07653.1"
FT                   /translation="MAISLRGVEKRLGGFFLGPIDLEVERGGRVAVLGPSGSGKSTLLR
FT                   IVAGLLRPDKGRVYIGGKDVTCKPPWARGVGVVFQSPALFPSLTVLENVAEPLLSRGVR
FT                   KSEAFEKARHVLEKVGLGGLEGRYPSELSRGQQQRVALARALVVEPEVLLLDEPLTALD
FT                   APLKNELLPYIYEVARGRTVLYVTHDFEEATYISERVVVVMGGKVAAEGKAVELFENPP
FT                   SPHVAKLLGYSNVLKAPCGYLYFRPWDVEEEGPLEGKVVGVWYRAGRYEVVAVVGEAAV
FT                   RLILAKPPASSTIRFKVSKGVCFPQKA"
FT   gene            complement(218747..219328)
FT                   /locus_tag="Pcal_0217"
FT   CDS_pept        complement(218747..219328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07654"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSN7"
FT                   /protein_id="ABO07654.1"
FT                   /translation="MNQQKKDRVNIAVAKDVAERLAAVAESLGMTQYALANQILATGLE
FT                   LVQQGFKVQQIREIAEFYKVMVELEVVPVPGRLLDKMVADMYKENPEVVEKAWCEAGKM
FT                   LASYIKAVYGGLDSALSLVPYFSKVIPAKRFDVKASGDELVVDAVGVGYGVESVKATAA
FT                   GARCFLEDLGYEVKEVITAPGILRVRAVKK"
FT   gene            219430..220479
FT                   /locus_tag="Pcal_0218"
FT   CDS_pept        219430..220479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0218"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: pai:PAE0309
FT                   chlorohydrolase, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07655"
FT                   /db_xref="GOA:A3MSN8"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSN8"
FT                   /protein_id="ABO07655.1"
FT                   /translation="MRLRAKYLLVGDLELVENGVVEVDDQGVVVGVGKYTGGVAADLGN
FT                   VVLMPQLLNAHVHVLDAAMADRDDLYIDDLVGWPHGAKYHVVKTLVRRRRHIPLLRAVA
FT                   RRMRGYGVGCAVVYAEYAARDVEEVFRGEGIEALVFQEAHGDFPDYPHVQVASPVDHPV
FT                   DYLRELRRRYALVSTHVSETEDCHEAGDLALTLEALDADVLVHLVHVTPEEAAAIPPSK
FT                   TVVVNPRANAYFVGKVAPIPLLLHLKPLLGTDNVFMNEPDPWAEMKFLHAYSAAAGWGL
FT                   GEREILSMATVWGWEKLKCPPPIEVGQKMRALAVAAPYAGDKVLKYLVKRVSHRDLVAF
FT                   VEGTRILPV"
FT   gene            220653..221606
FT                   /locus_tag="Pcal_0219"
FT   CDS_pept        220653..221606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0219"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pai:PAE0315 ABC-2 type transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07656"
FT                   /db_xref="GOA:A3MSN9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSN9"
FT                   /protein_id="ABO07656.1"
FT                   /translation="MAEGTCPYLLVSEKLIFQLGVAVVIVCENLGRRYGDFWALRGVTF
FT                   EVGKGVVAGVLGPNGAGKTTLVRILTTELMPSEGRALVAGLDVVKEAEKVRRVIAAVPQ
FT                   EARPIDFLTPYEFVYSYLLLRGYPRREAKRRAEDALKTFGLWEVRGREIDTLSGGMKRR
FT                   VLVASVFAADVDVVFLDEPTTGLDVYSRRMVWNAVSEMKRRGVTVLLTTHYVEEAAALS
FT                   DVVVVINRGRVVDIAPPGALVEKVPGRYVVEVYGTDGAVAESRARIKIGDRVLYYVDSP
FT                   PPLAEPRGAKIVVRPKSLEDYILINVGEVEEDYEDD"
FT   gene            221593..222318
FT                   /locus_tag="Pcal_0220"
FT   CDS_pept        221593..222318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0220"
FT                   /product="ABC-2 type transport system, membrane protein"
FT                   /note="KEGG: pai:PAE0316 ABC-2 type transport system,
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07657"
FT                   /db_xref="GOA:A3MSP0"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSP0"
FT                   /protein_id="ABO07657.1"
FT                   /translation="MKTIKDALVIAWINGWIAATRGWIWVVASSVSPLSFLVLLAIYGG
FT                   VEGLLWGVLGSLVWTIASNGISLMGDATYYRLGIKYQSMLTAAPVSPVGYAIGLALSAF
FT                   VFATPTLAFYIAVILWLGVPLASPVAAYALVTLWLASAGLGFTLSSFIRHMRYAWALPQ
FT                   ILTAVFTVGAPVYYPATVLPTPYLGVVVPTGAAGVLLQAATGLANYSADLQAAAAVALA
FT                   LQSVLGLYLLAKVARWRQQ"
FT   gene            complement(222414..222743)
FT                   /locus_tag="Pcal_0221"
FT   CDS_pept        complement(222414..222743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0221"
FT                   /product="GTP cyclohydrolase I"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: pai:PAE0317 GTP
FT                   cyclohydrolase I, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07658"
FT                   /db_xref="GOA:A3MSP1"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="PDB:5JYX"
FT                   /db_xref="PDB:5K0P"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSP1"
FT                   /protein_id="ABO07658.1"
FT                   /translation="MLKVSKSPSLVRLKTRGESVCPISKTVDSFEVSVEYIPRGAVLAI
FT                   EEFKKMVDSYRGREILHEELAVDLLEKVKAAVNPPYVKVTVKSYYIGVEVEVVAESGGV
FT                   PPVYI"
FT   gene            222805..224394
FT                   /locus_tag="Pcal_0222"
FT   CDS_pept        222805..224394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0222"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: pai:PAE0318
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07659"
FT                   /db_xref="GOA:A3MSP2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSP2"
FT                   /protein_id="ABO07659.1"
FT                   /translation="MCVVEKWREDPFYGAVAVVKAEGYVVGDFTGGIHGAFRDYVELPP
FT                   GVYTVGGEECAIEPLSYPWHFSVPYMAARWGDVVELRIYATEELEVPGGFVAKLADVGP
FT                   FSVYLAATRGASYVVKCCGRSRRFKAPHPGEAPRLSALYEVLPDRAGPGRGCRDLSKQF
FT                   CGGTLKDVAELAAGAVDFADGLYLHPIYPAMSYHRYDVVNHFDVDERVGGWAAFYALKE
FT                   ALSKVGMGLVLDLVLYHVAPRSPLFPDGPFVIKSAEGARLVKKLVEILPREALRGVFSG
FT                   EPPYETFLKVWLMPRLDYTRREAVEYARRVVEFWAPHVDGFRLDVAHGIPPEAWRAALE
FT                   PARGRYVFGEHVGNPAPFYHVIRGFTAYFLYHHGVKRLGEGVEEVARGVNRYLALTPPS
FT                   AVPHMNLFLENHDLDRAASFLSPDAVVMGYALIYSLPGVPSVYMGGECGEVGRAEDHTN
FT                   RRPFPGCGGHPLKSFLAKLFAARKRLGLSAGPAYAYTRRGRLVLWRGDVEVEVERGRAV
FT                   FTSPGGSLEIFI"
FT   gene            224412..225554
FT                   /locus_tag="Pcal_0223"
FT   CDS_pept        224412..225554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0223"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: pai:PAE0320 P.aerophilum
FT                   family 417, putative ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07660"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSP3"
FT                   /protein_id="ABO07660.1"
FT                   /translation="MDLGFRGVTAIYGRPGVGKTTLAMRMAHERLQRGERVLWVSLYED
FT                   KETFHKNASLLGYDLSKADFWDFVFVRTDAMLNQIVSAVSQEAYGLVVVDSMSSVLEGA
FT                   QAREYLINAVYRVFKPAGVDLVAIAEEESATPLDYVVDNLLRLEMRLANGVTERRMYVV
FT                   KSRGRRAGYYVEFDILEGRGLVFIDELPKPAARGGFEAWSDAVSQAVGPIKGGCAYLFL
FT                   GGALTPLLAKAAADLSKAGLKVLYRVQGKDAESVRRLVEKFGGKAVVQRAAPRPQSYFA
FT                   HVMSLYESLNETGADVVVSDGVDLEFLLYGKKALDINLHEVQELRGLGVALLIGMSRDR
FT                   GLRHAADAVVSIRGGEAVAHTPEGRRICKVEHAPEPALAC"
FT   gene            225558..226745
FT                   /locus_tag="Pcal_0224"
FT   CDS_pept        225558..226745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0224"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="PFAM: amidohydrolase; KEGG: pai:PAE0322
FT                   dihydroorotase (pyrC)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07661"
FT                   /db_xref="GOA:A3MSP4"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSP4"
FT                   /protein_id="ABO07661.1"
FT                   /translation="MCIRVEGRAYLNGRFTRVRIGGEDCRTVQYSNDFLILPGMVDVHV
FT                   HFRDWELAYKETLAGGAAAALAGGVVAVGDMPNTRPHIRTAELYQRRLREGASLPIIYR
FT                   LHMGVPADLAELDLAKPRTVKIYPEDIAQFGWAHVKSLLQKCAELNCVAVFHCEDPQLF
FT                   RDGERPPEAERLCVEKVRALAAETGARVHLTHVTLAETVETARGWATVDVTPHHLYLDT
FT                   ENCRDRGLCLVNPRLRAPDARKRLLAALAAGLVDMYATDHAPHTLAEKASENPPPGICS
FT                   LDVALGLLLALWKRGVLALGDVVRLYSHRPARLLGVDVDPLAGTFTIVKLEEYTVKGEE
FT                   FAGTCKFTPLEGLKAFGRVVATAVRGVVYFRDGEAKPLWPTAVSQPRGTPPSTYP"
FT   gene            complement(226696..227172)
FT                   /locus_tag="Pcal_0225"
FT   CDS_pept        complement(226696..227172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07662"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSP5"
FT                   /protein_id="ABO07662.1"
FT                   /translation="MFLVLVKSDSRELVKRLGRMVDGLELLEGVFLVWAPRDKVAKAVD
FT                   AVKRNVIRRWEEEGRGPMFEVAVVELGEAQYKEVRPLAKAVVEKMAEALLEEMERLHEK
FT                   MRSGDRKVLGWYRDVAARYQRLVDISLALDIEPSIMGRLRDKWKEVSLEAGRLR"
FT   gene            227352..228272
FT                   /locus_tag="Pcal_0226"
FT   CDS_pept        227352..228272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07663"
FT                   /db_xref="GOA:A3MSP6"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSP6"
FT                   /protein_id="ABO07663.1"
FT                   /translation="MKIALGTPLSAVPKPWLYFDVPALIINALEAKRRNPRLALGYEGE
FT                   LWLDSGGFQVLRKGLQLAVEEVAEVYRQVEAQYYLSLDVPPSPTDPPDVAEKKFEKTYR
FT                   NWVRLSRAVEGVVPVLHVYRDEGLFLKYLRRYLDAPVLAIGGAVPYVLITRGVPRGSRE
FT                   YALRLIKTAREEFKGKLHVLGLGSPSVTPILEALGVDSTDTSTWRVKAAYGKVILPGGG
FT                   ERHVTGRKVNFGPKKALEEELEELRAFLAQTGFPALTPDFSQRLAESFEYRALVNAWVV
FT                   LHSRTAPRSPAFRKLYAALAAPHSG"
FT   gene            228302..228724
FT                   /locus_tag="Pcal_0227"
FT   CDS_pept        228302..228724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0227"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   pai:PAE0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07664"
FT                   /db_xref="GOA:A3MSP7"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="InterPro:IPR039127"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSP7"
FT                   /protein_id="ABO07664.1"
FT                   /translation="MKYRLMDVLACPYDKTFPLRLVVLKRREYPERQYTWPRKPFCEEY
FT                   CAYRDLKIKDHPKPDTLPCEECHKWEIEAGVIYCPTCGRWYPIIEEIPRMLPDELRNEK
FT                   EELEFLRSVAEDLKKAAPDIAEKILQQGKPFNLSTK"
FT   gene            228761..229177
FT                   /locus_tag="Pcal_0228"
FT   CDS_pept        228761..229177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07665"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSP8"
FT                   /protein_id="ABO07665.1"
FT                   /translation="MLPELSDLDLENPSFSASGPAEYTVSFGRPCKVGANVRVDSLLFA
FT                   WPRVFSRALVAVYRCEEFWPHYDVKTRAVSVGKSIYVMVDSVARHAEQDAETVPLEEGP
FT                   LWRYVAKIGGAALCKTLREVLHIEAKCKMYGRLY"
FT   gene            complement(229174..229803)
FT                   /locus_tag="Pcal_0229"
FT   CDS_pept        complement(229174..229803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0229"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   pai:PAE0274 superoxide dismutase (sod)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07666"
FT                   /db_xref="GOA:A3MSP9"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSP9"
FT                   /protein_id="ABO07666.1"
FT                   /translation="MQVKKYELPPLPYAYNALEPYIAEEIMKLHHQKHHQGYVNGANAA
FT                   LEKLEKFRKGEAQIDIKAVLRDLSFHLNGHLLHSIFWPNMAPHGKGGGKPGGRTADLIN
FT                   QFFGSFEKFKEEFSQAAKNVEGVGWALLIYEPKTGQLLVVQIEKHNLMHIANAQVLLAL
FT                   DVWEHAYYLQYKNDRGSYVDNWWNVVNWDDVEKRLEDALNGKITKV"
FT   gene            complement(229846..230616)
FT                   /locus_tag="Pcal_0230"
FT   CDS_pept        complement(229846..230616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0230"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: pai:PAE0270
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07667"
FT                   /db_xref="GOA:A3MSQ0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSQ0"
FT                   /protein_id="ABO07667.1"
FT                   /translation="MIGEVYALYKREVLKLVRSRYMWIMIVAQPLMWILFFGNSLAGMP
FT                   SAFLRQYFGVDNYLAYMLPGMISILMMSTGMFASMSLVFDKRVGYLKRILVTPTPKAAI
FT                   HLAKALGAVTRGLLAAPVILLLGAVLGVQYTVNAIALAEWLVALVAAGVGFASLFTALT
FT                   ANTADVQAPGVVMNFITMPLMFTSTALFPRQFFPTWLQAISDANPLTYLTEIGRSALVY
FT                   GAVPPPSHFAAVLIFAATATALGAIVVEKTLTAD"
FT   gene            complement(230613..231563)
FT                   /locus_tag="Pcal_0231"
FT   CDS_pept        complement(230613..231563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0231"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: pai:PAE0269 ABC-2 type transport system
FT                   ATP-binding protein; TIGRFAM: daunorubicin resistance ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07668"
FT                   /db_xref="GOA:A3MSQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSQ1"
FT                   /protein_id="ABO07668.1"
FT                   /translation="MAIRAEDLRKRYGDVVALDGVTFHVEKGEVFGLLGPNGAGKTTTI
FT                   KILTGLTRPTSGRAWVAGFDVVKEAREVKKRIGWIASEVIVDDELTAWENLEIQARLVG
FT                   VRDWRERAGELLKYFGLWEAAGRPVGKYSTGMRKRLEVAMALLHGPEVLFMDEPTVGLD
FT                   VGARVGLWEVVKSINRDFGVTVLLTTHYMEEAEALCNRVAIINRGRIVAVGTPDELKAK
FT                   YGVDVIELEVSGRPDVASLSKFGEVVAVDGRIVIKTRGAEEVLPEVVKAVEGVKSVKVK
FT                   KASLDTVFINLTGASIEGEQTDIRQLYMRIRRARR"
FT   gene            complement(231592..232143)
FT                   /locus_tag="Pcal_0232"
FT   CDS_pept        complement(231592..232143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0232"
FT                   /product="peptidase S26B, signal peptidase"
FT                   /note="TIGRFAM: peptidase S26B, signal peptidase; KEGG:
FT                   pai:PAE0264 signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07669"
FT                   /db_xref="GOA:A3MSQ2"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSQ2"
FT                   /protein_id="ABO07669.1"
FT                   /translation="MREWVKDLIWFVAIVVALVAYARATGVAWPIAVVSSYSMEPTLRV
FT                   GDFVILAGASCETASPGDIVVYVARNPMWAGSWIIHRVYSKQVGSSCGLVTWGDNNNLP
FT                   DQAVGEPPVGNNLVGKVVLTIPYVGVFPMVVRPQGIGPVALAAWMGRLALFGGLVYGFY
FT                   AYFKLGEKRRRRSKRQAKLK"
FT   sig_peptide     complement(232075..232143)
FT                   /locus_tag="Pcal_0232"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.777) with cleavage site probability 0.460 at
FT                   residue 23"
FT   gene            complement(232172..233314)
FT                   /locus_tag="Pcal_0233"
FT   CDS_pept        complement(232172..233314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07670"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSQ3"
FT                   /protein_id="ABO07670.1"
FT                   /translation="MKWWPELIDEISLKPPALHFLFGPRQVGKTTLLKLLVKKLVEGGR
FT                   DPRTIFYYTCEMAADHRELGEVLGEIVKLKKRWGVSSALVLLDEVTYPREWYRALKFYL
FT                   DQGHFQNDVIIATGSVSMYAKREVETFPGRRGWGRDYVMYPLSFKKFAEVQGVPPGADP
FT                   TAWRTELAEALELYLKCGGYPAAVVNCATSGNPGGAADVVISSLAFDLARLKRSEAYAK
FT                   RLLKAVLETAPSPVSLNALAKEAELRSHKIAFSYLNLLESLYLLRQLYYIDPYRLVEDY
FT                   KKPRKIHLLDPLVYQAAAKWTGAKIPHEAALLEATVAMHFARSHRVGYWRDGFEVDVVV
FT                   PELGLGIEVKWGKKAGMKRVGQIVAKTLDLEELAQLLYQL"
FT   gene            complement(233438..233773)
FT                   /locus_tag="Pcal_0234"
FT   CDS_pept        complement(233438..233773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07671"
FT                   /db_xref="GOA:A3MSQ4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSQ4"
FT                   /protein_id="ABO07671.1"
FT                   /translation="MRYLEALLAVVIFVAAASLAFPRIAPLAARVGLIAAIIIAALWLY
FT                   SYVTSRPPPLASRVLELIRARGPLAARDIVAALGADPAEVEKALEYLVERGAVRRIKRG
FT                   DVEYYDL"
FT   sig_peptide     complement(233711..233773)
FT                   /locus_tag="Pcal_0234"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.957 at
FT                   residue 21"
FT   gene            complement(233770..234765)
FT                   /locus_tag="Pcal_0235"
FT   CDS_pept        complement(233770..234765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0235"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: pai:PAE0262 prohibitin
FT                   homolog (HflK family)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07672"
FT                   /db_xref="GOA:A3MSQ5"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSQ5"
FT                   /protein_id="ABO07672.1"
FT                   /translation="MAHIPIEVRGPSRRAAAIVAVVIFGLLVASVLLALSAYTLPAGVV
FT                   AVVVDPVTGTMSKPVKGPAFGFKAPWAYLIEDTYAVEVIEFVAVERGAGRYEFAAPTVL
FT                   TKDGVTVTVEMVVRYKINPDRFDELAKKFPGVDYDDKVLVPKARQLIRDVISKVSLDYL
FT                   IENRDVIARQIEQQYREAIESDPTVAGLVEILDVNVQNFILPQQITDAINRKIAAQQDA
FT                   IRAQFERQRVEELARANYTRVVLNAMAEANATLARARAQAQQILLVANATRSAIEMLIR
FT                   AAGANATEAARLAELYIYLMGLRDIAQAGNVQIVAISGGGGQVVPVIPLR"
FT   sig_peptide     complement(234661..234765)
FT                   /locus_tag="Pcal_0235"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.848) with cleavage site probability 0.252 at
FT                   residue 35"
FT   gene            complement(235078..235686)
FT                   /locus_tag="Pcal_0236"
FT   CDS_pept        complement(235078..235686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0236"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: putative RNA methylase; methyltransferase
FT                   small; Methyltransferase type 11; KEGG: pai:PAE0261
FT                   methylase, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07673"
FT                   /db_xref="GOA:A3MSQ6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSQ6"
FT                   /protein_id="ABO07673.1"
FT                   /translation="MFQSRRELEIFVERLPTFKRPKLRLEQYPTDAAIVATAVWDAYMR
FT                   GLLDSVVDLGCGTGRFALAAAAMGARRVLCVEVDVEALEVARQAAAGLGLDVDFLAADA
FT                   TAPPLARRFDVAFQNPPFGIWSGRGTDVAFLRSAVELADVVYTIHKLATLDYIRAQVEK
FT                   WGFRLDVLEKAVLKIKPMYKHHRKRIHNVEVFLARVAKP"
FT   gene            complement(235661..236101)
FT                   /locus_tag="Pcal_0237"
FT   CDS_pept        complement(235661..236101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0237"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pai:PAE0252 diadenosine
FT                   5'5'''-P1,P4-tetraphosphate pyrophosphohydrolase
FT                   (MutT/NUDIX family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07674"
FT                   /db_xref="GOA:A3MSQ7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003565"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSQ7"
FT                   /protein_id="ABO07674.1"
FT                   /translation="MYDEVSAGAVVYYGDGGGAEYLLLHYPAGHWDFPKGNVEPGETPE
FT                   AAALREVKEETGLDVELVEGFREEVEYVYYRGGRRVRKKVIFFLAKAHTKEVKLSWEHV
FT                   GYAWLPFDKALARLTYDSSRRVLAKAHRHLRAVYNVSKQKGA"
FT   gene            236144..236815
FT                   /locus_tag="Pcal_0238"
FT   CDS_pept        236144..236815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0238"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pai:PAE2785 ABC transporter ATP-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07675"
FT                   /db_xref="GOA:A3MSQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSQ8"
FT                   /protein_id="ABO07675.1"
FT                   /translation="MRVEIVVKDVVKYYGDYPALRGVTLEVPRGVWQCLVGPSGSGKST
FT                   LLHIIGGVDKPTKGTVEVAGVRLNDLNDDQLAEFRNKNIGFVFQMFYLIPRMSILENVE
FT                   LPLILRGVPKARRREAALEALRLVGLGHIDPRRRPTQLSGGEQQRVAIARAIVTRPRIL
FT                   LADEPTGNLDSATTKVIMDIFTQLKKELGITIVMVTHNLELLSYCDRYARMRDGRIVEQ
FT                   G"
FT   gene            complement(236812..237513)
FT                   /locus_tag="Pcal_0239"
FT   CDS_pept        complement(236812..237513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0239"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pai:PAE3211
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07676"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSQ9"
FT                   /protein_id="ABO07676.1"
FT                   /translation="MKRRTLLASLAAAPLAYLAVGAGAVGIKATELDWGLGRRVLFLTD
FT                   LHIHGEWHAPALGEYDLVLIGGDTYDEWTRDLQAVVEALGQIRGPKIAVLGNHEHWASR
FT                   RIPLSVGIRALEDAGVHVLRDDWVQVGSLRIFGLDWREDPRSYPAVKDADVVLVHSPDA
FT                   FHSAVGGLYLAGHTHCGHWCLPWGGAVFTNSAFGYTCGLYKRGAAAMYVSAGLGGMWPR
FT                   VFCPREVVFVY"
FT   sig_peptide     complement(237454..237513)
FT                   /locus_tag="Pcal_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.362 at
FT                   residue 20"
FT   gene            complement(237510..238859)
FT                   /locus_tag="Pcal_0240"
FT   CDS_pept        complement(237510..238859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0240"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: pai:PAE2535
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07677"
FT                   /db_xref="GOA:A3MSR0"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSR0"
FT                   /protein_id="ABO07677.1"
FT                   /translation="MWRVAITIAGLDSGGGAGVHADVKTFAALGVHGATALTCVTAQNT
FT                   YEVRRAECLDPGLVREQIMAVWDDMGIDAGKTGMLGTRGIIEEVAATVSKLGFPLVVDP
FT                   VMVAKSGAPLIAEDAMEALAKRLLPVAKVVTPNRYEAERLTGMRISSVEDAKRAAEYIH
FT                   RELGAEVVVVKGGHLDAPEAVDVVYVGGTFHELRAPRLNSRATHGTGCSFSAAIAAGLA
FT                   KGLAPLEAIKTAKELITTAIKYGVARGKGHWAVNSTAWVEIPAERWRAYEAMSAALRAL
FT                   EERGAEVARYIPEVQSNLGYAIDPRYASGRGDVAAVPGRIVNYMGKARPSGPPTFGASD
FT                   HVARKILAAMGKDPRIRSAMNIRLDWGLVEKAKALGMAVAVVDRRNEPEEVKAREGGSM
FT                   QWVVEEAFRQTGGRAPDLIVDVGDWGKEPMITILGRDPLDVLEKLFKLIT"
FT   gene            complement(239302..239775)
FT                   /locus_tag="Pcal_0241"
FT   CDS_pept        complement(239302..239775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0241"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pai:PAE0163 MutT/NUDIX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07678"
FT                   /db_xref="GOA:A3MSR1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSR1"
FT                   /protein_id="ABO07678.1"
FT                   /translation="MCLEKRWPAGGPEWAAVGVLLRDGKTLLIKRVQRAGDPWSGQVAF
FT                   PGGRWKPGEDLLGTAVREVQEEVGVTPRGLVGVLEPHSPRNAPWLKVVPFIFTEWEGEV
FT                   APNPREVAEARWVSKAELSEEEWISGYAFVHRDWVIWGLTYRILKRLIDCGIL"
FT   gene            complement(239866..241092)
FT                   /locus_tag="Pcal_0242"
FT   CDS_pept        complement(239866..241092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0242"
FT                   /product="translation initiation factor 2 subunit gamma
FT                   (aeIF-2g)"
FT                   /note="PFAM: protein synthesis factor, GTP-binding;
FT                   elongation factor Tu, domain 2 protein; KEGG: pai:PAE0064
FT                   translation initiation factor aIF-2 gamma subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07679"
FT                   /db_xref="GOA:A3MSR2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSR2"
FT                   /protein_id="ABO07679.1"
FT                   /translation="MTFVYPDAIVSTAGHVDHGKTQTTYALSGVWVMRHSEEIKKAMTI
FT                   KLGYAQVGIYDCGDEYYYSDGLLQDGKCPNGNEPKLVRMISLLDVPGHEVLVATMVSDA
FT                   AVVDGAVMVVDASQPVPQPQTAEHFAVLDVIGVRHMVVAQNKIDLVTREKAIENYQQIR
FT                   EFLRGTWAEKAKVVPISALHKVNIDVLATYLAKEIPRREAETGKPARFSVLRSFNVNPP
FT                   GTPPEKLRGGVLGGTLLQGVLRVGDEIEIRPGLKLEKGYQPIRTKVLSIEYSGHKVEEA
FT                   RPGGLVGIMTGLDPALTKADALAGAVAGKPGTLPPVWTAVEIETRPMPRMGGEKPEPIK
FT                   QGETVLVAVGPATVFGVVQSVKKDVATVALKKAVCAEQGAKAVLIRQVKTRWIVTHYGV
FT                   LRGGTVALE"
FT   gene            241160..242188
FT                   /locus_tag="Pcal_0243"
FT   CDS_pept        241160..242188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0243"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: pai:PAE0063
FT                   transporter ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07680"
FT                   /db_xref="GOA:A3MSR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSR3"
FT                   /protein_id="ABO07680.1"
FT                   /translation="MAVVRLEKLRKVFDRVVALDDVDLQVGDGEIVAVLGPSGCGKTTL
FT                   LRLVAGLDEPTSGRIYFDDRDVTDLPPQKRGTALVPQTWALWPHMTVFENVAYGLRLRK
FT                   LRPEEVAKRVKSVLELVGLSGLEKRKPFQLSGGQQQRVALARALVVQPEVLLLDEPLAN
FT                   LDAKLRVELREEVRKIAKKLSITTIYVTHDQEEAMAVADRVAVMNAGRILQVGKPEEVY
FT                   HSPAHFFVATFIGRSNVLRGRVVERRGEAAVVDVGFPLAAVAVDKAAPGEEVHVVFRPE
FT                   DVYMGGGGVKCQVEDVAFLGRYYQVTLVCAGRRIKAEGPKPPALPGEEVAVEIARAWAF
FT                   KP"
FT   gene            242185..243987
FT                   /locus_tag="Pcal_0244"
FT   CDS_pept        242185..243987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0244"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pai:PAE0062 molybdenum
FT                   transport system permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07681"
FT                   /db_xref="GOA:A3MSR4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSR4"
FT                   /protein_id="ABO07681.1"
FT                   /translation="MIKWSAAVGYIYLGLFLLFPLLFIFWQVVEGVAEVYKLVADPFYV
FT                   NLSPDAFASAVYIREGNPPTLVVRGPDLGVIFNSLWVALTVAAVDTALGFLLAYALAKY
FT                   VFPGRTALGLLATVPLIVMPFATAYAVRKFLDPRWGTLNWLLNDVLGIPLKVEISGLAA
FT                   VALVQSLMYLPIAYLNIYAALTRVDPTLEEVANNLGADERRAVRDVVLPLATPGLAAAF
FT                   VLVFIFAIDDVAAPIIFQDDPAARKLLSYQVYSRFLDQLRGQISPTAAFLALVLLTIAV
FT                   TSFLAVRKYVGLRQYAMLIRQLRPRIYKPGPLGKVLIYAVAFPLALVASAPLLGAISLV
FT                   FAERWTTSPLPESPSLSTAAERLAAVFQNELFVRGIWNTVIYGVSATLIMVAIGVAVAI
FT                   AAARLRGPAADALDALATVPIAVPGLVVAYAYFLTSLAAVSWLRPISPALADLLDPLRH
FT                   PEFYLVVGYSVRKLPFVVRSIYAGMQQIHPSMEEVALNLGDSYWGVVRKILLPLLVTNV
FT                   ISGALIGFVYVTSEVSLSITLGVLKGVGRDTAMPITAFMRERFESGLYGVQDAATLGLL
FT                   LVLIQVTAITLTTRVLKTRYGFVL"
FT   gene            244037..244402
FT                   /locus_tag="Pcal_0245"
FT   CDS_pept        244037..244402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07682"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSR5"
FT                   /protein_id="ABO07682.1"
FT                   /translation="MTLLPILNIYIVSGGMGQTIDPRDKMRFGEDSTRLVEAGARAAAK
FT                   ELGIRLVVEDMRVEIGDVVAEFDGGRLRIGSLEVSVDEDQWAGFKTLLLSFLANHRRPP
FT                   TEAEVKELIFAATGREP"
FT   gene            244694..245839
FT                   /locus_tag="Pcal_0246"
FT   CDS_pept        244694..245839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0246"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; KEGG: pho:PH0626
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07683"
FT                   /db_xref="GOA:A3MSR6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSR6"
FT                   /protein_id="ABO07683.1"
FT                   /translation="MDEFPLLLHVGYFATAGVGIPPVSAARAVAEYVQLAVEDPEEAVA
FT                   AAGKAAEVARTAFAELIGASPGEVAVAGPGTLAALERALTAVGCSAGRNVVTDDLEYPG
FT                   LLNLVATFASRCGYELRVVRHREGQLSLDEFKRAVDGETAAVVVSSVQWINGVRLDVDA
FT                   LSELVERTGAFLIVDGIQEAGVRQPALKRVDFYAAGTQKWLIAPFGAALTYVGPRMAER
FT                   QSLLSVNNAEMDVSPEAYFADGEKTPERLGLSKPRGAKSFELPGMGPAAGVVGAAAALS
FT                   YLAKVGDVEARVRRLRDAVWRALEEGGLKVLTPEEADWSGIVLATTGARRGDEELYCRL
FT                   REEGFRLHLRGMSGVAGLRFSAHFYVDETWVDRLAAVLRQR"
FT   gene            complement(245836..246489)
FT                   /locus_tag="Pcal_0247"
FT   CDS_pept        complement(245836..246489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0247"
FT                   /product="Protein-disulfide isomerase-like protein"
FT                   /note="KEGG: pai:PAE3285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07684"
FT                   /db_xref="GOA:A3MSR7"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSR7"
FT                   /protein_id="ABO07684.1"
FT                   /translation="MRLVNLAIVVVVVLMVAVAVLLVAPLISQSPPQPPQVVNPGGLPI
FT                   PPWAMRFGNGSAPVVLVEFFDLLCPYCAYAHVELGPLIKEKVQEGKLYYILVDFPVHGD
FT                   AAWALHQPLHCAYNELGPSATLDLVNKLYYVWYLAAIKRAISESDALANMSKTLQPYAC
FT                   RFNVTLAQAMGVSDAFGKVGIKIRGTPTFIIYKNGTLTVVEGAYVDKIRQLLSG"
FT   sig_peptide     complement(246403..246489)
FT                   /locus_tag="Pcal_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.969) with cleavage site probability 0.516 at
FT                   residue 29"
FT   gene            complement(246567..248102)
FT                   /locus_tag="Pcal_0248"
FT   CDS_pept        complement(246567..248102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0248"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: pai:PAE0061 extracellular solute binding protein,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07685"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSR8"
FT                   /protein_id="ABO07685.1"
FT                   /translation="MRLGLIAGLIAVVVLALVVAYFATQTPPTTATTTPATTAPPTPSP
FT                   TTTTPPTTTQTPTQTTTTPPKTTTTPPQTTTTPQPSACTTLVVLTRHPTDILDAARTLF
FT                   LKSDVAKRYGVKDVVFRPVAAGQWRAIIQAGQADVAWGGGPTLFDSLYSDGLLLPLEGP
FT                   EVKAAMAQIPKTIAGMPMMRVGSDGKVYWVAWAVSSFGITINKKVLGSYGLSEPKSWAD
FT                   LASFEYGRAAARGVPVTGLASLTQSTSNTRIAEIILQAYGWEEGWRIIVLTAANGKIYG
FT                   GSEAVRDGVIAGEIGAGWTIDFYGYTAQLQNPDTKYVIPPDTSVNGDPIAVVKGTKCRE
FT                   AAEAFVAWVITGGQVIVFDPKINRMPVNPNAFNTPEGQRRPDLKQVYDYLLTLKTINFN
FT                   DTLAISVENVVMYYFDAAVKDNQDVLQQAWWKLVNAYYSGKIDKATAEALARELTSPVT
FT                   FTDPDTGQTVKLTLDYAMKINDKLGNPTYRDKIYSAWRDAARKQYQAVMQKIP"
FT   sig_peptide     complement(248031..248102)
FT                   /locus_tag="Pcal_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.557 at
FT                   residue 24"
FT   gene            248192..249535
FT                   /locus_tag="Pcal_0249"
FT   CDS_pept        248192..249535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07686"
FT                   /db_xref="GOA:A3MSR9"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSR9"
FT                   /protein_id="ABO07686.1"
FT                   /translation="MLVYMRLGIAIFLVAALVAAQQIYVPILADVAHGEATKGLDRWVN
FT                   STANPDAISDFAKLYVLVSPGLSDPTLDRLNKTKIATFIVGDLSTVDLSQFKVIILGQP
FT                   QKPLTDAELAALKKWFDEGGKVLWCAADSDYPAQGSEMAQEVCNDVAEYLGAHIRLDYV
FT                   SVEDSKHNAGAGYRVVGVIDPPPNLAFLGFMAQRVLFHGPGVIAVVLPNGTWVPATSPV
FT                   VPKYYNNIAVIARTTENGVIVESRTSADGKGRDGKAHKAGDRGVFALMAVEFMPSGSVL
FT                   ILSGETPYGGYEPGVAPVYYGVPLDGPRFFRNLMLWATGNYRELSTFIAQTQATAAMSN
FT                   QLATLAATTGNLANDVAALKSTANQLNSQVGQLSGQVGQVSSQVSALSSQISQLNQKID
FT                   QLTQQLNAAVAEANNAKTVAFIGTALALIFAIIAAVLAVRRGGGRETR"
FT   sig_peptide     248192..248254
FT                   /locus_tag="Pcal_0249"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.605 at
FT                   residue 21"
FT   gene            249532..251424
FT                   /locus_tag="Pcal_0250"
FT   CDS_pept        249532..251424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0250"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pai:PAE0055
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07687"
FT                   /db_xref="GOA:A3MSS0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSS0"
FT                   /protein_id="ABO07687.1"
FT                   /translation="MRSLLLLFLATALVFSASLVDPRWAVPAYVTPGGTFNATFDGPVM
FT                   VKTAELAAPGVGPIRLEVVSTSGAVATLRVPPGTPVGLYDLVINGGEVYEPKAVWVGNV
FT                   TGPLRIIQLTDVHVGVELDMASVYRLIHGVLVANSGPYDVIFFTGDLADVGGQVWHYAL
FT                   FVRYASMATKPVFAIPGNHDHAGDDPLVNYRRFVGPPVWYRVVGPYLIIGLDSGENGFL
FT                   TDGQVKLYEEVLKRYPDKVKIVLVHHPPFYLQNGYVVETYRGPQDVDRLNRDPTGRRSY
FT                   YIVYTSYLQNRPAYEKFLDLTIRYKVALVMAGHVHSGNSTIVINGTYFVTTRTLGGSID
FT                   TSHGFRTYVVYPDGRVEVSRETWTYKNFAVATWGSRAAQFYIDSEFVGGVVAVDLPGNY
FT                   TGVRALQGDAKLLDAKVHPMGKYARYTIAVSGRPVWLAVGDYAPAPTIKVEKITPRSPT
FT                   TGDLVTINFRAEDPAAGVPFIVVNGTRVLASYLEEQPVYIYRFKYSKPVQLSAAAPGGQ
FT                   PLTVQIGAPTATPSPTPTQTTPQATPTATTPAPTPTPQPTTTTTPQATPPSPIASTPTA
FT                   TQPTATVTSPTPTATSAPPPTLQPQPASFPVEAIALIVIAIVGAVVVAALARRR"
FT   sig_peptide     249532..249594
FT                   /locus_tag="Pcal_0250"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.570 at
FT                   residue 21"
FT   gene            complement(251411..251623)
FT                   /locus_tag="Pcal_0251"
FT   CDS_pept        complement(251411..251623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07688"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSS1"
FT                   /protein_id="ABO07688.1"
FT                   /translation="MLKVEQQGAFLRLVYAKGGREAVAIGPASDLPTLLGLFVAQMARE
FT                   GFSLEDICTALREVGEKTGFKPTSS"
FT   gene            complement(251646..251879)
FT                   /locus_tag="Pcal_0252"
FT   CDS_pept        complement(251646..251879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0252"
FT                   /product="Protein of unknown function DUF504"
FT                   /note="PFAM: Protein of unknown function DUF504; KEGG:
FT                   pai:PAE2518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07689"
FT                   /db_xref="InterPro:IPR007547"
FT                   /db_xref="InterPro:IPR040459"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSS2"
FT                   /protein_id="ABO07689.1"
FT                   /translation="MRQLFNKLKWTGAKAYFSYVSRGAAGGEEVASIDDVVEVGSGGVT
FT                   ISTGSGERYIPYHRIVEVRLATGEVLLDRRKR"
FT   gene            complement(252081..252419)
FT                   /locus_tag="Pcal_0253"
FT   CDS_pept        complement(252081..252419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07690"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSS3"
FT                   /protein_id="ABO07690.1"
FT                   /translation="MLGNFSALVTGSWAPGPLSDLDIVIFSEKAEPRASLCCWGTPYKC
FT                   DIMFVRPADVEKKLERLSLALLEGLWFRKWACRGKCTEAVERAWEKFLETHIVERRGDY
FT                   FVVKKRVV"
FT   gene            complement(252442..252834)
FT                   /locus_tag="Pcal_0254"
FT   CDS_pept        complement(252442..252834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0254"
FT                   /product="HEPN domain protein"
FT                   /note="PFAM: HEPN domain protein; KEGG: pho:PH0402
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07691"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSS4"
FT                   /protein_id="ABO07691.1"
FT                   /translation="MRQARRNLESAELDLARGYYEWACFKAQQAAELAVKALLRARGVA
FT                   KGGHSVLKLIEAAERELSLQAPGEVKEVAAELDHFYTPPRCPDVYDEGNPFEYFTESMA
FT                   MRALEHARRVIKWVEAWSVVGSPGLF"
FT   gene            252903..253445
FT                   /locus_tag="Pcal_0255"
FT   CDS_pept        252903..253445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0255"
FT                   /product="PaREP1 domain containing protein"
FT                   /note="PFAM: PaREP1 domain containing protein; KEGG:
FT                   pai:PAE0422 paREP1"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07692"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSS5"
FT                   /protein_id="ABO07692.1"
FT                   /translation="MELAIERPLPKPTSADYASARLLEALVEARLALDFLRRGLTRNAA
FT                   GKAFQAWKAVLAALLKLELERLKALAKAEEEKRWLEERAVARVPTTKMLSLSQLLKEVG
FT                   YREVPAWTSLALDLHDYQYHGPDPDMALSKYRTREEAAYFIRSLVEVVAEYAERLKSRV
FT                   AWTKEHEEAYKALVGEL"
FT   gene            253813..254577
FT                   /locus_tag="Pcal_0256"
FT   CDS_pept        253813..254577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07693"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSS6"
FT                   /protein_id="ABO07693.1"
FT                   /translation="MADDAGFRKFLGYAYDAALGAPPAKGCVRLLGEVVVCIRKRQKYV
FT                   DEVVRRLAYGLEVAARETAAQRIAERLRKLGLYVETYKGKVSLPFVDPGIDIDALTNAL
FT                   RGVVEEVDLGDLGEGEVELKCSSVGDEGLCTVEYKPSEEFLEGQVVEALENAPRDVHRF
FT                   DVGDYAVEYFGVGPVLGVEAPFAELQLELDTVRELGLIYAEEYIAASHPARGRRALPLA
FT                   KPTAVEVKRVDCLSNYPLNTVTAMKLTQGHAH"
FT   gene            254657..255199
FT                   /locus_tag="Pcal_0257"
FT   CDS_pept        254657..255199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0257"
FT                   /product="PaREP1 domain containing protein"
FT                   /note="PFAM: PaREP1 domain containing protein; KEGG:
FT                   pai:PAE0417 paREP1"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07694"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSS7"
FT                   /protein_id="ABO07694.1"
FT                   /translation="MELAIERPLPKPTSADYASARLLEALVEAKLALEFLRRGLTRNAA
FT                   GKAFQAWRAILAALLKLELDKLKAIAKTEEERRWLEERAVPSVPTTKMIPLSQMLKELG
FT                   YQDVVFITSHALSIHGYQYHGPDPDMALSIYRTREEAALAIRELAKAVAQYAETLKNRV
FT                   TWTEEHERAYAALVEEL"
FT   gene            255265..255759
FT                   /locus_tag="Pcal_0258"
FT   CDS_pept        255265..255759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0258"
FT                   /product="PaREP1 domain containing protein"
FT                   /note="PFAM: PaREP1 domain containing protein; KEGG:
FT                   pai:PAE0417 paREP1"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07695"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSS8"
FT                   /protein_id="ABO07695.1"
FT                   /translation="MELAIERPLPKPTSADYASASLLEALVETKLAIDFLKRRLTRNAA
FT                   GKAFQAWKAVLTALLKLELERLKAVAKTEEERRWLEERAVPRVPTSRVVALSQMLREVG
FT                   YEDVVGATFVALSLHDYQHHSPDSDMALSKFRSREEAAMEIATFLRTVVKYVEKLKGAC
FT                   G"
FT   gene            complement(255881..256729)
FT                   /locus_tag="Pcal_0259"
FT   CDS_pept        complement(255881..256729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0275 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07696"
FT                   /db_xref="GOA:A3MSS9"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSS9"
FT                   /protein_id="ABO07696.1"
FT                   /translation="MTVGVDVVVIGGTRPWYALLVLLVVVLVGFAKGGLLAVAIMTLIV
FT                   GPLFGWGLWKWRRAARFVQSRGWESANCALGYVEFFYLSGGRSSRGWARFTPTGGVVRG
FT                   LPKPGEYALVAFVDWIYGRAAGCRVEEGPYRGFMLAVLDPAMAKSASGELFISTPQGDY
FT                   ARAVVRPVGPGQVEAVVEAWLVKARAARLELVAKTPEKTHKMKLAESRGGAVREVVDLR
FT                   GLAGPKVVIIAGTPRDEALDLFRNGVAGLGPGPAYALRLVLDVPLARDVAVEQEITPTS
FT                   F"
FT   gene            complement(256757..257653)
FT                   /locus_tag="Pcal_0260"
FT   CDS_pept        complement(256757..257653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0275 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07697"
FT                   /db_xref="GOA:A3MST0"
FT                   /db_xref="UniProtKB/TrEMBL:A3MST0"
FT                   /protein_id="ABO07697.1"
FT                   /translation="MTAYSEQGEWVDEWVFIVGVEHPGEALLAVAFLVPGLAVLFAIVH
FT                   PVTYAIALGVLAYVLFNAVRAARLWARARGLGLAVWREKLLCTPGFVEIGLSGRASSLW
FT                   ANFEPLGGPRYEWPETGSYVVVASGQWIYIRAPGCRVEEGPYRGMVVGVIDPERAYTLS
FT                   ARLSVSAPHGDYARAAVRPAGPGLADVAVEAWLVKARAARLELMVETSMGAHRVTLAES
FT                   RGGTAERRVDFRGFYGRRVVVVAGTSHAWSLDLPAEGVAGLGWGPSYKLRLVLDMPASR
FT                   DVTVEEEVTPQPPWLDA"
FT   gene            complement(257876..258628)
FT                   /locus_tag="Pcal_0261"
FT   CDS_pept        complement(257876..258628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07698"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:A3MST1"
FT                   /protein_id="ABO07698.1"
FT                   /translation="MIWILRVELRLLESVVFRRFSGLAARAILYWLVGGRHHDSPGPKP
FT                   LSASPLLRGGKPLLRGSRVEAGEVVSARFAVLGEYVGEAVAKLSEVKVEGARAEAVKAE
FT                   AWPLKVGGDPPPRFTLRFLTPVRFKRGRVFDVMPAPHNLALSAGLHAARALGPSSQEVL
FT                   GFSATEGLVRRVAAWAYGYVAVAKASLRTAVVYADGASQVGAVGWATYEVKGKRRARHF
FT                   WALVQYGAAVGFGDGKTYGLGYAELSSG"
FT   gene            258662..258937
FT                   /locus_tag="Pcal_0262"
FT   CDS_pept        258662..258937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07699"
FT                   /db_xref="UniProtKB/TrEMBL:A3MST2"
FT                   /protein_id="ABO07699.1"
FT                   /translation="MRQIPALGFEWQHVVAALSRHNVKELWLSNANPSHERVRGAVSEL
FT                   ERVAKRMGVSSIHAVEVPTDDVRTRVKRRQRHLCQLSPRLPPELTQ"
FT   gene            complement(259038..259496)
FT                   /locus_tag="Pcal_0263"
FT   CDS_pept        complement(259038..259496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07700"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:A3MST3"
FT                   /protein_id="ABO07700.1"
FT                   /translation="MRLGARTHVPSSRTAMELVIKSWGVYLGFSRGAVVIRQRGGGERR
FT                   VPIYQVDRIWILTGGVAISSKLLRVCARVYRRGGVRRDAAGAGVSAEGNGAVSHWGRCE
FT                   AYFDGRGFELARGIWECRLSVWGVGEVLCTMEGPCGGLMDAAGKCLGA"
FT   gene            complement(259530..259685)
FT                   /locus_tag="Pcal_0264"
FT   CDS_pept        complement(259530..259685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07701"
FT                   /db_xref="InterPro:IPR009260"
FT                   /db_xref="UniProtKB/TrEMBL:A3MST4"
FT                   /protein_id="ABO07701.1"
FT                   /translation="MAGYALALEADEEMPMERGLLLYVHVDDVVKAKPVVVGDSLRRLF
FT                   SEEGAR"
FT   gene            complement(259693..260286)
FT                   /locus_tag="Pcal_0265"
FT   CDS_pept        complement(259693..260286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0265"
FT                   /product="CRISPR-associated protein, Csa1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csa1 family;
FT                   KEGG: pai:PAE0082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07702"
FT                   /db_xref="InterPro:IPR009260"
FT                   /db_xref="UniProtKB/TrEMBL:A3MST5"
FT                   /protein_id="ABO07702.1"
FT                   /translation="MFRELRWLKSVRVEVSEELRGWRWDSPPVAPPPLGVRVSVSEVGG
FT                   GVCETRRDVYLRRVGGVEGRPSRAVKYGAYIHEVFRLSLKRLRRLVEDGVASGWELLQA
FT                   FDAEGVAKDAAAAAEFEPDVRGVKLARWLAVQVAARVDEVRSRSHVDGDSLAARAVPLW
FT                   TEYVVDGRPLGLTYVRSDALAYDVVVEVKVGPAA"
FT   gene            complement(260813..261526)
FT                   /locus_tag="Pcal_0266"
FT   CDS_pept        complement(260813..261526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0266"
FT                   /product="CRISPR-associated HTH regulatory protein, Csa3
FT                   family"
FT                   /note="TIGRFAM: CRISPR locus-related DNA-binding protein;
FT                   PFAM: regulatory protein, MarR; regulatory protein, ArsR;
FT                   transcriptional regulator TrmB; Helix-turn-helix, type 11
FT                   domain protein; KEGG: afu:AF1869 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07703"
FT                   /db_xref="GOA:A3MST6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR010163"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MST6"
FT                   /protein_id="ABO07703.1"
FT                   /translation="MHTLFPLKINLKLYTAVRLLVFTLGFEEKFAIRAFTRRGLDVGDR
FT                   ILLVAARPAADRVVRAYNTLREFVQRYYGGGVEIELVEVNVRDFPGAVCEIRRRVLEKA
FT                   GGDVVVNLSGGPRALVLATYAAVQLLPDDVAKRVRVEVEFEDGTYLVEVPLCAVYAQKL
FT                   AERLGEEKLAVLEKLAQRGVATAEELAREVNLDSSTVRRHIRRLEELGLVQVLSKRPLR
FT                   AELTQDAKVITCLRE"
FT   gene            complement(261614..262171)
FT                   /locus_tag="Pcal_0267"
FT   CDS_pept        complement(261614..262171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07704"
FT                   /db_xref="UniProtKB/TrEMBL:A3MST7"
FT                   /protein_id="ABO07704.1"
FT                   /translation="MIYICFKDEERLGNFLSSLGPYGGECGEASEEGLEVRVFEGVAVV
FT                   VERWGGACVSLLPCEAYLGTGFYDLGVAAETAAALLPRFRELACRLAGLGAVFIALGEN
FT                   VLEPLDDVVPRQPLPHGLYALYIGSEPQGSMLYRLLTYALSYGQSLLLLQLPLVKKDLG
FT                   SALRDLCAEVVEECGGVLCLRQ"
FT   gene            complement(262168..262680)
FT                   /locus_tag="Pcal_0268"
FT   CDS_pept        complement(262168..262680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07705"
FT                   /db_xref="UniProtKB/TrEMBL:A3MST8"
FT                   /protein_id="ABO07705.1"
FT                   /translation="MQKLDVDCEKQNACELGNDMEPEDRECGLNKGRLLQILELLEQRL
FT                   AELKISTNTVVYLCRCDKPQKEPALPPCGRRYIGESFDLFLLIRDKRGRKACIWIECRV
FT                   GENVASIVSRLVQKFNRYRTLGNGASEACCGRGAHASVLLTVATNTSELKKKLKDNGLN
FT                   EVLVVGI"
FT   gene            complement(262680..263951)
FT                   /locus_tag="Pcal_0269"
FT   CDS_pept        complement(262680..263951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07706"
FT                   /db_xref="GOA:A3MST9"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A3MST9"
FT                   /protein_id="ABO07706.1"
FT                   /translation="MSASAVQLVKRLVVQGFKRVEGEVELELSGLTVLYGPNASGKSSI
FT                   LCALQRLLHYVYGVRTACPQEVNYSARTLRVAGLVWVPGGYVEVEYGAEVDDYRVTRRR
FT                   WFRVGPLVAEFFEGSTYVKCGDRKISISFAPYVAEGSLFSREAVRSGGLLGDVLRECGP
FT                   FEVEVYEHSGAGGEISESVRIERRRHALSWLRDAVVKHVKVDEGVYEEFGWRPLQYMAE
FT                   TLVRHVRPPATLGAVRQSVAGLAKYGVRALDKFKEDLGYVFGEEIIDIAIDVSVEPASH
FT                   GGEEIIEIAADVELVFRGGAFKLRQLSDGMLHVVNTLAEAYSAVYSLKEMKRWGIEPPP
FT                   PLLIIDTPEFNIHVDWLYRLMELLLDLGVQVIVETHSGLLLAYALKYGVAYYVKDGKVK
FT                   MLDVKSLKDIELFRSEYWAYQQVT"
FT   repeat_region   complement(264904..265136)
FT                   /rpt_unit_range=264904..264928
FT                   /note="CRISPRs"
FT   gene            complement(265427..266596)
FT                   /locus_tag="Pcal_0270"
FT   CDS_pept        complement(265427..266596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0270"
FT                   /product="CRISPR-associated protein, Csx1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein DxTHG motif;
FT                   KEGG: pai:PAE0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07707"
FT                   /db_xref="InterPro:IPR013383"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSU0"
FT                   /protein_id="ABO07707.1"
FT                   /translation="MRLLVATWGSPLTWRRARYTGVPPLNCPEGQTFTDLPCYRGVVDR
FT                   VVVIALDSAAAAAAPRALVNEDALNCAREAGLSVRERGGDVEIFPAAEDYREWRRAVVN
FT                   YVKCVAEASGGGEVDVVVAPAVGRLGMCRHVLRDPRAFLSISLAELYALLGGEAPSEIY
FT                   LDTTHGVNYATTLAYELVHMLASLAVARGAAEAKVQTFNAVEAAGGEYEVARVYQANVR
FT                   RIDLAAARATGGASGKVLRALALAAPLAVYYACREAEPPKAEEVVERFVQGVKIRAAEE
FT                   CAVEKPAVEPPEVVYGMLLAWEVCKAGWSNVVTEMRGDYFRKLSPLYETLVNEELAALN
FT                   KLLTKRPAYCAPYYAFKNVGPEKWKRQRGCKGGKSPSATYGTSPRTPAS"
FT   gene            complement(266593..267426)
FT                   /locus_tag="Pcal_0271"
FT   CDS_pept        complement(266593..267426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0271"
FT                   /product="CRISPR-associated protein, Cmr3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07708"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSU1"
FT                   /protein_id="ABO07708.1"
FT                   /translation="MIVKIRLLEPIHVGAKQVSGVDDIGADAVYATIMPSTAIGVLASL
FT                   AGVRGGDPFQLCRQLWGPLVEVDGRLYFQAASSLYPVEEAGRYIAAAKGEGEPPRARYE
FT                   VVELERPGVRLRDKVVQNLYYAKYLWVEGAREVAYLYYADCEGLKGGVEWVGGEGRVAV
FT                   VEVQDDDKVAPKPCREGVLLSPLLFYADWPYAEVGKSAGVEKSGLENVEEVYGVLEGGR
FT                   AKVKSTYVGLGYSLSLRRRRAIYQALPQGTALRLREPAPSAGLHRERGYGSLLCP"
FT   gene            complement(267423..270230)
FT                   /locus_tag="Pcal_0272"
FT   CDS_pept        complement(267423..270230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0272"
FT                   /product="CRISPR-associated protein, Cmr2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Crm2 family;
FT                   KEGG: sso:SSO1729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07709"
FT                   /db_xref="InterPro:IPR013407"
FT                   /db_xref="InterPro:IPR024615"
FT                   /db_xref="InterPro:IPR038242"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSU2"
FT                   /protein_id="ABO07709.1"
FT                   /translation="MDLREFFLTKAYALFHDPPDKMWGLKGHEERAWDMFNKVRRGSPL
FT                   DGELPEWAREVVKLADRMAASMDRYAFYSGGGEGVKYDKLHNLFNPRLWRALAPPDPGK
FT                   VAEYVENLGGRVRAAKGPREAYHVLYALFEALWIDEGLGPSLADPRAPTHDVFDHLYAT
FT                   AMVANWLLAGGKPSGYFVTLDVPGVQDFVKAGRKAGDIWAGSWALSMAVWLTVWPFAWE
FT                   YGPDVLLRPTARLNPYYYAFAAARGLGVEHGVFAKLLSPYVKGESFYDLVNFAVVQPLI
FT                   GERAQIVLPPYRVEGDKIASWGGAEEVREAVRDRFKRAVECLTHFAKGQRGAGDEYCED
FT                   FFKVVEEGRGEGRGGGEVEKIAAWLQKYAELRLPLRVEVVDVGAVYDSIKCPREVAKAI
FT                   EEALGDGEERCKILFLFDAVLRGGREGTKLVEPQRRRFIPTRGPWFKPGGYDDLNPHFN
FT                   FPLDPNWRVCSLCGSEPAVVGVRKVAREGREDYNEEDLRRISAEVGIEVSRLKNHLRKV
FT                   LRPGEYLGPVCLAKRLIYLRAADRELIKFESTEDVAVVKLAESHEQHYAELDRVQECVK
FT                   VVNYLRTTGGRDLEVIWGNPEAMRRDWDNCFKKFGRLRGVERLVREIFGVEGDVGKAVE
FT                   EFAGPRLFYAVVRADGDSVGKLLEGHLPVNWYGAVAEVVEGVGAEGREKALEVLRAVEE
FT                   HMRSFGVPPPVVITPTYRVAVNRAMVLTSLKDLATTEKHRGLLIYAGGDDVVALLPVET
FT                   ALDAAAEYRENYWGEGGFHIVDNYPVPALAAYGRSTAVRFVHLMDLMSEELGKSYHDLE
FT                   HLAKGGRWDCFEKDSLTITSSRVEAKAVLPFRRPREAVERLKELWLLMALGRLSKNAPH
FT                   DLDAYEDLKRDLAAYLKAWRYALKRNARELSPETLTRLLCFIEKYGAEAGEGLKEAMKI
FT                   LRRLP"
FT   gene            270269..271171
FT                   /locus_tag="Pcal_0273"
FT   CDS_pept        270269..271171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0273"
FT                   /product="CRISPR-associated protein, Cmr4 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Cmr4
FT                   family; PFAM: protein of unknown function DUF324; KEGG:
FT                   sso:SSO1987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07710"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013410"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSU3"
FT                   /protein_id="ABO07710.1"
FT                   /translation="MDRVSRGLLIYAVTPLHVGVGRAEGAHVDLPVQRDEFGLPTIWAS
FT                   SLKGSLKSHARSRSPNDAKLVFGPDPDGGPPDHASGAALLDARLLAIPARSVRGVWAYV
FT                   TSPHMLRTFVTYAEALGAFQPLAEKACALLQATAGLSEGRAAVSDHALLHGGRLFLNEV
FT                   ELQAEVKREVGDFIEELDKALGGDLPKKALAVVSDDVAKEVVNRSTLVQYRVRLDSARK
FT                   TVVEGALWSEEYVPQFTVFASGVVCRPVALKDATIKAEEICEKFTKLLTNGQGNKANVW
FT                   VGGKETIGKGLISVYIWTR"
FT   gene            271174..271584
FT                   /locus_tag="Pcal_0274"
FT   CDS_pept        271174..271584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0274"
FT                   /product="CRISPR-associated protein, Cmr5 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cmr5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07711"
FT                   /db_xref="InterPro:IPR010160"
FT                   /db_xref="InterPro:IPR023101"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSU4"
FT                   /protein_id="ABO07711.1"
FT                   /translation="MAIECTKAVAEAADGDVRRRYAQRCRAFHAEIFTLGVAHVVALAA
FT                   ARAGAKAVEAGLRHSTCGEVVKAALAEAGGPEEKSYGLYGAVLLYAMRRRGYVKSTTLL
FT                   DALGELKDPALNAAAYRAAEWLKRLAEAYFKA"
FT   gene            271581..272744
FT                   /locus_tag="Pcal_0275"
FT   CDS_pept        271581..272744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0275"
FT                   /product="CRISPR-associated RAMP protein, Cmr1 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Cmr1
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07712"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSU5"
FT                   /protein_id="ABO07712.1"
FT                   /translation="MRALFRATIATPLSLGWYEPGVLDERFYIRPASVKGVWRWWARAF
FT                   VGGVLYERGCLKGRRGRDVFLAPTREEAEAVMRHVGKTLGLGYAGEEGAQASQFRLRVR
FT                   VLRRPEKGVARRREGLVRVAGRQAALQRFKLLTLNNDVEYAVGGEFEIEVEAEVDRRVF
FT                   NASVGVLAVALTLSGLGKGSRKALGDLDVVEARGVQLPNSLPKLVEEVRAAVAELIRDR
FT                   CPGRPQGLPPMPVVTAEKWSGAELAAVYEAGLGFEDLHNFFLRPARAKALTGNYAARDP
FT                   LREKLAAWVLGLPREQRGTGYTSPLERRASTIIAAYHGQRHLVGGGRGYLTVLISGDWP
FT                   TEIEWSGAGSERIRIDEAKILDAYKTAVEEFAAYAQRLRSNVTKIWP"
FT   gene            272735..273529
FT                   /locus_tag="Pcal_0276"
FT   CDS_pept        272735..273529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0276"
FT                   /product="CRISPR-associated protein, Cmr6 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Cmr6
FT                   family; PFAM: protein of unknown function DUF324; KEGG:
FT                   sso:SSO1990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07713"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010172"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSU6"
FT                   /protein_id="ABO07713.1"
FT                   /translation="MAVRGRREFAGGDDPLSRYCQEDYNVVSCINLAFLEWMRQKIGKP
FT                   EGARQRSEGLPDFSRRAVLHLYRQPPRAAREEVERYVQAIFDAVSRASAMAFKYEFTLE
FT                   TPLTIHTKWPYLPLEIGLAWHPILNVPYIPASSLKGAARAAAVSPLCGIEPEDLFGTTE
FT                   EEGDLIFTDAYPTRWERLVEPDVITPHYRETAGEISEAQARPVPLVFPVVPAGTTFTFV
FT                   VAFRQMVGQECWGETLRWLQQVLTRGLGAKTQLSYGVFRRQT"
FT   gene            273526..275220
FT                   /locus_tag="Pcal_0277"
FT   CDS_pept        273526..275220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0277"
FT                   /product="CRISPR-associated protein DxTHG motif protein"
FT                   /note="TIGRFAM: CRISPR-associated protein DxTHG motif"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07714"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSU7"
FT                   /protein_id="ABO07714.1"
FT                   /translation="MTPAPCHEDLKAYDYVLIVAPMGALGGYREVKYVIPSRGSVGEEK
FT                   GGQDSDKKHWAVAFALYDYVQGVSKELYAFIQDTIIVNLVKPQNKEKPVKQEIVEQLKL
FT                   LLNCNDDSCTIDENLIDTLLKLEGKTSEAQKTIDRLKELRKEAKIHFVPGVITRWIEEV
FT                   LVTWRGGNQFYDVLKGTLVYYILSALKKSCHKRIAIFVDTSHGINYFVTALKEAVPLAA
FT                   TLYLIHRIADGEPVEKLDICSYNSDPYPTPSRECQSQKGGDAQKDKAEQADKETPSLKI
FT                   HLVERFEMVYTHKSETETYTSINLYPVRSLVEDLFLTMGLKGIVNYLNQKWALGEDKWK
FT                   SITASVVLFLRGILGWSLSIAHSSNEDMLAEIGETVKKRGIRIEQRSDKNEIAITYIWG
FT                   SNRKIGTDVVTFASIHSSLNRLGRCLATPRMIEGSPYVCYPTKELEKYIEQFYAPPYRE
FT                   INLNELASVRNYLEGKKKSDESSVRDSLEEKSRDREYCKPLEGGKGFICGKREDADQQA
FT                   EGANPRNFYAHAGLSFELDWGALKEEGELLCFSKEVERVINILASSG"
FT   gene            complement(275203..275778)
FT                   /locus_tag="Pcal_0278"
FT   CDS_pept        complement(275203..275778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07715"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSU8"
FT                   /protein_id="ABO07715.1"
FT                   /translation="MGSGVLWRKGLQSVFMVLLVAVNCGDVEDAAKALGCAEAPGEVGD
FT                   VVNCGSYALYMNHRGDVCYLGVTYPELWRGWQYDVEVAAKRLDDSEARGVLCKLSHIAL
FT                   VAAATAAPSVRPETEATVYHHAEWVWVRKGYTPHGSVASLVVGLLQQIHYTMDFFPLLI
FT                   DDALKRLNGGEELCGGVLIRLGSSPATR"
FT   gene            complement(276130..276966)
FT                   /locus_tag="Pcal_0279"
FT   CDS_pept        complement(276130..276966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0103 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07716"
FT                   /db_xref="GOA:A3MSU9"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSU9"
FT                   /protein_id="ABO07716.1"
FT                   /translation="MRIERVCLRDFLAVGGQCVEVGGPTLLYGPNGAGKSSLILGVAAL
FT                   LYAISGGVLRGLVPDNLALWVRRGAEAGAVEAVVDGRRYRLEIGRDTSVWVDNEKQGYP
FT                   PFKLIEARVAYVGPCTAAWESWRFHLCEGADLEVEDPEDAEWLRRVGAVAGVEDVYGGR
FT                   VKVGGRWIDVQTLAYGYRRALAMLIAARRADVLLVEAFEAGLHYDLAVDLIQVLKETSA
FT                   LVIAESHLMATLKAALDAGWRVYYVDGGVFHPIKDVFDVAKYAERERLAYAAISRT"
FT   gene            277053..277640
FT                   /locus_tag="Pcal_0280"
FT   CDS_pept        277053..277640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07717"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSV0"
FT                   /protein_id="ABO07717.1"
FT                   /translation="MDDFRRQLEEVKRAFRESVAAGIREGVEGVLQEMRGIIEVLEEVS
FT                   LMIDRYSKTLRNHSSLLEAHLNALKEHTDTMRAVSAAVREVNASLGELMALVRVSLERM
FT                   GDMARDFALALCKALGGEAEEAGPGLALCHIGWATHLIYAAAVATVEHVEKLKGIDAGG
FT                   AKKVLAALIAHRDAVEAAKALGIEIAAGGVSP"
FT   gene            278253..278681
FT                   /locus_tag="Pcal_0281"
FT   CDS_pept        278253..278681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE3185 paREP9, associated with SRSRs"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07718"
FT                   /db_xref="GOA:A3MSV1"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSV1"
FT                   /protein_id="ABO07718.1"
FT                   /translation="MGRVLTVSFIAPMYLYLGVVVVRGLRGYMWLLGRRLYFKTSWRAR
FT                   DTHYLGRLEDLLSASARLRRLIPRPVDVRTVVVAVAKALAMAHYLAKRCRGSPTWRYLP
FT                   FEVEMAIEEAARLLTARWPSAAKYFGGSRWGSSATWLT"
FT   gene            complement(278849..279448)
FT                   /locus_tag="Pcal_0282"
FT   CDS_pept        complement(278849..279448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0282"
FT                   /product="PaREP1 domain containing protein"
FT                   /note="PFAM: PaREP1 domain containing protein; KEGG:
FT                   pai:PAE0973 paREP1"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07719"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSV2"
FT                   /protein_id="ABO07719.1"
FT                   /translation="MGPPPPQPPPPSRRGADKLHLPLLVQRHIAHSAPNQRHLHVYEKQ
FT                   AYKYVKARRHGVAPDVDHLAALRLSEAKAEAALAAELLQAGAIRDAAGKAFQAWKAYIS
FT                   HLAIRHRELLAEAAPRGEVDYAEWTAPTSRLLQIAAALEAVEPGVSAYTALALQLHEYQ
FT                   YNGPDPSGVLSNFPDDETAKEAVAALLEELKRRVGF"
FT   gene            279992..281170
FT                   /locus_tag="Pcal_0283"
FT   CDS_pept        279992..281170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0283"
FT                   /product="N2-acetyl-L-lysine aminotransferase apoenzyme /
FT                   acetylornithine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.-"
FT                   /EC_number="2.6.1.11"
FT                   /note="PFAM: aminotransferase class-III; KEGG: pai:PAE2515
FT                   acetylornithine aminotransferase / acetyl-lysine
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07720"
FT                   /db_xref="GOA:A3MSV3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR037537"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSV3"
FT                   /protein_id="ABO07720.1"
FT                   /translation="MARIARYYREYGIRLVRGYLQYVWDDSGRRYVDCNTNHGVAFLGH
FT                   ANPKIVEAVKRQVEELWVAPLNFYTPARERFIEEFSRLLPAGFGVVFLQNTGTEAVEVA
FT                   VKIAKKVTRRPTIVAFTNSFHGRTMGSLSITWNEKYRKAFEPLYPHVRFGKFNVPHEVD
FT                   KVVGEDTCCVVVEPIQGEGGVNPATPEFLKALREEATRKGALLIIDEVQTGFGRTGAVW
FT                   AFQRYGVEPDIFTAGKPVAGGLPIGLAVAREEFGDVFEPGEHGSTFAGNAVVMAAAAAA
FT                   SRLLREEDVPAKAEAMGAELAKALQSINSRLAVRVKGAGLMLGLELRVKADQFIRPLLE
FT                   RGVLALTAGVNTLRFLPPYMITREDVEVVAAAVEQVLRAAEAAGGSPLATAT"
FT   gene            complement(281184..281765)
FT                   /locus_tag="Pcal_0284"
FT   CDS_pept        complement(281184..281765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07721"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSV4"
FT                   /protein_id="ABO07721.1"
FT                   /translation="MREVPVVAVATAVAVVLIVVAVNNAVNSAVKESAGWIIELRLYSP
FT                   YKTFEERYYYLNGELYKYDDGAYWRMGKVVRIRVENITAGGFELVFLRYRGAPPPTNDT
FT                   LVKASFQVIRDSHIYNVTIETRYSQLLAALNAMCKGPDNKVVTLPFADVVVDYRVVSKT
FT                   ETKAIDLGRVAVNAAGDMCAVYIDKVEIHK"
FT   sig_peptide     complement(281700..281765)
FT                   /locus_tag="Pcal_0284"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.826) with cleavage site probability 0.414 at
FT                   residue 22"
FT   gene            complement(281833..282291)
FT                   /locus_tag="Pcal_0285"
FT   CDS_pept        complement(281833..282291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0285"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="PFAM: Vitamin K epoxide reductase; KEGG: pai:PAE2513
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07722"
FT                   /db_xref="GOA:A3MSV5"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSV5"
FT                   /protein_id="ABO07722.1"
FT                   /translation="MGKGWLILLLAFSAGGLASSLLVIYLFYLLKTLPPGCFAETELLP
FT                   GVTLDCVKVLTSSYAYIGPIPLDVAAAAWFMVNIAAALWLYRTLSRRAAAFIFWWRLLG
FT                   LAILPYLLYLEFAVLKAVCLYCTIMHIMIIADFAVITLFLRRVSPLLR"
FT   sig_peptide     complement(282235..282291)
FT                   /locus_tag="Pcal_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.969) with cleavage site probability 0.758 at
FT                   residue 19"
FT   gene            282332..283141
FT                   /locus_tag="Pcal_0286"
FT   CDS_pept        282332..283141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0286"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: pai:PAE2508
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07723"
FT                   /db_xref="GOA:A3MSV6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSV6"
FT                   /protein_id="ABO07723.1"
FT                   /translation="MCVRVYEVRVKRALAPSGLPEYDYALNPYVGCLHGCLYCYAMDYT
FT                   RGPPAAAWGSVVYVKVNLLEVLRREVGRVRPGVVGLSTVTDPYQPPEAKYKLTRGAVSI
FT                   LAGAGFRVSIQTKSGMVVRDVDVLVAHREAVDVGVTITTLADKARILEPMAAHPYARAQ
FT                   AVRKLAAAGVKTWIFLGPIIPGFNDGAEDIEPVVKLAHETGSELYYDRYRPKPRADAYL
FT                   AAKYRPVAATPSWWAEVKKTVEAICARYGARCIDAEEERRAAFKAST"
FT   gene            283148..283393
FT                   /locus_tag="Pcal_0287"
FT   CDS_pept        283148..283393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07724"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSV7"
FT                   /protein_id="ABO07724.1"
FT                   /translation="MDVLAAVVEVLNAEGLEVYLIGARAMAFYGVVRETRGWDLMIDAP
FT                   YTPQLRDRLTRRLRELGLDVRWSWWGFSVEGAHGFA"
FT   gene            283416..283643
FT                   /locus_tag="Pcal_0288"
FT   CDS_pept        283416..283643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07725"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSV8"
FT                   /protein_id="ABO07725.1"
FT                   /translation="MDDELRRRANSYGTFKVPSVEDLVMMKIMGREKDLKDAVKLLRLV
FT                   SDFDYLRRRAEEAGLLKELRKAAARAGVKI"
FT   gene            complement(284286..284696)
FT                   /locus_tag="Pcal_0289"
FT   CDS_pept        complement(284286..284696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0289"
FT                   /product="PaREP1/PaREP8 domain containing family protein"
FT                   /note="PFAM: PaREP1 domain containing protein; KEGG:
FT                   pai:PAE3206 paREP8"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07726"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSV9"
FT                   /protein_id="ABO07726.1"
FT                   /translation="MDPRERVEMYLKLSEDYLRETEDLYAKGNLPQAGEKHRGAVAALF
FT                   NAVGEALGLDHYSHRDYQLIIQRIYRDTRDVEVLRLFGMAERLHANFYHNFLDKETFYR
FT                   HQEDASALIEKLRRYLDVITCQPHVGASHSRT"
FT   gene            complement(284796..285263)
FT                   /locus_tag="Pcal_0290"
FT   CDS_pept        complement(284796..285263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0290"
FT                   /product="PaREP1/PaREP8 domain containing family protein"
FT                   /note="PFAM: PaREP1 domain containing protein; KEGG:
FT                   pai:PAE3206 paREP8"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07727"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSW0"
FT                   /protein_id="ABO07727.1"
FT                   /translation="MIPAAVLSRLEEEARARGKSLAEVLLEKLAIDPAAKAEAYLELHE
FT                   KYLAEAEELYKKGDLLQAGEKYWGAVAALLNAIGELLGVEHYSHRDYQLIITRIYRETG
FT                   DIDVVRLFRMAEALHANFYHNFLDRDLFERHREDALALVERLKRYISLKRR"
FT   gene            285502..286146
FT                   /locus_tag="Pcal_0291"
FT   CDS_pept        285502..286146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mth:MTH1192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07728"
FT                   /db_xref="GOA:A3MSW1"
FT                   /db_xref="InterPro:IPR025098"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSW1"
FT                   /protein_id="ABO07728.1"
FT                   /translation="MDLETNLSTSAAFTGKIFSNWGRLLLLIALSIIPIANFIVVGYMA
FT                   RIVRENPDELPRLENYAGLLLNGLLVFIAWLIYAAVPLIFIILGLGTWLFSRTLSPLGL
FT                   ALFVVGVLLLLGAMVIGTVAIGYTIKRDMDFTKIFAFQEVWGIIQRIGVGRYLVWYLVM
FT                   SALGLVAAALGWVIPWVGGAIAGVFFGLFANKSLALLLDEALKPPQQAEGS"
FT   gene            complement(286143..287408)
FT                   /locus_tag="Pcal_0292"
FT   CDS_pept        complement(286143..287408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0292"
FT                   /product="transporter, YbiR family"
FT                   /note="PFAM: Citrate transporter; KEGG: pai:PAE2457
FT                   arsenite transport protein, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07729"
FT                   /db_xref="GOA:A3MSW2"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSW2"
FT                   /protein_id="ABO07729.1"
FT                   /translation="MGDALVALLLLAIVVGGMAARPLYPHLPTWSIMSLAAFVAIVLGP
FT                   VSIDDVPHVVNFEVLFFLVGMFSIVALAEKSGLLEALAYAFISPFKTRRSIYVASSLLF
FT                   GLTAAFAVNDTVALMGPPIAAAIARASGIRPRDMFLLLAFSLTVGSVMTPIGNPQNMLI
FT                   AVESGMKAPFLAFLGALAIPTLINLVAVPLLLFKVLGIEDGPVRYVATPWDYIRDKRDA
FT                   ALAAVGLASAVAAMVANDLAALSGAPHIHNIGLIPFVVAAALYFLAREPREVLARVDWG
FT                   TILFFATMFIAMDAIWRGGVLQPLVSALLPAYHGTPTDLLSITILSIALSQVLSNVPFT
FT                   SLFATYLHHLGVEDPKAWLTLAMAATVAGNLTLLGAASNIIILEVLETRYGATITFAQF
FT                   SKYGAVVTALNLAIYLPFLLFL"
FT   sig_peptide     complement(287349..287408)
FT                   /locus_tag="Pcal_0292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.873) with cleavage site probability 0.867 at
FT                   residue 20"
FT   gene            287448..287863
FT                   /pseudo
FT                   /locus_tag="Pcal_0293"
FT   gene            287899..288063
FT                   /locus_tag="Pcal_0294"
FT   CDS_pept        287899..288063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0294"
FT                   /product="SSU ribosomal protein S30E"
FT                   /note="KEGG: pai:PAE2455 ribosomal protein S30"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07730"
FT                   /db_xref="GOA:A3MSW3"
FT                   /db_xref="InterPro:IPR006846"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSW3"
FT                   /protein_id="ABO07730.1"
FT                   /translation="MPSHGSLTKAGKVRNQTPKIPAKPRKNLTPRRRNIRNYKRRVLYA
FT                   SQQAAAAEA"
FT   gene            complement(288060..288563)
FT                   /locus_tag="Pcal_0295"
FT   CDS_pept        complement(288060..288563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0295"
FT                   /product="Bacterio-opsin activator, HTH domain protein"
FT                   /note="PFAM: Bacterio-opsin activator, HTH domain protein;
FT                   KEGG: pai:PAE2449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07731"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSW4"
FT                   /protein_id="ABO07731.1"
FT                   /translation="MALRLTISFKYGDGSVCGEVVGVNMGHVLLADQSLTRVKCEPCEV
FT                   VAEYGAAVVGGRICGGRAELILIANAYQISRILRELHYRGLQPRVIGRAKYIRDPQLTE
FT                   DQLKLVELAYRLGYFDDGRKISLKELAAVAGISPSAADRKLRRALRKIVEFYLSRFGRG
FT                   DLGG"
FT   gene            288657..288983
FT                   /locus_tag="Pcal_0296"
FT   CDS_pept        288657..288983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0296"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: pai:PAE2450 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07732"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSW5"
FT                   /protein_id="ABO07732.1"
FT                   /translation="MAAELLKYQRVLIDQDTCISCGACVAACPYQALELDENGKARMIW
FT                   EMCKDDFSCVAVCPVKCIYKISEAPAEFKAKKGWYRLGKALSPEEQKAFQEWKAKYGVT
FT                   ADPV"
FT   gene            289013..290104
FT                   /locus_tag="Pcal_0297"
FT   CDS_pept        289013..290104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0297"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: pai:PAE2451
FT                   pyruvate formate-lyase activating enzyme homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07733"
FT                   /db_xref="GOA:A3MSW6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSW6"
FT                   /protein_id="ABO07733.1"
FT                   /translation="MGFCKLCGRVGITISSRLGVCVDCLRRRPREALKIAEELHRASRL
FT                   RFGLPLSPPQGGVPCGICGRGCSVPEGGVGYCGLVKNVGGRLTRPGGVYMGVLEYYYDP
FT                   IPTNCVADWVCPASTGRGYPKYAKSPAGEVGYYNLAVFYGACSLDCLYCQNWHYRKYPR
FT                   RPVFASVEELDRAMDRRVSCVCFFGGDPAPQVVHALLVAKRAAEKGVRVCWETSGQLAP
FT                   HLLDKVVEISLKTGGIVKFDLKAFTPSVYKALTDGEVDIVLRNFKVAVRRFRERPEVPL
FT                   VVASILLVPGYVDEIEVDLLTKFIARLEPEVPTRFLAFHPDYLLDDLPPTSIRHAETAV
FT                   KIAQENGLVEVDVGNAWLLGDYY"
FT   gene            complement(290101..291255)
FT                   /locus_tag="Pcal_0298"
FT   CDS_pept        complement(290101..291255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0298"
FT                   /product="protein of unknown function DUF790"
FT                   /note="PFAM: protein of unknown function DUF790; KEGG:
FT                   pai:PAE2447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07734"
FT                   /db_xref="InterPro:IPR008508"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSW7"
FT                   /protein_id="ABO07734.1"
FT                   /translation="MTLMSIDYLRVVRKGGEIRPRYLSDASAAAEVIEAARGAKTLGEF
FT                   KRRVEALGFDKKLAGGLAHVLSHFLKAESVDRRLVSRIRLEVFKAAAASWPVLTAEARE
FT                   AVFNTVASKLRLDPGEVRCLFLKAYEDNLEIVEPPSITAEELAREYNLALMQTLLFKSL
FT                   YVKAWVPNAPAVVKRLIRAVKGYRLMYIAEEGDGGWLVFHFDGPVSALRQTERYGTRLA
FT                   KLVPYIVSAGQWKIEAQIKLRDRVYTYREDWRTAPDLPRQPPPEEEFDSSIEAEFYRQV
FT                   SRVCRVEREPEVLVVDKRVYIPDFKIGDLYVEVVGFWTPDYLRRKYEKLAKVKKPLLVL
FT                   VSEELAMATWKELLPNVVLFKDRPRLSDVYKHIKPYCTPPGRQP"
FT   gene            complement(291252..292622)
FT                   /locus_tag="Pcal_0299"
FT   CDS_pept        complement(291252..292622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0299"
FT                   /product="DNA repair helicase RAD25"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: pai:PAE2446
FT                   helicase, possible DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07735"
FT                   /db_xref="GOA:A3MSW8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040699"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSW8"
FT                   /protein_id="ABO07735.1"
FT                   /translation="MGLTTPRIVLTWDRGTVLVEGSLPQELRKLSFLKFDERVGKYRAL
FT                   AIYYPRILAAARALGVEVEDRVWSLHCAEVRAAAEAKLRSYQAEALAAWSKAKRGVVVM
FT                   PTGAGKTYVAIAAIAQMRVPALVVVPTVELLQQWRSRLSQYFPGRVGVWYGEEKRESCV
FT                   TVITYDSAYAAVEVLGNRYMFLVFDEVHHLPSPSYRQIAELSPAPYRLGLTATPERADE
FT                   LHVDLDWLVGPVVYKMSARDIRGVWVADYEVEVVKVELTEEEKMVYKEAEQRYLSYLRK
FT                   KGLRFKSPSDFQKLVALAGRSPEARRALEAWHIMRRLIHETSAKVEAVGEILARHPASK
FT                   VLIFTEYTSLARAVSERYLIPLVTHDISPQEREQVMAMFRRGEVKAIVTGKVLDEGVDV
FT                   PDVDVVVILGGTSSVRQFIQRMGRALRLKPHRAKIYEVVTAKTREVDMARRRKRGVS"
FT   gene            complement(292613..293479)
FT                   /locus_tag="Pcal_0300"
FT   CDS_pept        complement(292613..293479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0300"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   pai:PAE2445 ornithine cyclodeaminase (ArcB)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07736"
FT                   /db_xref="GOA:A3MSW9"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSW9"
FT                   /protein_id="ABO07736.1"
FT                   /translation="MLLLPNIDPLVDPGEAVEAIRRGYLTEAKFLPRQALTVGDVWFAP
FT                   MVAHMGGKIAVKLVGIYPRARPTVKAVVMVIDPERGSPLALINGTQLTGWRTAAASAVA
FT                   ARAMGAEPETIGIIGAGLQAEYHLRVFKALYPSASFKVYDIEPTRAAQLAAKYGAVSVT
FT                   HAEALGSDLVIAATTSKSPVVLGATLKAGAVVITIGAPRPVRELDDEVKRRAGCMLVDN
FT                   PHAAEESDDVAPKWVYMGDFLRGARCDFGEIKVYKSVGNPLFDAAMALYVVEKAQRTGL
FT                   GVEVAWD"
FT   gene            complement(293501..294145)
FT                   /locus_tag="Pcal_0301"
FT   CDS_pept        complement(293501..294145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07737"
FT                   /db_xref="GOA:A3MSX0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSX0"
FT                   /protein_id="ABO07737.1"
FT                   /translation="MVYIFDEGGLIHLQIPLVALEGGEVKEEVVELVAERDGRVVSGPY
FT                   STVQEALYGALQRLAEAISAVESSLDTLEFRLETEERVSPGEVYTALYNSHMLYFAASQ
FT                   LRQLAVELKRRGLVGYRQYAYARSLARRALLLRRFARDVRLLYSTVVQMSLDVSVKRLT
FT                   WLGTVALPALIITGFYGMNLSWLPLADNPPAVFVILAAATAGFAYILGKLF"
FT   gene            294159..294668
FT                   /locus_tag="Pcal_0302"
FT   CDS_pept        294159..294668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0302"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: pai:PAE2439
FT                   conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07738"
FT                   /db_xref="GOA:A3MSX1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSX1"
FT                   /protein_id="ABO07738.1"
FT                   /translation="MGLKEVEARDAAALALLLAVMLALPSPLGYLAVFAAVVPYYKKIT
FT                   WATFSPSPLAAALLLYTTTFLVDYATVGIPTQRPPWLTAVVFAPLAEELVFRALAFALL
FT                   PTPLSWVFSVVIFGVLHLDNPLLAALYGAALSLAYRGGGYFASSALHAFNNALWLYLAQ
FT                   CLHGCA"
FT   sig_peptide     294159..294266
FT                   /locus_tag="Pcal_0302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.959) with cleavage site probability 0.886 at
FT                   residue 36"
FT   gene            complement(294665..295041)
FT                   /pseudo
FT                   /locus_tag="Pcal_0303"
FT   gene            complement(295228..296679)
FT                   /locus_tag="Pcal_0304"
FT   CDS_pept        complement(295228..296679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0304"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: pai:PAE2438 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07739"
FT                   /db_xref="GOA:A3MSX2"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSX2"
FT                   /protein_id="ABO07739.1"
FT                   /translation="MRRVRYRKSGVKVALAYPSTYSVAMSSAVYHVLYFKLQDEGFYVE
FT                   RFTADRGPRGVEEGTPLSHFDYVVATVHYELDYINLTKLLIEAGVEPWARARERPKVVV
FT                   GGPPVTANPEPLADLADLIVLGELEAVWDKVVQYLATGDRVEGAGMYYPADGPYEVAVA
FT                   YAKDVEEADYRRLPEPEAAFSLSVELARGCPFSCLFCMESYIAKPYRPRGWEKALEEAE
FT                   LLYKRYGVRPSLVALTANAHPGFKELLSEAARRWVPLSLPSLRAELLDDEALELVAKLG
FT                   QKTLTIAPETSERLRKALGKEVSDADVLKVAKRAGELGMKLKMYLMVGLPCEREKDLEA
FT                   VKALVKEAARYAKLYLSVNPFIPKPQTPLQYHPMEEPQALEEKIESIREVHRGEFSSYD
FT                   PRLAAIQAAIALGGRDVSRHIVESASSDKPMAYWRRLLKAGALSYVFRPREEPLPWSHV
FT                   KGFYAAEELRQRYRRYVEAACGSVS"
FT   gene            296712..297149
FT                   /locus_tag="Pcal_0305"
FT   CDS_pept        296712..297149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07740"
FT                   /db_xref="GOA:A3MSX3"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSX3"
FT                   /protein_id="ABO07740.1"
FT                   /translation="MDVIRTLRRGEYIAYLIVLGLTAVLLGLSVYLAGYRLYELATTAA
FT                   SSPAALSQAIYNALSDVFLVVIFVELIDTFVTYLEKKRLIVYRIIDVALVALARELFIY
FT                   LAPVNAEFKIDKGVALILATAVIGFVDYLQRRGITLGRRRR"
FT   gene            297204..297590
FT                   /locus_tag="Pcal_0306"
FT   CDS_pept        297204..297590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0306"
FT                   /product="SSU ribosomal protein S24E"
FT                   /note="PFAM: Ribosomal protein S24e; KEGG: pai:PAE2434
FT                   ribosomal protein S24"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07741"
FT                   /db_xref="GOA:A3MSX4"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSX4"
FT                   /protein_id="ABO07741.1"
FT                   /translation="MSPVSEAQFNILSLRENKLLGRKEVLVEILHRKSSTPTRQSVREW
FT                   LAKQLGVEVDKIFVRKIKTEYGIGKSKAEVHVYTDGALARVIEPLYILARNLGEEGKKL
FT                   LEEARKRRNERREKRRRKKKGGGK"
FT   gene            297593..297790
FT                   /locus_tag="Pcal_0307"
FT   CDS_pept        297593..297790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0307"
FT                   /product="Ribosomal protein S27a"
FT                   /note="PFAM: Ribosomal protein S27a; KEGG: pai:PAE2432
FT                   ribosomal protein S27"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07742"
FT                   /db_xref="GOA:A3MSX5"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR022845"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSX5"
FT                   /protein_id="ABO07742.1"
FT                   /translation="MSKKAPAKEGKKLPRAATWYEIDMEKGVFRFKNKLCPKCGSVMAF
FT                   HREPVPRWHCGKCGFTQFQR"
FT   gene            297763..298782
FT                   /locus_tag="Pcal_0308"
FT   CDS_pept        297763..298782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0308"
FT                   /product="putative metalloendopeptidase, glycoprotease
FT                   family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: pai:PAE2430 o-syaloglycoprotein endopeptidase;
FT                   TIGRFAM: putative metalloendopeptidase, glycoprotease
FT                   family; PFAM: peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07743"
FT                   /db_xref="GOA:A3MSX6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022449"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MSX6"
FT                   /protein_id="ABO07743.1"
FT                   /translation="MWFYSVPEVIIGVESTAHTFSLGLVSGGRVLGQVGKTYVPPAGRG
FT                   IHPREAAEHHAKAAPQLFRKLIEEFNVSLGDVEAVAYSAGPGLGPALRVGAVFARALAI
FT                   KLGVPLVPVHHGVAHVEIARYATGSCDPLVLLISGGHTVVAGFSDGRYRVFGETLDVAI
FT                   GNAIDMFAREVGLGFPGVPAVEKCAEAAEELVAFPMPIVGQDLSYAGLTTYALQLVKRG
FT                   IPLPVVCRSLVETAYYMLAEVTERALAFTKKRELVVAGGVARSRRLREILYEVGREHGA
FT                   EVKFVPDEYAGDNGAMIALTGYYAYRRGIAVEPGESFVRQRWRLDTVDVPWFYDLCNR"
FT   gene            298811..299137
FT                   /locus_tag="Pcal_0309"
FT   CDS_pept        298811..299137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07744"
FT                   /db_xref="GOA:A3MSX7"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSX7"
FT                   /protein_id="ABO07744.1"
FT                   /translation="MVALSLVAAGAALVTFAVVNALLLYFAGAPKVSLNITAPLLGQTI
FT                   TARISGVPDPYAVGTAVARGVILLTIGLIGAKLLEVGLGELRRQREEETRRQYYEQYYQ
FT                   YQQY"
FT   sig_peptide     298811..298876
FT                   /locus_tag="Pcal_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.634 at
FT                   residue 22"
FT   gene            299142..299432
FT                   /locus_tag="Pcal_0310"
FT   CDS_pept        299142..299432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07745"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSX8"
FT                   /protein_id="ABO07745.1"
FT                   /translation="MFKYFKALEERGLGEWVDRAFPTAAVFRLIEEAAGATAEEVVERL
FT                   VEVIAPNIHPEVAGEVVGHRGEGAVLVVARAVALWYLQVAEELGVVRVRRR"
FT   gene            complement(299387..300568)
FT                   /locus_tag="Pcal_0311"
FT   CDS_pept        complement(299387..300568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0311"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: pai:PAE2426 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07746"
FT                   /db_xref="GOA:A3MSX9"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023980"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSX9"
FT                   /protein_id="ABO07746.1"
FT                   /translation="MAYAVAPIEDKYKVVPTTDPLRDAHELQRRGERVLVLYSLSTPLF
FT                   VEIWQEVREVASKYPVVAGGPHAAGDPITLLKLGVKYVVIGDGEVALPAIVEREAEGLE
FT                   EVPPNTLMLVDGRVRAGRRIYAELIHKTYSTSLGAYPPIEIMRSCAYRCTFCQTWFHGS
FT                   VRYRPVENVAQMVKHYVAAGREEIRFIAPVGFLYGSTDGKTPNVDALVGLLRAVREAGG
FT                   RPYLGTFPSETRPETVTRDVLGAIKPFVANRRLSFGLQSGSERLLASTKRDHDVAVVEE
FT                   ATATAVKMGFKPVVDVIAGLPGEEEEDVVATVKAMERLVSMGAHIRLHYFMPLPGTPLW
FT                   GREPKPPHPLYWDFLKRHRKRVEGYFEEQIRLSRAILETYRLLTLTTPSSSAT"
FT   gene            300639..301328
FT                   /locus_tag="Pcal_0312"
FT   CDS_pept        300639..301328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07747"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSY0"
FT                   /protein_id="ABO07747.1"
FT                   /translation="MKLAYVKGPLVAVFAGSWLCEKSPVDGVPILLGEPIGECAGDVAR
FT                   LISIATTVRAVKRLGARVYVSEALGADGVDAAFAGGADGVVEELGASKDAAGGTQAVVV
FT                   EAGDVAELLNKARRLGEEVRRGFEVLVAAPFDKAVELAPFVDGVVLTGGWVEVGLEEVG
FT                   HVPEVGRCTACGVDYLMYGETIRRCVYCGRRLVKVITSTRPPRSRPVFRAVAKKYLKLA
FT                   IHRFKVV"
FT   gene            301436..303865
FT                   /locus_tag="Pcal_0313"
FT   CDS_pept        301436..303865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0313"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="KEGG: pai:PAE2423 phosphoenolpyruvate synthase
FT                   (pyruvate,water dikinase); TIGRFAM: phosphoenolpyruvate
FT                   synthase; PFAM: PEP-utilizing enzyme; pyruvate phosphate
FT                   dikinase, PEP/pyruvate-binding; PEP-utilising enzyme,
FT                   mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07748"
FT                   /db_xref="GOA:A3MSY1"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSY1"
FT                   /protein_id="ABO07748.1"
FT                   /translation="MPFIKWITEVGKNDALLVGGKGANLGEVAKLATVPPGFIVTSEAF
FT                   RYFQQSVGLAERIREVLNAYIRSGEPEEYEKASAEIRRMVEEAPLPPELERAIVEAYMR
FT                   LGEEVGIKDVAVAVRSSATAEDIPEASFAGQQDTYLNVRGAEKVVYYVKKVWSSLYTAR
FT                   ALYYRDKMGIPHEKSLMAVVVQKLVNARSAGVIFTLDPTNGDTSKVVIEASWGLGESVA
FT                   RGLVTPDEYVVDKATFKIVEKRISPKKVAVVRDEAGLTKEVELPPEKANAPALSDEEAV
FT                   ELAKMAVKLEQHYGHALDIEFAVDADLPFPRNLFILQARPETVWSRKAERPKASVVPAG
FT                   TVVVKGIPASPGVAVGTAKVCLTLEDAKKKLKKGDILVTKMTDPDWVPYMKLAAAIVTD
FT                   EGGRTSHAAIVSRELGIPAVVGTGNATSVLKDGEVYTVDGSRGVVLAGAVAAKAEEAKA
FT                   PAAAVAPPREIILHIYRAVPTGTKVYMNLGEPEKIDEYKDLPFDGIGLMRIEFVISSWV
FT                   GQHPLYLLSIGQEQKFVDKMAEGIAKVASAIYPRPVVVRFSDFKSNEYRGLEGGEKFEP
FT                   EERNPMLGWRGVSRYVSPQYEKAFRLELRAIKKVRDEMGLNNVWVMAPFVRTVWEAERF
FT                   SRLLEEEGLYRDRDFKVWAMAEVPSIAFMVEEFAEYFDGFSVGSNDLTQLVLGVDRDND
FT                   FLVRINPRYFDEREAPVLKAIYELIRRAHRVGRTVSICGQGPSVYPQLVEFLVRAGIDS
FT                   ISVNPDAVLQTRVLVASVELKVLRERLDAIYSALYKRDSDEEFAEIVKKVFGGVKY"
FT   gene            303931..304644
FT                   /locus_tag="Pcal_0314"
FT   CDS_pept        303931..304644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0314"
FT                   /product="potassium transport membrane protein"
FT                   /note="KEGG: pai:PAE2422 potassium transport membrane
FT                   protein, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07749"
FT                   /db_xref="GOA:A3MSY2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSY2"
FT                   /protein_id="ABO07749.1"
FT                   /translation="MDLGFILIGIAVGVVVFLLLDYFVKRIFSRVLDSEQLLLLRLLAA
FT                   LFSLSLIFAIVSPVAQIHHLFYLLLVILVFSLGSFILGTRRILEQYLTGLFVARLLDLH
FT                   VGDYIELGDLRGYITALEDAYLVVRDPRREYVYIPYTVLLQNPFRRIKSPEGHEVRIRL
FT                   FVPSGQDVKRIRSLIEEVAREFGVERLSVDVEKIGARGVTLVVRGVLRDPRQEDELKYA
FT                   VLDKVYASMMGGATL"
FT   gene            complement(304634..305263)
FT                   /locus_tag="Pcal_0315"
FT   CDS_pept        complement(304634..305263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0315"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: TrkA-C domain protein; KEGG: pai:PAE2421
FT                   potassium transport peripheral protein, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07750"
FT                   /db_xref="GOA:A3MSY3"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSY3"
FT                   /protein_id="ABO07750.1"
FT                   /translation="MAREALVLDSNDDLALQLVRVLAENGYVVRVLVPRERTKIFEKFP
FT                   VYIHTLSENYEKVVKDIDFSKIEVAVFPSPNDMLNLYFARFAKSQGVPIVVITTRSSQA
FT                   AKQAEELGIEAVVVYHCVLSRMLRILNLRFARIVPIRGEVAMLEMVVTADSKLLGRKIG
FT                   EVEEETGAKVSIVRGDDFVTSPEEEIQEGDYLVAIGPQGDLQRLTE"
FT   gene            305344..306576
FT                   /locus_tag="Pcal_0316"
FT   CDS_pept        305344..306576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0316"
FT                   /product="cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes; KEGG: pai:PAE2420
FT                   cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07751"
FT                   /db_xref="GOA:A3MSY4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSY4"
FT                   /protein_id="ABO07751.1"
FT                   /translation="MYLFVMFFILLIERTKDLYMLVELVLMRRGSIVVRGYKHLDPYGA
FT                   IQPPIYLAALFRMEGEAQRSDRGLDLKYSREDNPTLRPFEEVVAKLESGVDALAFNSGM
FT                   AAISAVFMARLAGGDVVYVPMEAYGATLRLLDSLGKFGVKVVRGFPDTEPFIEGIKAAR
FT                   PRLVFFETISNPTLRVLDLPEVVKAAKDLGAEVVVDNTFATPLLITPLEHGADLVVHSV
FT                   TKYLAGHNDVVGGVVVAKSREQVEELWLWRAMLGGIMQPWEAYLAFRGVKTLVVRFERQ
FT                   CRSAMAIAEYLADHSKVSEVLYPGLPTSPYYHVARRLFGDKFGAVVSFRVKGGRDAVLK
FT                   FFKSLRLITPGPSLGGVESIATYPIASAASPIPDEDKRRLGITEDLVRLSVGLEDPEDL
FT                   IEDLDQALRST"
FT   gene            306573..307706
FT                   /locus_tag="Pcal_0317"
FT   CDS_pept        306573..307706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0317"
FT                   /product="Protein of unknown function DUF650, N-terminal
FT                   domain protein"
FT                   /note="PFAM: Protein of unknown function DUF650, N-terminal
FT                   domain; KEGG: pai:PAE2419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07752"
FT                   /db_xref="GOA:A3MSY5"
FT                   /db_xref="InterPro:IPR006978"
FT                   /db_xref="InterPro:IPR006979"
FT                   /db_xref="InterPro:IPR033167"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSY5"
FT                   /protein_id="ABO07752.1"
FT                   /translation="MNICVKCRGRKLLCGLPKCPIEPRARAFHLALRRISGREVFGSTP
FT                   PSVIVGEFGWPSVRVYLGEPPEVFGEEARRYDDPRLLWGLSLEEISALRSYMAFGVKTA
FT                   RTPWELGELAFVYVSSRPVDVEMRLEKPPVPSLKFDLREKPLGPRAPLESARVVENPSP
FT                   PRPLESLINDDVSAHEAVVELYSRGVDLYIIQRAFSLGLLGARHRRRLVPSRWGITAVD
FT                   VAVGNWLAEAVRHFGEVPSPLYGYGEYLDNRYLVVVVPGPLRFVYLERWQQGDRAAEVL
FT                   VKEDPRGVRSTMDGGFEAARVAVLEKLYAMRRRGSVGIVRWIGEGYYVSVGNWQIRETV
FT                   RRIQLRPLDEEYKAYVERVGADPLKLLGTSKPLTDFI"
FT   gene            complement(307699..308001)
FT                   /locus_tag="Pcal_0318"
FT   CDS_pept        complement(307699..308001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07753"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSY6"
FT                   /protein_id="ABO07753.1"
FT                   /translation="MIDVYLGLIATLLLAVATLAVLFTVFDNFSTPSVCTAVKIALENP
FT                   GSEVIAYGKVKVWDLDDRLYFSCGVAVEKRRIMTVEKTEGLLTIGTTAEGLLYIK"
FT   sig_peptide     complement(307939..308001)
FT                   /locus_tag="Pcal_0318"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.942) with cleavage site probability 0.882 at
FT                   residue 21"
FT   gene            complement(307998..308264)
FT                   /locus_tag="Pcal_0319"
FT   CDS_pept        complement(307998..308264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07754"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSY7"
FT                   /protein_id="ABO07754.1"
FT                   /translation="MRADTIFILVVFALAVATLSWIKPVKFYKTDLSAIFLYWPEAYAY
FT                   AERGDPTAVYRVTSLVTCATSGTIAAPPGIAFSVLGMSCRLKP"
FT   gene            complement(308266..308772)
FT                   /locus_tag="Pcal_0320"
FT   CDS_pept        complement(308266..308772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07755"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSY8"
FT                   /protein_id="ABO07755.1"
FT                   /translation="MLTLRYLILVAASTAATAAVVAAVLLAMQYADPYTRTVAESIAAE
FT                   KVASSPRPLTLQTFKAYYIFEDGKWVLRRNISESPHLPVYILAVGQCEYPTALLNKTYT
FT                   HNNATVHVTYCSYVLPTVEVKEVVEVRHFAAICREGTRFTTEVYVQQLLLATIPMVVKL
FT                   VLVKC"
FT   sig_peptide     complement(308704..308772)
FT                   /locus_tag="Pcal_0320"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.716 at
FT                   residue 23"
FT   gene            complement(308760..311699)
FT                   /locus_tag="Pcal_0321"
FT   CDS_pept        complement(308760..311699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07756"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSY9"
FT                   /protein_id="ABO07756.1"
FT                   /translation="MLWLFLTLVITLGTLASPLYAAITITYVGNFTYKTTDTVHISFKF
FT                   NTIAPAYGDLVSVEYPYGATTTSVWDVEFLDLRNRAWPTVRVFSTAWEGRWDRDLVYVL
FT                   NLYYFAPGQDWVLERYRVDWSGLTLYFCKVVKTPNRVSDTIKFETSRSQVQFFDYRSIK
FT                   VSLPIQYRVPWYCDYVVKDLWICGGSLCFISFDEQNTYSVSAPSSWHAEEINGFKAGDV
FT                   VKWGGVEAKIPNPWTYRNAPFPSSGSFLYDISISVTAEPELWGSVELAPPREIPLYISR
FT                   AVFGKPTDCSPPFCFLINSVGNSTWVGTHWVWNSTMYSAAFKTSFNLRPYIAFAPSALR
FT                   PALTRGISIELPLGSAVGFRVAVLWELDMAARRVWINSALGTFLRAAGTDGALIDYEEV
FT                   SKNKKLAYSTPPLSTGHGVKWAELQIAVDENTRAIKTAWYSPPDPCAQWPQQIFTCVYR
FT                   QPVFTKVNGVWVSYARVGPPGRGWPMRWLELVDWLIPYSFLNGRGTDLLSMLYGDYALF
FT                   YDHVYRLRTWAFNPATGDFDVPSELVIRGARVSLVSLATSLGEYRNTTRDNAKLFYYTS
FT                   SPYYGQFYNYLFEGVSNWELPAGWTDALPLGLAGMLSNETSPWLVSLVPTTACTSPICV
FT                   DIKPTLWGPTPSPVADVALPGAGYSLLITYIGEPRTVTVRIYVERGQILQRTASGIAHE
FT                   PICNAPLATVSKTWVPLDGVYVGPGWWLPYKPLAPCESAQINVNSIYTTPGNYTGPVLV
FT                   TIEEAETGKRYHFAFIVTNDVSLELRSTSRAPPVYTANAEVPLNTTALLYLGGSPYFHG
FT                   LPGAGEGGRRFAFRCVTTTVSGRSYADVAQGAAQLSVAGDFWGEVEIWIKARVKEVQVL
FT                   PIFEAADPERGLVKVSGGTGVVGFAFYLFRDGTWVQKAAVAGSCAVVNASKIAPWDPVL
FT                   VLPIVDWRAFVYPNGEAQIPRPRAALLSKTWADLPQTETSTVEAWPCSR"
FT   sig_peptide     complement(311634..311699)
FT                   /locus_tag="Pcal_0321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            complement(311730..312395)
FT                   /locus_tag="Pcal_0322"
FT   CDS_pept        complement(311730..312395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07757"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSZ0"
FT                   /protein_id="ABO07757.1"
FT                   /translation="MWSTAFGLVALAVVLFVATYAALHTPTLATVNLADQLYAAKTALN
FT                   MLDAFNAYANYSAFQNAAPNAVLVKDVVVCPPGLGKPLAVAVPVGYKLSSEGRNVRYQL
FT                   YVNLASCRNVTTPWGEPAALYEVELIHSLDFLPWLDVVAVPVENLTQYLLSINYGAPLL
FT                   GRLSAYPAAKAQWAMVYYGNVTKLYIVAPQSTPLIYIVDYPLRLPLACPEVIQRLFSC"
FT   sig_peptide     complement(312324..312395)
FT                   /locus_tag="Pcal_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.551 at
FT                   residue 24"
FT   gene            complement(312397..312747)
FT                   /locus_tag="Pcal_0323"
FT   CDS_pept        complement(312397..312747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07758"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSZ1"
FT                   /protein_id="ABO07758.1"
FT                   /translation="MIAVRDLVIFAGLMALVAATIASLYPAREGFSPPIHCGDCAYKLV
FT                   GPYTVVQRDYYAALLLGEREVEKFAWAYHTSGAPFRVNETLACTPLYVWVIGGVAFVSC
FT                   SPSEPKMGKRLW"
FT   sig_peptide     complement(312679..312747)
FT                   /locus_tag="Pcal_0323"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.779) with cleavage site probability 0.426 at
FT                   residue 23"
FT   gene            complement(312744..313223)
FT                   /locus_tag="Pcal_0324"
FT   CDS_pept        complement(312744..313223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07759"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSZ2"
FT                   /protein_id="ABO07759.1"
FT                   /translation="MEDVVAATAFIAALVSLFLYAVAVASQFIEVKIAESPLAPAGDAP
FT                   TRRVYVYATPTSSPLISSSLPVSGFGLVAVEYEGDVEELRRALGIGGVLVAVFEIYPGG
FT                   YRCRLAPGVKSVRIGDDPYTGLWCPPPFSNATVAGCSPVGIASRGRWLVVQYSCP"
FT   sig_peptide     complement(313152..313223)
FT                   /locus_tag="Pcal_0324"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.470 at
FT                   residue 24"
FT   gene            complement(313252..314208)
FT                   /locus_tag="Pcal_0325"
FT   CDS_pept        complement(313252..314208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07760"
FT                   /db_xref="GOA:A3MSZ3"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSZ3"
FT                   /protein_id="ABO07760.1"
FT                   /translation="MKYLLFLLLGVFTMAGLVSWYPPHALLINAYPVNSTHFTAQVGGK
FT                   VVYLRQIGLSFLGSPQEERAVLYYLSEACRYIAIDVQEATNSSNDFAEVWSGDLYCSPN
FT                   GTTWLWLKWLPLRFSAYASSIEFADANLTTYTPVGVFSGHVPAGWYLDIESKTVLRVPQ
FT                   TNISLIQSYQQLQAELRQLQKVVDELTRNSSNAVALVAQLREKVAELQRQRRELEEALR
FT                   LRESQIAALTSQLASARQEAEELKKRLEEAQKELEKARALLAELNRTNAALHAELAQLS
FT                   AEVRTEESAQLPIPLLIAAVVAGGIVAYILYRRRSSE"
FT   sig_peptide     complement(314116..314208)
FT                   /locus_tag="Pcal_0325"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.881) with cleavage site probability 0.243 at
FT                   residue 31"
FT   gene            complement(314240..314686)
FT                   /locus_tag="Pcal_0326"
FT   CDS_pept        complement(314240..314686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07761"
FT                   /db_xref="GOA:A3MSZ4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSZ4"
FT                   /protein_id="ABO07761.1"
FT                   /translation="MPKLRGLTTVESLLIAAAFIIVGVIGVLTFQGIGKSAAESLRANA
FT                   IVTADRGGFDVTIEVLNGKLTGIYLRYGPSGGALQLLTTGSCITSTTTNAQPNQLNLVA
FT                   GQSATCRFQASLTAGQQYTYVIYAVDTSGKAVQIAKGVVTIGIS"
FT   gene            complement(314717..315913)
FT                   /locus_tag="Pcal_0327"
FT   CDS_pept        complement(314717..315913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07762"
FT                   /db_xref="GOA:A3MSZ5"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSZ5"
FT                   /protein_id="ABO07762.1"
FT                   /translation="MDREDFYMVVAPIFATYLSVSSGNEALKYTSLNAVELNEEEARRL
FT                   FVASLMPTPSTQFLEDKSEVVRLYGFALAQEEAGVDRGVVVSTFLESVKALAVAKVEAR
FT                   VRLFESITSALGALFLLPLFFLFLWSIGVFSVDPALILATIAATALAAGAAVVLTSPQD
FT                   LNPLRVYSWSIPLGILAAVPLGLLASPPLALATFGVVALAWLKAGDRLWWFQIRREVPP
FT                   MLRATAAMLKEGAPPDVILARLTSKFKTAAKVAYGYYIPSRYFVLAKSMYRAITEAGGV
FT                   FAIKAVEYIQSIVDIEASAVRKMAKQAAAFFLLFTAAVLVLAFSVATSVHALQDSSAVN
FT                   PFFTPPPYDEVREVLSKGLSLVTASYVAVFLIPMGLHQAALIGGTAGLLVEQLLLQIL"
FT   gene            complement(315943..316281)
FT                   /locus_tag="Pcal_0328"
FT   CDS_pept        complement(315943..316281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07763"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSZ6"
FT                   /protein_id="ABO07763.1"
FT                   /translation="MCRVEKKAVKSGFTASTARWICELAGELGVDERRFYKAVAKLAKS
FT                   GIWLEEEDWRIAAKAVDLRKYLEMVVDYILRRVSSGASVEEAVRELPKAVEKAGKLAHI
FT                   REVLSNLV"
FT   gene            complement(316268..316507)
FT                   /locus_tag="Pcal_0329"
FT   CDS_pept        complement(316268..316507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07764"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSZ7"
FT                   /protein_id="ABO07764.1"
FT                   /translation="MLKRASLEKLLDGGGDGGRVEERGQSWVECLVRALSEMPQDVAKR
FT                   ILEAVPREAVLKTLSERDDPYVKLALLLLANVPR"
FT   gene            complement(316538..318067)
FT                   /locus_tag="Pcal_0330"
FT   CDS_pept        complement(316538..318067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0330"
FT                   /product="type II secretion system protein"
FT                   /note="KEGG: pai:PAE2399 type II secretion system protein,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07765"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSZ8"
FT                   /protein_id="ABO07765.1"
FT                   /translation="MIYAHADRGLTSRCVLKKEGVIVDRGVRTDICITDDLMYVVVDPE
FT                   LPDELQTALLLVMFRGAVPPDEREYPRVMKSIAEGLGDRAIWALYKDYREVVHYLLDRW
FT                   SGAREYAGYGALEAMMRDPFLTEIVIPQSVAPAAKFTYVPKTLREQLDYIKFQMLELGR
FT                   YRRVVAVRNELRLPTNIVIPEPLMYVVVKQLVPSLTMDKPLLTREDQVYKARIAADLLE
FT                   YNVNIRKMSSVPKPSKALLKPYLTRPRFEESSAGVTYGVEGLELLALASLVLETRGGVI
FT                   FSGGMGSGKTTQLNQLLYLVPPWVQVVAVERGAREIWAPLEGQLLHLSVPNEEKLWAAL
FT                   DQALRYGTVHTVVALAEARTPAELRTLASYKLTGHGALTTMHAETVRDAVTRIVEAEAP
FT                   PEALDSILVIQLSAVAGARYVKEAKALAAEGREVKVVDVSQLTPRLAAYVREMYDVELK
FT                   QELALRVEAVLKAAEFEDPLEARRTIVEMLWGKRLDFKAAVAEEARRFGYT"
FT   gene            complement(318064..318768)
FT                   /locus_tag="Pcal_0331"
FT   CDS_pept        complement(318064..318768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07766"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MSZ9"
FT                   /protein_id="ABO07766.1"
FT                   /translation="MRPVKVVVITSLDGGVGKTTLAAVLSVAKGYTLLVDMDWEKADLS
FT                   QLFRAPRKPGWLAPYINGSMPYVHRINPMLYLIPGFEAFEAYQKFGVDVVEDFEQALLE
FT                   WARVMPKLVQKLRLPVDTVVIDTTAALRTEVLAALQSSGVYTVFMSDRRLISRISDVKA
FT                   EQYRRYMAYSSLVVVNMVEKEEVRVAKKIAPVVIKRVKIQEFSGESVADAVLSDRENRK
FT                   AVDTILMRLKAV"
FT   gene            complement(318765..319064)
FT                   /locus_tag="Pcal_0332"
FT   CDS_pept        complement(318765..319064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07767"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT00"
FT                   /protein_id="ABO07767.1"
FT                   /translation="MLDEATLAMLKELERACVNSEFYKANRDLCIAARIALLNIKGRAV
FT                   KLRPSLLGLEELSDRKAASYVIEEIKREVGPVADSESIKEAAAAVVYRKLRERI"
FT   gene            complement(319057..319647)
FT                   /locus_tag="Pcal_0333"
FT   CDS_pept        complement(319057..319647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07768"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT01"
FT                   /protein_id="ABO07768.1"
FT                   /translation="MIARVEEVAKALGEGWALRWGEAPVGGVYMLKEAYMWRPEDVEPY
FT                   CKRPEKPIVIYIVASVEGLDVVYSRVRPGPLSCPVATFVKKYRWSDVRTAVKSLVEFIT
FT                   RVERIPYFQLNPELLRLAGLCGEYPLVCDDPFEVIRRVAAPRGGGARRLSQSRPVLEEL
FT                   VKVLRERLEFDASFEEVVRRVVEDPERLRACYA"
FT   gene            complement(319644..320342)
FT                   /locus_tag="Pcal_0334"
FT   CDS_pept        complement(319644..320342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07769"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT02"
FT                   /protein_id="ABO07769.1"
FT                   /translation="MVLSLLYLVKARVDPCIFLHREPRDWVELLGRDFVEVLLERLSHV
FT                   VNSVDELVDYIFSNPRVAHLVVRGLRIGGRFRDEWLLFAEGGYVHPGARAAWPYVKNDV
FT                   VLDVRVQVSPCYLLTSLTSGDRRYVWRNRASALFKWVSDVPESRPWEVFREAFPRWLRE
FT                   LAWERGYAWVAWTRWRDRRNGHLAEWLYWLDTGRMPHIDFMMGRRAVCNSSGCTTVQAP
FT                   RGFVQFGVSA"
FT   gene            320649..320870
FT                   /locus_tag="Pcal_0335"
FT   CDS_pept        320649..320870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07770"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT03"
FT                   /protein_id="ABO07770.1"
FT                   /translation="MAGEISITLTSEYLVRQIYARLAGELKNLGGAVAPVVEGRTIRVQ
FT                   YVKGVEEVLWRVVKSTPAAVFASIDFKK"
FT   gene            320883..321485
FT                   /locus_tag="Pcal_0336"
FT   CDS_pept        320883..321485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2378 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07771"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT04"
FT                   /protein_id="ABO07771.1"
FT                   /translation="MPRVAKPCIFLGSCSGDLGDTEVLWLGKPLCVSKASGIIKVFGAL
FT                   ETALAYLNLAALKCERQRKCLTRLYWSLQNLGFYLSTGEERYFAQSLHMLQKGIHCLKP
FT                   LLPDTPLGWIYCLDECCGYVNSARAWVRWVERRITAVEEGRKAILVLNHLANALFETMR
FT                   TANHGVKIGNRLVVPQTQLDAPVPPCLDECPTNGKTA"
FT   gene            complement(321489..321593)
FT                   /pseudo
FT                   /locus_tag="Pcal_R0004"
FT                   /note="tRNA-OTHER9"
FT   tRNA            complement(321489..321593)
FT                   /pseudo
FT                   /locus_tag="Pcal_R0004"
FT                   /product="tRNA-OTHER"
FT   gene            complement(321689..322102)
FT                   /locus_tag="Pcal_0337"
FT   CDS_pept        complement(321689..322102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0337"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: pai:PAE2384
FT                   universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07772"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT05"
FT                   /protein_id="ABO07772.1"
FT                   /translation="MERIVVGYDGSVYSKKALEKVKVLAEKFGSKVYVVHVIDTAVLSL
FT                   SDVFASPSILASLREKADYLVKEAVQLLGGNAEGKVLEGDPAHEIVKFAKEVNASLIVL
FT                   GSRGLSTIRRVLMGSVSSRVVQESPIDVLIVKG"
FT   gene            complement(322131..322568)
FT                   /locus_tag="Pcal_0338"
FT   CDS_pept        complement(322131..322568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0338"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   pai:PAE2382 conserved protein with 2 CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07773"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT06"
FT                   /protein_id="ABO07773.1"
FT                   /translation="MKAETIARRPPITATPDAKIKEVARIMAEKKIGLVVIVDKSQPDV
FT                   AVGVVSERDIVRAVAKGVNLDGPVSAIMSTPVITVEGDEPVWKVAEVMRQHNIRHVVVT
FT                   RGGKLYGVISIRDLVAEEPVLRSLVEFGRGERHEEYAPAGD"
FT   gene            complement(322608..323810)
FT                   /locus_tag="Pcal_0339"
FT   CDS_pept        complement(322608..323810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0339"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pai:PAE2385 transport protein part 2, authentic frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07774"
FT                   /db_xref="GOA:A3MT07"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT07"
FT                   /protein_id="ABO07774.1"
FT                   /translation="MCDGFVGISEWFRGNVGVMMISWFLFAISGSLTMPYMSKYMHMLG
FT                   ASDVEIGVVRSLGALAVMVTILPGGVLTDVIGRKRAIVVGTWGISVVQFFYALVQDWRQ
FT                   FAVVYVVDWALHFYQPALTAILLDSLPPEKRGGGMMLTAVLPQIPWLFLPPVGGFLLDS
FT                   FGLLGMRLSFLLSGAISTAVALLRMKALQETITPRRAVSLRELLDSYAFWRGFASLPPF
FT                   MAYVTFLGFTSSLAAVSLQTFGVLYATNVIGIDNTSWGVINSAATAVGILFGFVLMPVI
FT                   DKAPRVHALFSGLLLTAVGYLMLGVWHNVVSLVASAIITGIGFEIAMSIRRALVGDYIT
FT                   PDNRGRVMGLTLALEYLGSIVGGVATGYIYAAWPHGAFLFSSVILFGSAIPLLFQVLAK
FT                   R"
FT   gene            323906..324565
FT                   /locus_tag="Pcal_0340"
FT   CDS_pept        323906..324565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07775"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT08"
FT                   /protein_id="ABO07775.1"
FT                   /translation="MNNWVVFALGLAITAGVLFATLATGAYQREHLFKPYWEDPQKRQQ
FT                   ILTTAAQVGIEVSRGNEGVVVVGYRDQIGAPNRQELLSVLNQLLKDAQGYTVYLAPWAT
FT                   DNATRQYLSLLYTGQLKPEDYLRGVLTNATAQSPRVDQAARLADEVATAYGTYRPLGGQ
FT                   PAAPRPPIYVAIFRYDTTYVVYEPFTPGRDTTYSDWYKWVKTALENLRQGQGRTTP"
FT   sig_peptide     323906..323968
FT                   /locus_tag="Pcal_0340"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.644 at
FT                   residue 21"
FT   gene            complement(324651..325385)
FT                   /locus_tag="Pcal_0341"
FT   CDS_pept        complement(324651..325385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0341"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   pai:PAE2388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07776"
FT                   /db_xref="GOA:A3MT09"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT09"
FT                   /protein_id="ABO07776.1"
FT                   /translation="MFVPFLAGLLGGLLGPLIGVGGGVVIVPLLNFSGASFQSAVAASL
FT                   FSIVVTSLTSIFNYRGLLNFRLLWRYMALSASAAVLSALASVKYSGEWVKLAYGVYLIV
FT                   VGVVLLVEARPRRRAPVLGYLLIFAGGLASALFGVGGGTVFVPALVLAMGFDAKAAAAS
FT                   SMGIILPTAVASTLMYASLGVLDVVLGVAVALGSFIGAFVASRYIMPRLKSQHVRKMFV
FT                   GYVFAVGAYYLFSTGALLFSRT"
FT   gene            325491..325667
FT                   /locus_tag="Pcal_0342"
FT   CDS_pept        325491..325667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0342"
FT                   /product="Preprotein translocase subunit Sec61beta-like
FT                   protein"
FT                   /note="KEGG: pai:PAE2389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07777"
FT                   /db_xref="GOA:A3MT10"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR023531"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MT10"
FT                   /protein_id="ABO07777.1"
FT                   /translation="MARRRKYEGLNPFVAAGLIKFSEEGELEKIKLSPKAAIAISLAII
FT                   AAILALNLLLPPP"
FT   gene            326178..326262
FT                   /locus_tag="Pcal_R0005"
FT                   /note="tRNA-Leu1"
FT   tRNA            326178..326262
FT                   /locus_tag="Pcal_R0005"
FT                   /product="tRNA-Leu"
FT   gene            complement(326319..328100)
FT                   /locus_tag="Pcal_0343"
FT   CDS_pept        complement(326319..328100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07778"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT11"
FT                   /protein_id="ABO07778.1"
FT                   /translation="MECQRQLEGYRRYVELARFRSGKCRLPGRACGYAEADIRLMWQYI
FT                   EDTAPLCGKLIRTLAVVEEKFRGLGLAGLRGSYRVGVSRPDKLNPNRKIVTLYLERPVY
FT                   ATIALWEKRLYVYYDNVPIGDELRGHKLKEVAWEAKQAGIPVEAYDVDEEYKRLWLEVP
FT                   LPKLVSRLLGGRDKGPVVLFRNLGWLLSDDWRREIRHAAGNFGQVAVRLFDWIALAEYA
FT                   VVRGIAPKAPLAFKLAIRKVTKSGGCENPTVDARPIDTTAEAIQAAYEWFGIKLGKTEE
FT                   VLVRGYAALKALREETFKRYGKMYVVNDVGAWIAFSNVVDMLVIGDGYITPVELRVVAK
FT                   SVLRATLEGETTLVKDLANAIGGTAVGKEVKFQSWHMRLLLPTPPTPAFEKTVRLFETL
FT                   ANYPAAAVVELNDTTYMLTHNGGGEFAIGKGKGVKLYDAVNRLGLKARFKRNLLLLSYT
FT                   QLEELARLGFVVRLLNDAEKDAIKEVKPVMSTADVETIKRVLEEMAKMARIVMAKDRGR
FT                   VYIRVIPYDKSKVEEIVAKLRAVGIRVTVLHKKREVRIHERRSVETIREIAPALFALLH
FT                   RSLHFAVAPQECCSTRM"
FT   gene            328795..329931
FT                   /locus_tag="Pcal_0344"
FT   CDS_pept        328795..329931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pab:PAB0539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07779"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT12"
FT                   /protein_id="ABO07779.1"
FT                   /translation="MLLRVENFKSIGHMDLRLASLTILIGPPGGGKSNILDAAALVGYF
FT                   ARFLRDEYDVQTSAYEPLPILARFSAPQQLFTYGDITKRVFIELAPEPGKGAALELQYS
FT                   GGSPKAVFNGVSVPWDLILARLPILMALNFSSFLSALRRAANNEPLMEARLYGYDRYGL
FT                   SSPHCETRLSCGFVARLRGQQSVPYPKNVLSELGWNAMALAKSVRDVVVELNATLEELE
FT                   VGVEVKFLQSGAVVVFDRDYEVESSSVSDAVFRTLYYLMAVRTSMNYVKLYGLEGRYVV
FT                   LLEEPEAHVFPYFLSLLANYLARAAEHMYVVVTTHNPLFVSMLWDRVKELKTYYVARDR
FT                   EGLTRAWEVDVGKLARDLATAEDLLYMPPREVVAKYST"
FT   gene            329934..330422
FT                   /locus_tag="Pcal_0345"
FT   CDS_pept        329934..330422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07780"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT13"
FT                   /protein_id="ABO07780.1"
FT                   /translation="MELTVVPECYANACFAQKLVDILRAAHGVNPRVIHRRVSGRDRIL
FT                   NILKQLPQDNVLVIIDYEVGPARKYIDENFDLERVVEGIYVGVFRRSQSVVAVVFDPRI
FT                   EEAFICRYLRERCNDVNWVRRVKSGEACIALVELFNGEAVAALLRKVGTAIVERLGGN"
FT   gene            330448..331389
FT                   /locus_tag="Pcal_0346"
FT   CDS_pept        330448..331389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0346"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: regulatory protein, MarR; transcriptional
FT                   regulator TrmB; Helix-turn-helix, type 11 domain protein;
FT                   KEGG: pai:PAE0146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07781"
FT                   /db_xref="GOA:A3MT14"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT14"
FT                   /protein_id="ABO07781.1"
FT                   /translation="MLWTVLLYANGTVLLLLNATLAGVVANVSLPASPLAKPYVALDGV
FT                   PVPFLFEGDRVVVPLGGGGVVTVKYVPRLGELDGFLYFNLTTPDLFVIWAEAGVLALPR
FT                   LTVLNFTKVGNDVIIVAKGPGALAYAKVSNVTRPPASTPQSTPTSTPPSPAPATAQSIT
FT                   PALPATTTTTPVVNVPHTQASTASPSSVVSPTAAAPPIATPAGPISTGSPSPSGQLLLA
FT                   IGVAAALAALAAVFVKGRRGGGGGATVGGLSEVDERILAYLRERGGAYESEIARDLGIP
FT                   RTTVFRAVRRLEEAGLVIVEKRGGRNFVRRVG"
FT   gene            complement(331373..332983)
FT                   /locus_tag="Pcal_0347"
FT   CDS_pept        complement(331373..332983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0347"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: Citrate transporter; TrkA-C domain protein;
FT                   KEGG: pai:PAE3063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07782"
FT                   /db_xref="GOA:A3MT15"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT15"
FT                   /protein_id="ABO07782.1"
FT                   /translation="MDFHTVVILAALFATVAASLRYRPDVAAFTALMALVLVGVYSLQS
FT                   ALSFLIAPAVVVLFGSMVISGVIAESGLLDLAAGSLAKRTRHMTILAAALYVVAGVASG
FT                   FVSDVAIVLALSALVAETAKRLKTTPVAYVLPLAFVVALGGRLTMIGNAGNVILLSTYP
FT                   QTTGEEVGIFQFTEPALYSLLLAVPLFVAIAKYAEKIAPSVPTAAKSVLVRALVGESLD
FT                   GAWKKEVETRERVKILTKRRVLRRGDVLLVKVLTSDIPARLRSRDLQILPLGEVKSDHM
FT                   EFLVVTQRSRLVGKSLALEPVHAAFPVAVVGIVAGGPVSSLETYVFKPGDELLVAGDEK
FT                   AIERLAAYYRLERAKSPVKTFRPRLAASGLAGLAVAVALSQFTDTALAFIAGTFVALAG
FT                   GGRAVERLYQMVSWETLIYVGSFIGIGQAVAQTGVLQPLAQYLNSPTTVFATAILATNT
FT                   IGLVPSAVVLGPLITNQAALMMYILGTMPILLPFAHPAVYLVYKETGLPLRDYLKLSAL
FT                   ATAAAVATTLAGIELSQLF"
FT   gene            complement(333457..334728)
FT                   /locus_tag="Pcal_0348"
FT   CDS_pept        complement(333457..334728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0348"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: pai:PAE0176 metabolite
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07783"
FT                   /db_xref="GOA:A3MT16"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT16"
FT                   /protein_id="ABO07783.1"
FT                   /translation="MDKWTRAHWELFAVVSASFFLDGVLFSLVPATVYLLPGLADYAVY
FT                   IFAANSLAFMAGALALGALTDRVGRRLGLIVSLSIYTAVAFAFVALYWAGWINLATALL
FT                   VTSLINFGVGGEVGPAYAAIAELSPPYLRGRAIMLATNFWNIGAAVIAGLSLWYKELAE
FT                   DPGTVVLNTFYSALALAVVVFFARLHLPESPRWLAAAGRVAEAKALAKRLLGTEEVNPA
FT                   TLEIGLGEAVRRYLFRLSVLITVTATQLVTYNIAAYYSPYAEGFAYGPESAPVVIAVAN
FT                   LGASLGAFLFIPLIDASRRAALLSAFLGGFATAVGLAVVHGAPQWAYLAVLFFNLVFSE
FT                   WAWASLSALESELFPTGVRSSVVGLVTASAWLINTAAVFTEGVLTAGQFLALNAAIWLI
FT                   GAMAATTWALRGVESAKRRLEELI"
FT   gene            334853..335770
FT                   /locus_tag="Pcal_0349"
FT   CDS_pept        334853..335770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07784"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT17"
FT                   /protein_id="ABO07784.1"
FT                   /translation="MRWIIPALVIAAAALAANVTYVVTPSGNIHITYQDNGTFIVINFN
FT                   NNKTLTINAKLNITNATDLYYIHVVGKAVGVYNSTAVKALLSTLQNATRAQALETLRQL
FT                   AYTLAASNSTRELKVKAFITARSLNATYNATWLRMKVEYEFEKKLGKLNGTRVTTENEL
FT                   EIKGYAANAQKLAEVLRALARQLAPVDNATASALLQISNRINGTAISLKTVQNGTEIKV
FT                   VYKNGKFEIEIERGRDKKHEERDAAGGKQEEKKEENGKEESKQGNKSNDDDSKEKKDSG
FT                   ESKKDDKKSDEGGGEKEKSEKKKR"
FT   sig_peptide     334853..334903
FT                   /locus_tag="Pcal_0349"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.748 at
FT                   residue 17"
FT   gene            335940..336866
FT                   /locus_tag="Pcal_0350"
FT   CDS_pept        335940..336866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0350"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   pai:PAE2915 dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07785"
FT                   /db_xref="GOA:A3MT18"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT18"
FT                   /protein_id="ABO07785.1"
FT                   /translation="MDVLSPMKLEGVVAATVTPFSKDGVNFEALRALLAKVAADGYHLF
FT                   PTSSTGEVTKLTVEERVKVMEVAKEVAGGSVYVVAGTGTGDHVSTIDIIRRYRDVGVDF
FT                   VLITPPYYIQYDWAAIYAFYKKVLDKVDVPVILYTIPLAVGYNIPVEVFELVANEYSQV
FT                   VAVKDSSGDFRYHLDLIHLLGKRLSILQGLDLLFVPSLVMGAHGGILAGPNFLGKLTLR
FT                   QYQLVKEGKVAEAVELHNRLMPLWRFMGGCGLVGKLGGKWPTLYKVAAEMVHGIDMGPP
FT                   REPLPPIDDKDRKELERLLRELGLVKP"
FT   gene            336866..337516
FT                   /locus_tag="Pcal_0351"
FT   CDS_pept        336866..337516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0351"
FT                   /product="Protein of unknown function DUF207"
FT                   /note="PFAM: Protein of unknown function DUF207; KEGG:
FT                   pai:PAE2913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07786"
FT                   /db_xref="GOA:A3MT19"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="InterPro:IPR022908"
FT                   /db_xref="InterPro:IPR036602"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT19"
FT                   /protein_id="ABO07786.1"
FT                   /translation="MPVVDAAAFEARKRAFVERLEREALQGRVDEDILPLLRLLNTHPR
FT                   IYTTSSCSGRIMVAEAVRPSFSKGRGFRPVAKWHHPVPPDLVREVVSNVEYAWLMVRGA
FT                   ILHVAAADAKTAYKLVEIGRETGHKHSGIIAMNRAGIFVEILGEERLDIPIKRGSPIAD
FT                   IDAAMDLANKTLILAKLRLYWLAARLEAELFGVEAPTSEEIRRAIRRVAQCLG"
FT   gene            complement(337513..338361)
FT                   /locus_tag="Pcal_0352"
FT   CDS_pept        complement(337513..338361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07787"
FT                   /db_xref="GOA:A3MT20"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT20"
FT                   /protein_id="ABO07787.1"
FT                   /translation="MTSIFNYIATIALAIVVAAGAALVYVLYTHFTQPPTTTTTTPSAT
FT                   TAPPTTQTTTPPPPTQPPATTTTPSPSQRSTVKSVVLYIATPNVTKCGGLGNKYIYYFN
FT                   VTVERVRVEDPVSFYVFKARAGNATLNLTSASYLPLNGKFFKPYSINMTQLGLVNVYLE
FT                   AMADKSLDITAVEYLGDEYPINRAVYVSCVKGLKVINATSRQQLAVTTLSPGALGLIPA
FT                   DAAYRVNVTLPPGRYQLIAPPDIRIEPAVVEGGKPQTLTITLLNKPQVYDPLVINATRV
FT                   G"
FT   sig_peptide     complement(338287..338361)
FT                   /locus_tag="Pcal_0352"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.656 at
FT                   residue 25"
FT   gene            complement(338358..339152)
FT                   /locus_tag="Pcal_0353"
FT   CDS_pept        complement(338358..339152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0353"
FT                   /product="5'-nucleotidase / 3'-nucleotidase /
FT                   exopolyphosphatase"
FT                   /EC_number="3.1.3.5"
FT                   /EC_number="3.1.3.6"
FT                   /EC_number="3.6.1.11"
FT                   /note="KEGG: pai:PAE2908 acid phosphatase; TIGRFAM:
FT                   stationary-phase survival protein SurE; PFAM: Survival
FT                   protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07788"
FT                   /db_xref="GOA:A3MT21"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT21"
FT                   /protein_id="ABO07788.1"
FT                   /translation="MRILVTNDDGVYSPGLRLLYQFAEPLGEVDAVAPETPKSASGLGI
FT                   TLHKPLRMYEMDICGFKVVATSGTPSDTVYLALYGLGRKYDLVLSGINLGDNTSLQVVL
FT                   SSGTLGAAFQAALLGIPAVAYSLYAESWDEVDGEALHVLRAVVQATARYVAERGMPQGV
FT                   DVISVNFPQRPRRGVRAKLAKPAKLRYAQRVEARRDPRGAAYFWLYGEPLSPEPETDVY
FT                   VVLKEGNVAVTPLALNLDALGDGQRARKEELEAFVDYVNANL"
FT   gene            complement(339228..339548)
FT                   /locus_tag="Pcal_0354"
FT   CDS_pept        complement(339228..339548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0354"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: pai:PAE2907
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07789"
FT                   /db_xref="GOA:A3MT22"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MT22"
FT                   /protein_id="ABO07789.1"
FT                   /translation="MSLASRRKVRIRLYGTNPADLDQVAREIVDLAKKMGVAVRGPIPL
FT                   PTKRLMVTVRRAPSGQGYHTFDHWELRISKRLIDIEASERVLRRLMTIRVPDTVKIELQ
FT                   LI"
FT   gene            339604..340758
FT                   /locus_tag="Pcal_0355"
FT   CDS_pept        339604..340758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0355"
FT                   /product="peptide chain release factor subunit 1 (aeRF-1)"
FT                   /note="PFAM: eRF1 domain 1; eRF1 domain 2 protein; eRF1
FT                   domain 3 protein; KEGG: pai:PAE2906 peptide chain release
FT                   factor aRF subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07790"
FT                   /db_xref="GOA:A3MT23"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT23"
FT                   /protein_id="ABO07790.1"
FT                   /translation="MAFARPPNGVYHLKTPVELRAFINVLKKFRGYATTLITLYINSER
FT                   PMPDVLNLLRSEWSTASNIKDKTTRTHVQDTLERIINNLKGEAKAPENGMAVFAGFHMI
FT                   SQGNYEWVYYVVVPPQPINTFKYICDTVFHTELLEDQLHSGVVYGVIVIERGEAVIALL
FT                   KNSRWEVVKTVEFFVPGKHHAGGQSANRFKRQTEHLAETFYKLVAEEANRVFLQIPTLK
FT                   GIIVAGPGPTKEDFLEEGGLDYRLKDKVLAVVPACCANEYGVMEAIKNAQEQLKESEYV
FT                   KAKETMERVMFYAVKKSDYIVYGKEKVMKALETGLAEVVIVAEELGEDVVLEVIMKAEE
FT                   KGVKVEVVPKGVEESATLVKAFGGFVALLNAPSWLLEQQQTAQA"
FT   gene            complement(340834..342936)
FT                   /locus_tag="Pcal_0356"
FT   CDS_pept        complement(340834..342936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0356"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: pai:PAE2905 purine
FT                   NTPase, probable"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07791"
FT                   /db_xref="GOA:A3MT24"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT24"
FT                   /protein_id="ABO07791.1"
FT                   /translation="MIKRLEVVNFKAHARAVFKFGEGVNFVYGPNGSGKTSLMEAVAVA
FT                   LFGSQWVRKVGGKWADFLRRGSPHGEVKLTLVVGGREVVVERRFGESGGLGAYLSVDGS
FT                   VEARGDTEVTDYVKSRLGLSVDEFRNLLYIRQGELRRILQEPEYIDRVLKLDEFDKVDE
FT                   VVKDIFNEFRARRERVGGRAEELERRVKDAERRIEELKARLAEAEARVKELEPLAARFR
FT                   DAERRYFEARERAAALAKEREALEKRLADLARAVAEVERDLEEVERGLAEVEQAKAELA
FT                   SLPQVGDVEKEYYELRQAVAVAEKVPEEVRTYDPRVLEELRRRYEELTKRQAELKSRLE
FT                   LLRDALRLAQRAEGGRCPVCGSPLTREAVQRHELEVAGLEAEVQRLAKALEQVRTEMKR
FT                   AEELEKAYHLYKPYLSLDLREARRRLGELEAQYRLKREVEARRSYLAAVMAKEEALVKR
FT                   LEELRRRREELGREAVEASARLAEVEEALPKAAAEAEEAEKAYRELRAAYVEYLKAHSR
FT                   AEELRRELEKAERELAGAAAELEKARAELEKLDKALAAAKNIRAVLGEVKPLARQILLK
FT                   AINEELNAVFLRLRHKEAFKSVQLVEAGGRYAVRIHTPNGHIEHSLLSLGEQNLLALSL
FT                   RVALARALIGTAPFMMLDEPTEHLDEEHRRRIVELVRDLTSVVPTVIVTSHLGEFEEVA
FT                   DVVIQL"
FT   gene            complement(342929..344086)
FT                   /locus_tag="Pcal_0357"
FT   CDS_pept        complement(342929..344086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0357"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pai:PAE2904
FT                   exonuclease SbcD, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07792"
FT                   /db_xref="GOA:A3MT25"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT25"
FT                   /protein_id="ABO07792.1"
FT                   /translation="MKVLHISDAHLGRAQYHLPEREEDYFEAFREAIRLGKSADAVLVT
FT                   GDLFDLKRPSTKTLVKFVEVVEQVEVPILLIGGNHDFSYTRFRAEAGRCVAPKECLYDT
FT                   ALRLIDKLGLARLLCWEAADLGGVTVFGACATPREYAQEYRQLLQRAPPRSILAIHQAI
FT                   EGVKARYPVEEDDFSMPPAVFQGLSFLHIAAGHVHDHLASHPVGALWAGSLELWDAGEF
FT                   ETWDYGGSFEKTQDAAAKGAVLIDAAGRAVTTRPLPIRPRRPMYRVRLYFRDSKELEAA
FT                   VEEAVKMFDRPGAVVRLELYGEAEARPRQIAARFSKALHVDVVDRTSRGIQRAVAPRGA
FT                   AFEEIWRLMRERLGPHAEAVLRAMELVREGEREAAYRLLLKAIYD"
FT   gene            complement(344083..345900)
FT                   /locus_tag="Pcal_0358"
FT   CDS_pept        complement(344083..345900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0358"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   pai:PAE2903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07793"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT26"
FT                   /protein_id="ABO07793.1"
FT                   /translation="MKIGYVVAAATPFEYLATLDPERPVSLYDYVVVDHVEVEGGELAN
FT                   VRLLGQIIRLYRDPYSAKRDLPLYSVISEVSNNILEVHLAKVKVLGYLSGGELRQPKQP
FT                   PRIGAAVYLADDEEIAELFRVKSGLCVGRLATRDVEICLDLEGVKRHIAVIAATGSGKT
FT                   WFSVVLIEELLKKGAKIVVIDPHGEYVPIRDSIYKLGPFSARVVKVSKHHQGDLMYKIG
FT                   VLDSEPDALANAAGVPPGAKKIRYAIYLAWAYARRVRKELGKAVGLAFMQKVLYTALRG
FT                   EAALNKLFQQLKLSGDFPTEDLKMLAKRDRHAIFSALTYLKKLKRLGVFAPRSTPLSKI
FT                   LADITIVNLAGVNEEVQDYVVSHLVNRIFQARVRQVRELKGVKIPWPVVLVVEEAHRFA
FT                   PPKALRKTKSYEAISRVASEGRKFGVYLVVITQRPSKVDPDVVSQCQSQVIMRIVNPKD
FT                   QEAVRESSELLAQDMLENLPGLDVGEAVVLGPVAKLPVVIKVRDRVLEYGGADIELSTA
FT                   WRVDKTADVVQMWRRLYKSPPPPSVAVAAAAMRVLAKRRVGDRVEVEVSDGDKRAVVTF
FT                   EDGVPVCSLCGRAGCPHVYKALEEAVEVL"
FT   gene            complement(345897..347252)
FT                   /locus_tag="Pcal_0359"
FT   CDS_pept        complement(345897..347252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07794"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT27"
FT                   /protein_id="ABO07794.1"
FT                   /translation="MVYPLYFCFYRTYIRPLDKICVDQFFDLFVVEARRKLAEYVGRRP
FT                   QYDYPVEALGDRILHKRIDGGTVADLRVAGVDGGVGVVRLSNGHQVIIARAAAVGPDFI
FT                   EREVKVDVAVVDSPSLAWAYLTIVESLVAIKALERRGVDVLLMDGSLYAKAMRLVHNLI
FT                   LTREFQNLYYVPEFVAALYALSRLIHRARELGARLVFVSKDHSFKLLKEHAVFEKLSER
FT                   SREYVFQKGLSWYSVLWIRRFRKELVELYKRARRYDYEGARLLALLIAQSVTDSDLLAR
FT                   VLPPGHYTVPMLVGGCDAYINYKGLATVDKLVKAAEERLQDSLIFRLRESFDSDVVGRV
FT                   KEALDALPKVYFFYVRLGRDDQPLLVDMPADGTRMFDGAAVKAFYPAAAVDDVAALLAQ
FT                   QYRDPVHYNTWLWYAHSIASMRAGQLSEYAVYIKSFAENVATARRVKLAWGI"
FT   gene            347317..348423
FT                   /locus_tag="Pcal_0360"
FT   CDS_pept        347317..348423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0360"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG: pai:PAE2901
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07795"
FT                   /db_xref="GOA:A3MT28"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT28"
FT                   /protein_id="ABO07795.1"
FT                   /translation="MEELAAKVANVRKTLNSLFYKFSDEINGSLTAVLVRENFILVGPP
FT                   GTAKTMLVASIAKLLKAKWFYRLLTKFTEIEEVIGPIDVVELLKGNVKRIYANSIVEAD
FT                   FALLDEIFNASSAILNTMLTILNERVIYDGGSIIPVKTWTVFGATNRVPDEEELQALYD
FT                   RFPLRVFTKYAQPEETEELMKTGLRLKREFDKLAPIMSMDEVKKVNEYLQNYVYENMDA
FT                   LVKHVAPIVASYLDHVVISNRTRVKVPLYVVSYLTVMGLRPSDLDAATIRAGTLKVLKY
FT                   LVKDKEDIAEYESFIATHLPGGLSVLYDLVNEIKALVANNALSIAREKLREAYEILEKS
FT                   VADPVTYRFFQAEIDEVKSTLDMLKSQL"
FT   gene            348427..349716
FT                   /locus_tag="Pcal_0361"
FT   CDS_pept        348427..349716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07796"
FT                   /db_xref="GOA:A3MT29"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR040322"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT29"
FT                   /protein_id="ABO07796.1"
FT                   /translation="MGSLINVDYSDELTRMRVHEIVKYFQRLGIPIKLSKIPNDAIADS
FT                   FYVHYRTPILKEKAERGEELWHFFLRSYISADVYQDVAKISRYNYQVSKSASVKLLRAF
FT                   NSLLSRVERGAIEGVDEKSDYRELSQNQQLRQEINSLLRFYLGNIKNIENLRKSLAKAL
FT                   GDEVGKEAAELLFDIDIDPYRARLAKILEALVQLVSEAGIEMELGPLAERRGVISGVTR
FT                   LRSFSDLQRATNLSKAIYLQSRELFGYKLATRSLSIYDVSVDVREKIYLLVDKSGSMFY
FT                   TLYDGFAMDMTQKITWATALAVALMKRSRRVVMRFFDQIVYPPITNTREVIKALLKVLP
FT                   LGGTDISAALYTAVRDAKAYGLHSYKLVLVTDGEDDMINPEAIRAAKAAFREVKAILVG
FT                   GSNEVIEAHLPAIKINMANPESLREVLKNI"
FT   gene            349740..350159
FT                   /locus_tag="Pcal_0362"
FT   CDS_pept        349740..350159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0362"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   pai:PAE2898 conserved protein with 2 CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07797"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT30"
FT                   /protein_id="ABO07797.1"
FT                   /translation="MYCGDLASRPPVTITSDATLYEAAEKMAQHKVGLLVVVDKANPKK
FT                   PIGVVSERDVIRAIAAKMPLDTTVDKVGTMHNFVFVYADDPITTAARKMKERNVRHVVV
FT                   LDKNGELYGVISIRDLIKERAVLEILARDRAPTKE"
FT   gene            350190..351419
FT                   /locus_tag="Pcal_0363"
FT   CDS_pept        350190..351419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2897 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07798"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT31"
FT                   /protein_id="ABO07798.1"
FT                   /translation="MQKIVIGIALAIVAAIVAAALILTQTPPKSPTQPSTGQGGKVYVY
FT                   SVEITGGPSIVAYYIPTDAGLIYGEKVNLTSYYFMFKNGVINILANTPQGIQKVTYYER
FT                   LLEVCRNSTTIATVAGERITLSNSQCSPSTSPLPTVKSLDELILVVQGLPGPTSQSQWV
FT                   KSGVAQTPFGQATVYTNITQVPIMTGLNAVLNYEKQVLPDGTIYLLKAQLAYGNQVAAT
FT                   LTYTLRNITAMAPELKAIVDELSKDVVAKNGGGLDLLKVAEKIGMTFDGSWPAAIVFFD
FT                   LQCPYCAQLFKYNYTLFQGHKLVLVDLVVHPEALESHQRLRCLYQTAPDQVIPTLRVLY
FT                   DRFLARDANYTDVLPNQTCQIDVQAGMQLAQLLAGQNVGTPMVVVVYPNGTYALTVGYD
FT                   PASIAKALRG"
FT   sig_peptide     350190..350249
FT                   /locus_tag="Pcal_0363"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.469 at
FT                   residue 20"
FT   gene            complement(351416..352177)
FT                   /locus_tag="Pcal_0364"
FT   CDS_pept        complement(351416..352177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0364"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pai:PAE2893
FT                   spermidine/putrescine transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07799"
FT                   /db_xref="GOA:A3MT32"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT32"
FT                   /protein_id="ABO07799.1"
FT                   /translation="MRALRLYAWVLIAALYAPVAVILALSFNASKLPYVWGGFTLKWYE
FT                   SLFAWREAWTALLNSVVIALGVAAASVLLGVFMAYTLRGGGYIVLSQGAIVMPEVSEAL
FT                   AFAAALFVVKQATGIDLYGPLGVFLAHLAFALPMAHVMLAPYVAYVSRSVVEAARTLGA
FT                   SEARTAFSVVMPILAPALVAVFLIVFANSFDTYIKTAFTTSPDFITAPILLWNYAARGR
FT                   GDPTMYALTAFMLIPSLLAAVIYFRAIKRYG"
FT   sig_peptide     complement(352082..352177)
FT                   /locus_tag="Pcal_0364"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.746) with cleavage site probability 0.463 at
FT                   residue 32"
FT   gene            complement(352174..352905)
FT                   /locus_tag="Pcal_0365"
FT   CDS_pept        complement(352174..352905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0365"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pai:PAE2891
FT                   spermidine/putrescine transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07800"
FT                   /db_xref="GOA:A3MT33"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT33"
FT                   /protein_id="ABO07800.1"
FT                   /translation="MIKEVALAGLAAVVFLFYLPFLALGYYAVGGGELKTPPLSMLTTT
FT                   FLLAAATAVVSIALAYPAAYYLAKRGTELEFALLVAPLWIGTLLKAYSLLTLFAIVEKF
FT                   TGLRLWGSPLGVLVGMVYEYLPYSLLTIYAAVEKLSETPVNAARVLGASRLQAFLRVEL
FT                   PLTMPGVVAAFVLVFLLALGEVIMPAVLGAGKVYTFGSYIWDLYFKSRDFYNGSILSLA
FT                   LSGLSLLATYVVVKAIRPFSI"
FT   sig_peptide     complement(352828..352905)
FT                   /locus_tag="Pcal_0365"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.950) with cleavage site probability 0.557 at
FT                   residue 26"
FT   gene            complement(352902..353885)
FT                   /locus_tag="Pcal_0366"
FT   CDS_pept        complement(352902..353885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0366"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: pai:PAE2890
FT                   spermidine/putrescine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07801"
FT                   /db_xref="GOA:A3MT34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT34"
FT                   /protein_id="ABO07801.1"
FT                   /translation="MGLSVELRDVSVKYGSFSALKNINLYVEAGEGLVVLGPSGSGKST
FT                   LLRAVAGLVPLAGGRVYIGGVDVTDKPPEKRKISMLFQDLALFPHLNVFENVAFGLRVR
FT                   GVPQEEVKRRVMWALELVHLDPHVFMERRVSQLSGGQQQRVALARALVVEPELLLLDEP
FT                   FSHVDLDVKNKLLEELKILHNKLGFTLIYVTHDRFEAVEIGDRVALMKDGEVVQVGRPV
FT                   ELYKRPRNKFVAEFFGEANIVPARLLGIAKEGYAVIRPEDVVLGGGTYRLKGQVVDVTF
FT                   LWHYQKVEIQADGYVFKAYVDLDAPVSVGETVEFGWDAKDVYLLEE"
FT   gene            353933..354508
FT                   /locus_tag="Pcal_0367"
FT   CDS_pept        353933..354508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0367"
FT                   /product="Protein of unknown function DUF998"
FT                   /note="PFAM: Protein of unknown function DUF998; KEGG:
FT                   pai:PAE2889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07802"
FT                   /db_xref="GOA:A3MT35"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT35"
FT                   /protein_id="ABO07802.1"
FT                   /translation="MTLGRILLALGSLQFIVAMLVAEQLYPGYNPLHNYISDLGALKAP
FT                   TAPLFNTSVILLGVLGLLAVFLLRRELGRAGASLLGLASLGAMGVGFFPEDYGLPHSIS
FT                   ALIAFLFGALAVIVIGLRRGGIFKPLGITLGAISLIALALFIPRVSTPLGIGGIERLVA
FT                   YPVLIFLAIYGLSGKTTGKSSSGNTQRA"
FT   sig_peptide     353933..354001
FT                   /locus_tag="Pcal_0367"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.849) with cleavage site probability 0.800 at
FT                   residue 23"
FT   gene            complement(354735..356024)
FT                   /locus_tag="Pcal_0368"
FT   CDS_pept        complement(354735..356024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0368"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="PFAM: fumarate lyase; KEGG: pai:PAE2887
FT                   argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07803"
FT                   /db_xref="GOA:A3MT36"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MT36"
FT                   /protein_id="ABO07803.1"
FT                   /translation="MAFYRSWIGGGGDLVRRYTSSMADDVEIAEEVVKILKTHVAHLAE
FT                   VGVIPREAAERIAKALDEVDYDALAKGGFEDIHEAVEKWVIDRVGEEAGGWLGLGRSRN
FT                   DHVAAAIRLAALRKLAELKRGLAALRCALAKRALQYADCAMPSFTHFQPAQAITFGHYL
FT                   LSIDELVEEFSRALAGVEPLLKRSPLGAGPAGGVKTPIDRRRLAKALGFEDVVGNALYA
FT                   SGSRFFASAAASIVVSFLVELSRYVDDFIRWNSPAIGYVKAPDSHVSTSSIMPHKRNLV
FT                   TLEVLRARISEAVGHLTALYAVQAKIGAGYSLDLQEATRHLWAILKIAGEGVEVLRDFV
FT                   EGLEFNCEKARLDAETYYATSSDTAEAIALSGVPFRRAYFQLAEEIKRGSAKLLSPEEA
FT                   VKRPTEGSANPEEVRRAASARLIFCKTPAF"
FT   gene            complement(356038..356196)
FT                   /locus_tag="Pcal_0369"
FT   CDS_pept        complement(356038..356196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07804"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT37"
FT                   /protein_id="ABO07804.1"
FT                   /translation="MGQKTVVCPTCKKPVKPVECGRKAQSKRYVLVTYCCPRCKTELLT
FT                   ERLEVQI"
FT   gene            complement(356245..357273)
FT                   /locus_tag="Pcal_0370"
FT   CDS_pept        complement(356245..357273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0370"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG: pai:PAE2884
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07805"
FT                   /db_xref="GOA:A3MT38"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT38"
FT                   /protein_id="ABO07805.1"
FT                   /translation="MQHFYVDAKREFAEQYISRAILMNGMYEGQYPLGTALARPLIAEK
FT                   VVEVARRVGADAVAHGSTSKGNDQVRFDVTVKALTPDLKIVAPARIWGMTRAEEVEYAR
FT                   RHGLPIGEEHKKYSIDDNLWSRSIEGGPLDDPREEPPEDAFKWTVAPEKAPNEPAYLTL
FT                   EFEKGLPVAVNGEKMPLDKLVAELNHLAGAHGVGRIDHIENRLVGFKSREVYEAPAAVV
FT                   LYHAHVDLEKLVLTPRELRFKHHVLDPQWADLVYQGLFVEPLREALEAAAEAMEKWVTG
FT                   EVRVKLYKGSVQVVGRWSPHGGYSKELADYSRGWYPTDEEARGFIEMWSLHSLTARRRR
FT                   GI"
FT   gene            complement(357442..357627)
FT                   /locus_tag="Pcal_0371"
FT   CDS_pept        complement(357442..357627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0371"
FT                   /product="putative lysine biosynthesis protein"
FT                   /note="KEGG: pai:PAE2883 putative lysine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07806"
FT                   /db_xref="InterPro:IPR005906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT39"
FT                   /protein_id="ABO07806.1"
FT                   /translation="MAKQKLVVTCQVCGTEFELPDDVMDGEIVSCPTCGARYIARIKGG
FT                   SVKLEEFKGDVEDYGE"
FT   gene            complement(357697..358482)
FT                   /locus_tag="Pcal_0372"
FT   CDS_pept        complement(357697..358482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0372"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: pai:PAE2882
FT                   acetylglutamate kinase / acetylaminoadipate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07807"
FT                   /db_xref="GOA:A3MT40"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037529"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MT40"
FT                   /protein_id="ABO07807.1"
FT                   /translation="MIVVKVGGSVICKDLSKVVENLPKYAGEAVVVHGGGCLVNELLKR
FT                   MGIEPKFLTHPGGVVSRYTDLETLKVFVMAMSWINKQLVASLFARGVEAVGLTGADGGV
FT                   VRARRKEKVLVVDERGRQRVVDGGYVGKIVDVNVKALAPPPLKVLAPIAVSEKGELLNV
FT                   DGDQLAFEVAARAGAGRLVILSDVDGLILGGRVVPRLTPEEAEELAKSEEVRGGMKRKL
FT                   LMAAEAARRGVEVVISNGLADSPIDAALGGAGTHISRNI"
FT   gene            complement(358479..359534)
FT                   /locus_tag="Pcal_0373"
FT   CDS_pept        complement(358479..359534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0373"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: pai:PAE2881 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase / N-acetyl-gamma-aminoadipyl-phosphate reductase;
FT                   TIGRFAM: N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase, NAD - binding; Semialdehyde
FT                   dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07808"
FT                   /db_xref="GOA:A3MT41"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MT41"
FT                   /protein_id="ABO07808.1"
FT                   /translation="MKRVCIVGASGFTGGELLRILLQHSGVEVVCATSRKFKGEYVYRV
FT                   HPNLRGFTQLKFVEPTIDAALKADVVFLALPHGESVKWVPQLYESGVAVFDLSADFRLK
FT                   DPNAYVEWYKWPQPHPYPDLLAKAVYGQPELHREELVGARLVAVPGCMATASILMLAPL
FT                   AKFGLISAPPVVDAKIGSSGAGAEGSVVDLHSFRTYVVRPYEPVHHRHIAEIEQELSRL
FT                   AGKEVKVAFTPHAVDIVRGIFTTGHVFVEKMPTEADLWKYYRALFGDSKFIRIVKDRLG
FT                   ISRYPNVKYVLGSNLVDLGFELDARMKRVVTFAAIDNLVRGAAGQAVQAFNIAMGFPED
FT                   EGLRHIPVAPI"
FT   gene            complement(359531..360031)
FT                   /locus_tag="Pcal_0374"
FT   CDS_pept        complement(359531..360031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07809"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT42"
FT                   /protein_id="ABO07809.1"
FT                   /translation="MRNPYTAVAYGELAERSINPPAAIASALNRLSWLPKFGPPHAVVS
FT                   SDFAVEKVEVEKPWLLMTAWRLDIDGVVTSVEGAKSVLEHRLYMRNPLARVSVVVPKPQ
FT                   RTYTVFATAKAGEGVAKEVLKHLGLLYAKITLGEYGREVYVLDVDPIPPLDKGEAALVA
FT                   ELV"
FT   gene            360378..361421
FT                   /locus_tag="Pcal_0375"
FT   CDS_pept        360378..361421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0375"
FT                   /product="L-threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   KEGG: pai:PAE2878 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07810"
FT                   /db_xref="GOA:A3MT43"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT43"
FT                   /protein_id="ABO07810.1"
FT                   /translation="MEVVVGEKYWAPKGRGVWRYASMLPVKNGVTMGEGQTPLVPSTLK
FT                   PNLYVKYDGANPTGSFKDRGMALGVTVAKLSGANKVVVASTGNTAASAAAYAARAGLKC
FT                   YVVLPRGNVARGKLMQAALHGAELVMLNGLFDKALEYVVNYGTKYAYPLNSFNPWRLEG
FT                   QKTAAFEIYEEVGCPDYVVVPVGNAGNISAIWKGFKELWELGLCKKLPKMVGVQAEGAA
FT                   PIANAWAMGKRAPIFLDEPHTVATAIKIGKPINWPKAVAAVEESGGLFVTVSDEEILRA
FT                   QRLLASRDGLGAEPAGAASVAAALKLDLSGTVVAVVTGHALKDPDVVEISAREVRNADE
FT                   LVELLEK"
FT   gene            361418..362308
FT                   /locus_tag="Pcal_0376"
FT   CDS_pept        361418..362308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0376"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="PFAM: GHMP kinase; GHMP kinase, C terminal domain
FT                   protein; KEGG: pai:PAE0034 homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07811"
FT                   /db_xref="GOA:A3MT44"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MT44"
FT                   /protein_id="ABO07811.1"
FT                   /translation="MRAPSTSANLGAGFDVVAVAHDAYFAEAYVAVEQGCGVAVKFKGY
FT                   DPGENNTVSLAFRHLFNMLGICRQVEVVVDNRIPLARGLGSSGASAVAALAAFIREAGL
FT                   KAEPKLVVEAAGLGEVAAAGSPHFDNVAGAALGGAVVVVSTSPLEVVKFSPKLLFVVGV
FT                   PDVPPIPEKTRLMRSVLPREVPFKTYVAQLARVSALVAGFATSNPRLVALGMSDDVVEP
FT                   ARAPYVHGYARARRYALEAGALGFAISGAGPSVVALVDDKHSDAVRAALARAYAEEGLR
FT                   AEVKVAQVAEGALGV"
FT   gene            362305..363297
FT                   /locus_tag="Pcal_0377"
FT   CDS_pept        362305..363297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0377"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   pai:PAE2877 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07812"
FT                   /db_xref="GOA:A3MT45"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT45"
FT                   /protein_id="ABO07812.1"
FT                   /translation="MRPVVKIGGSLLRSADDFIRAAKFLASYERPPIAVVSAVKGVTDM
FT                   LLELYKTRSYLMFEEVAHRHISIARALGVEDEVAPLLRELEAALQLPKEPWAVDYFASF
FT                   GERLSATILASVARRMGIAAKLYIAPIVTDSSFGNATPIRLDYADELREGDVLAVVTGF
FT                   IGRDREGRFTTVGRGGSDYTATYIGKEIGARKVFLITDAPGVMTADPREVEEAEVLPLM
FT                   SIYEAVAAAQAGAKNFHPRTFQPVLEAGNMAVEVRSYHSRGTLIGHIYPPPPYKVVTRC
FT                   GQGSCVVGLAAEELTKLGGVSLGRYTCRLDIPPRQAHELLVKPYIKYIK"
FT   gene            363314..364336
FT                   /locus_tag="Pcal_0378"
FT   CDS_pept        363314..364336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0378"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: pai:PAE2876 aspartate-semialdehyde
FT                   dehydrogenase (asd); TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase, NAD -
FT                   binding; Semialdehyde dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07813"
FT                   /db_xref="GOA:A3MT46"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT46"
FT                   /protein_id="ABO07813.1"
FT                   /translation="MDRLKVYIIGATGLVGQRYVQLLADHPWFEVVGLAASEKSAGKRL
FT                   AEAGWVLDEAPPPSLADMKIEKLDVDKVPKVDFVFSALPSEVAAKVEPALAARGHVVLS
FT                   NSSNMRMDPDVPLIVPEINPEDLKLVEEQRRTRGWSGAVVKKPNCTTTILNLPLKPILD
FT                   EWGIRAVHVVTMQALSGAGYAGVPSVAILDNLIPHIRGEEEKVVAETRKILKRDFEIYA
FT                   TTTRVPVLDGHTEVVYVDTERDFDETAVAEALAKFKGLPQELGLPTAPQRPIVVRSQAD
FT                   RPQPRLDRWEGRGMSVVVGRVRRLAPRKLAFVVLGHNTVRGAAGNSVLTAELMAKLGVR
FT                   "
FT   gene            364333..365259
FT                   /locus_tag="Pcal_0379"
FT   CDS_pept        364333..365259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0379"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase, NAD-binding; KEGG: pai:PAE2868 homoserine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07814"
FT                   /db_xref="GOA:A3MT47"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT47"
FT                   /protein_id="ABO07814.1"
FT                   /translation="MILLFGFGGVGRTLAQQIYQRTRLKIVAVFDSSGGVYKRGGFTSE
FT                   EVEKLVSLPRGSLVKAPVGEKVDIDHALDEAEIVVDVSPPNYETGEPAYTLYKKALQKG
FT                   KAVVTANKAPLALHFDELRDGVYYKATVMAGTPLVDLLKGLEPQRVESFMGILNGSTNY
FT                   ILTRVYKDGVSFEAALGEARTKGILEPDPRLDLEGVDAAAKLVIVANTLGVSLKLGQVA
FT                   REPLTPMGPVTKYVAYLDVGAQRGEVKPVRLDPAHPLANVDYTLNAAYIKTEVNDIYLV
FT                   GKGAGRLETSLALLNDILSFYKTLRGK"
FT   gene            365502..367508
FT                   /locus_tag="Pcal_0380"
FT   CDS_pept        365502..367508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0380"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="TIGRFAM: acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: pai:PAE2867 acetyl-coenzyme A
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07815"
FT                   /db_xref="GOA:A3MT48"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT48"
FT                   /protein_id="ABO07815.1"
FT                   /translation="MQTIQKETELPFEEYIMNNKWQGRSIDVKSYWQFHAKSLENFEEF
FT                   WASVAKELEWFKPWDKVLDASNPPFYKWFVGGRLNLSYLAVDRHVKTWRKNKLAIEWEG
FT                   EPVDDAGYPTDRRKLTYYDLFREVNRVACMLKCNFGIKKGDRITLYLPMIPELPITMLA
FT                   AWRIGAITNVVFSGFSADALAERINDSQSRIVITADGFWRRGKVVRLKEVVDQALEKAS
FT                   GVEHVIVYPRLGLKDTPMTEGRDYLWTKVMQGIKPNVYIEPEPVESEHPSFILYTSGTT
FT                   GKPKGIVHDTGGWAVHVYATMKWVFDIRDDDVYWCTADIGWVTGHSYVVLGPLLMGATN
FT                   IIYEGAPDYPQPDRWWSIIERYGVTIFYTSPTAIRMFMRYGEEWPRRHDLSTLRIIHSV
FT                   GEPINPEAWRWAYRVLGGEKVAFGSTWWMTETGGIVISHAPGLYLVPMKPGTNGPPLPG
FT                   FEVDVVDDSGKPVPPGVRGYLVIKRPWPGMLHGIWGDPERYIKTYWSRFPGMFYAGDYA
FT                   IKDQDGYIWVLGRADEVIKVAGHRLGTYELESTLVGHKAVAEAAVVGVPDPVKGEVPIA
FT                   FVVLKQGVAPSEELRKELREHVRKTIGPIAEPAQIFFVTKLPKTRSGKIMRRLLKAVAT
FT                   GAPLGDVTTLEDETSVEEAKKAYQELRAEVEKA"
FT   gene            367505..369571
FT                   /locus_tag="Pcal_0381"
FT   CDS_pept        367505..369571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0381"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; General
FT                   substrate transporter; major facilitator superfamily MFS_1;
FT                   KEGG: pai:PAE2866 sugar transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07816"
FT                   /db_xref="GOA:A3MT49"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT49"
FT                   /protein_id="ABO07816.1"
FT                   /translation="MSVQVNFRQVASVAIVAWFGAFLEWLDFYTYALLAGLVAKIFFPS
FT                   ADPIASLLASFAALAIGFLFRPLGAIVFGKIGDQFGRKVAFITAMSLMLVGTLGIGLLP
FT                   GYAEIGILASVGVFILRIIQGLALGGGYGAAITYLGEFVPEHRRGFFTGFLFTTPAAGM
FT                   ATVGALIWLFSTMLGTQQYNAWGWRLNFIVAGVIVFIIVLAMHLFYKETPVFSMLRAVR
FT                   RVTSAPIREVFSRKYLPLVLLAWIGVVGAHGPIWYTNQLFNTYYVGPNFQKYVDSATAS
FT                   ALLSTATYAALWMYPLFGYISDKVGRKPILLLGIYGNALWFPIAFWLIDQVGPQKDLTA
FT                   LWLLFWSMTLFNGIGYSGAMSAFLLELFPARIRLSAVSLAYNLGYGVTGGLTPFVITWL
FT                   YSITKNVYLSTILWSTVVPMVMALWYALKGPETLGTRIWAEFAAEKFAKKTVTLPATTP
FT                   IREVVKAMVDTGVKYVVLTGSVVGIFGTRSLIRALAAGAKLDEPAGNYAVKTSCIDAKA
FT                   PVTEVFVALEQYNVRAVPVCEGGKPVGIVEARELVNEALGLRSVLKKKVALRFNVYDAA
FT                   PRELVTIAPDKSLKEAIDLMAKYNIGFLPVVEDGKLVGVLSETDIVKAVAKGVDLGRPV
FT                   AEFANKPIVVDKSATLRDAAELMVKYNIRHIPIVEDGKVVGVISVRDVLKAIG"
FT   gene            complement(369582..370418)
FT                   /locus_tag="Pcal_0382"
FT   CDS_pept        complement(369582..370418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0382"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="PFAM: GHMP kinase; KEGG: pai:PAE3407 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07817"
FT                   /db_xref="GOA:A3MT50"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT50"
FT                   /protein_id="ABO07817.1"
FT                   /translation="MRRRVKVLVPLHVTAMWLPVYTDNPLTTGSIGVGVLLKPGAVVEV
FT                   EAGSGGRGPIPHISAVLKRLGLSASVRFSAPVPLGAGYGLSAAYTLGAALGASALAGRP
FT                   LIEAAQTAHVVEVEMGTGLGDVIAEFYGGGIEVRVKPGAPGVGVVDKVPHPRRLAALTH
FT                   VFRREDTSSMLVRLRDALRERGAKLVEKFLEQPTYDSFLELSAEFSRVMGFLTPEVEGR
FT                   IRRCKKQMHGYYAKKGVLVVLLDVNEVEEVEECLMREGVEVKSFGLSHVGAVVLRE"
FT   gene            complement(370403..371245)
FT                   /locus_tag="Pcal_0383"
FT   CDS_pept        complement(370403..371245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0383"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: pai:PAE3409 2-dehydropantoate 2-reductase
FT                   (ketopantoate reductase); TIGRFAM: 2-dehydropantoate
FT                   2-reductase; PFAM: Ketopantoate reductase ApbA/PanE,
FT                   N-terminal domain protein; Ketopantoate reductase
FT                   ApbA/PanE, C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07818"
FT                   /db_xref="GOA:A3MT51"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT51"
FT                   /protein_id="ABO07818.1"
FT                   /translation="MKFGIIGLGAVGSLLAYFLNRAGYVPHVVTRSRRERYVLKWGGET
FT                   HVLQVAVVDELPPVDYTLVAVKAYDTEAVVDKIRGEPVVFQNGIGGLELLKERLGVGFG
FT                   AVVTYGVSRVEGVAEVRGVGEIVLPREAGEVADALRAGGARVRVVEDIEPARWLKLAIN
FT                   AAINPITALLRAKNGVVVENPYAKSLAAEAAREAGRVAEAVGVRLPADPVEETLRVAEA
FT                   TRDNVSSMLQDLSQCRRTEVDYINGAVVRLGERHGVEAPVNKALWALVKAAEAACGAV"
FT   gene            complement(371242..372009)
FT                   /locus_tag="Pcal_0384"
FT   CDS_pept        complement(371242..372009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0384"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="PFAM: Protein of unknown function DUF137; KEGG:
FT                   pai:PAE3406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07819"
FT                   /db_xref="GOA:A3MT52"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT52"
FT                   /protein_id="ABO07819.1"
FT                   /translation="MIPPNHPRRESLLVRERLVEGFREGYVVPQGLIAHGRGECFDYLL
FT                   GEATVEEAWEAERAAVAALLTAKRPVISVNGNVAALVPEGVVQLARATGAAVEVNLFYR
FT                   TREREELIAEVLRRHGAEEVLGVGDDASCTIPELFSERRRVSCRGIYVADVVFVPLEDG
FT                   DRTEALRKMGKFVIAVDLNPLSRTARAASITIVDNVVRAVPNMVKLAEELKALPREELE
FT                   AIVKRFNNDENLRRVLRRISQRLVELAERGVAL"
FT   gene            complement(372033..372392)
FT                   /locus_tag="Pcal_0385"
FT   CDS_pept        complement(372033..372392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0385"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: pai:PAE0045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07820"
FT                   /db_xref="GOA:A3MT53"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT53"
FT                   /protein_id="ABO07820.1"
FT                   /translation="MSSGIYRLKDLNKSLDVEELANFLSALREGALSIVVFGSAARGRY
FT                   VRGLSDVDVLVITAQEPERRALTRGLTFGDVNVIFMSREEYCRTVRAGNQIALETWERG
FT                   VVVYGAEPRELCHNN"
FT   gene            complement(372521..372697)
FT                   /locus_tag="Pcal_0386"
FT   CDS_pept        complement(372521..372697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07821"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT54"
FT                   /protein_id="ABO07821.1"
FT                   /translation="MYRAGRFAKACFLAQQAAEKALKALLIKRGGVYERTHSVVTLLER
FT                   AEAYVDVPAELLT"
FT   gene            complement(372732..373037)
FT                   /locus_tag="Pcal_0387"
FT   CDS_pept        complement(372732..373037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0387"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: pai:PAE2711a
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07822"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT55"
FT                   /protein_id="ABO07822.1"
FT                   /translation="MVFKSVKISGANCLSPMVLRKEIAEVPVGEVLEVITNDSCAREDI
FT                   RVWCKFTGNELVSVEEMGEGYPCPWQNRCPRTWTVKKALYLPPLIVRELGEVERLA"
FT   gene            complement(373092..373418)
FT                   /locus_tag="Pcal_0388"
FT   CDS_pept        complement(373092..373418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2626 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07823"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT56"
FT                   /protein_id="ABO07823.1"
FT                   /translation="MEYDLEVLKALGLDGEPLDESRWRDFEKIRLVAEELVPGQYLDFG
FT                   TVKIRYEGNGVVSFAKSWHAFNEAVKLADGESFLIYCTCPMVDRFVALRRAGDKLVLLY
FT                   KPRH"
FT   gene            complement(373465..373950)
FT                   /locus_tag="Pcal_0389"
FT   CDS_pept        complement(373465..373950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0389"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG:
FT                   pai:PAE2701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07824"
FT                   /db_xref="GOA:A3MT57"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="InterPro:IPR033921"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT57"
FT                   /protein_id="ABO07824.1"
FT                   /translation="MVEFLGNVDKNVIVKRLLSAYADEWIAAYYYTLTAYAVKGPLSEE
FT                   IAEHFLKEAEEEIGKHAKMIADRLQDFDVDPPREFAKLWEISGCKYPALPEDPYDIDAW
FT                   IMAAVKAEECAIEAYRELYRITHGVDPVTEELAEEILADEVRHRTSLKNLLSKARGT"
FT   gene            374003..374488
FT                   /locus_tag="Pcal_0390"
FT   CDS_pept        374003..374488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0390"
FT                   /product="PaREP1 domain containing protein"
FT                   /note="PFAM: PaREP1 domain containing protein; KEGG:
FT                   pai:PAE0973 paREP1"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07825"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT58"
FT                   /protein_id="ABO07825.1"
FT                   /translation="METLPKPWFDLAKYREVRLKEALYEAELAERFLEEGFVRNAAGKA
FT                   FQAWKTLVAAYAVDKVEELKNAFPGRKKPRGMRGRAESALWVLAIMPTTALKQVAQIVG
FT                   GDVDIYTDKALWIHEYQYDGPDPQAILSPYPDDEVAVRDIKRLVEKVRELAERQLRR"
FT   gene            375119..375580
FT                   /locus_tag="Pcal_0391"
FT   CDS_pept        375119..375580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07826"
FT                   /db_xref="GOA:A3MT59"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT59"
FT                   /protein_id="ABO07826.1"
FT                   /translation="MTRGRLVFDVAIFTAAMAALASALGVALFLESIPWPIRAYMIGSS
FT                   ALAVLIVLWFIPVKYSVEGGVVKLCSPIRCVRYEVEGIEGGEVYDPRRWKEWFLCGGFR
FT                   GFRLAWAKCANDHLYFATARCRDVWKKFQVRKGDERYTLWLCIDGRSSG"
FT   sig_peptide     375119..375184
FT                   /locus_tag="Pcal_0391"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.958) with cleavage site probability 0.342 at
FT                   residue 22"
FT   gene            complement(375648..375732)
FT                   /locus_tag="Pcal_R0006"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(375648..375732)
FT                   /locus_tag="Pcal_R0006"
FT                   /product="tRNA-Leu"
FT   gene            complement(375756..376445)
FT                   /locus_tag="Pcal_0392"
FT   CDS_pept        complement(375756..376445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0392"
FT                   /product="formate dehydrogenase delta subunit"
FT                   /note="KEGG: pai:PAE2664 formate dehydrogenase delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07827"
FT                   /db_xref="GOA:A3MT60"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT60"
FT                   /protein_id="ABO07827.1"
FT                   /translation="MWREVNGIKVAVDELYQVFVNGELVATAVASPQDLDELALGLLYA
FT                   DGYIDTVEEVSELRVEGRKIIARIRRRASPSFKAVEDCDVVKGGRREVRLVEARLDVEK
FT                   LRALVAEFGKFTMPTAEPSLAMHTSALLDEKGWLVVHDVSRHSSMLKLVGKALKEGRRG
FT                   PLVFTTGRASSDLVARGAAIGASIMVSIRGPLNSGVETACALGVTLVANVRGRGLTPLC
FT                   NPWRLKI"
FT   gene            complement(376420..377007)
FT                   /locus_tag="Pcal_0393"
FT   CDS_pept        complement(376420..377007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2659 formate dehydrogenase protein
FT                   fdhE"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07828"
FT                   /db_xref="GOA:A3MT61"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT61"
FT                   /protein_id="ABO07828.1"
FT                   /translation="MSKEVEIVCGGDSHCVEEVRRAVEEIRSLFSTPIPEPHLSSLSPP
FT                   LVDQVANMAEIVDAVGDEAAARLVVASRLAKRFAQRFAEWSGDRCPICGSAPRLFVVVP
FT                   RPGEIFESRERYAKCVCGFSWLHEGWWRCPNCGAEGRQNFDVYIREGLEGAVFYRCRRC
FT                   GFAYVEYQGLPREDLEYLLRIVVGHVAGGQRD"
FT   gene            complement(376991..377710)
FT                   /locus_tag="Pcal_0394"
FT   CDS_pept        complement(376991..377710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0394"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="KEGG: pai:PAE2660 formate dehydrogenase, cytochrome
FT                   b556 subunit (formate dehydrogenase gamma subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07829"
FT                   /db_xref="GOA:A3MT62"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT62"
FT                   /protein_id="ABO07829.1"
FT                   /translation="MSSVKYEEVEIASIGYKIAHSLNLVLFTLLAITGVLLLFPGLFNW
FT                   LAYAVGAPLAAAVGLPATSVGLELGRTSHRFLGMLWGLFLIVYGIYLVMFNRVRIFDAL
FT                   RKPISHQIREASALTKHYLLGKPLPEDVAKNLERHNVLVAYMTILLFIGVVLLSASGVL
FT                   MVYRDVLGLSLNDFRLLLLMHDLGFYLSLIFVLLHLFASLHPSNRPLLVAMFGYGKVSL
FT                   EWVQKHMPRFLSRVQRG"
FT   gene            complement(377741..378568)
FT                   /locus_tag="Pcal_0395"
FT   CDS_pept        complement(377741..378568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0395"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: pai:PAE2661 formate dehydrogenase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07830"
FT                   /db_xref="GOA:A3MT63"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT63"
FT                   /protein_id="ABO07830.1"
FT                   /translation="MSPATSRQGYAVLVDLDKCIGCRACQLACKDWNGLTATKTEFSPT
FT                   LAQPPSLTAQDWKVVFFYEGVVQKGLKTPAGEVVFSQVDIAPLPYNCLHCVDAPCARAC
FT                   PAGAIVTTPEGAVVINKDLCIGCGYCENACPFNVPKKGQDGKYYKCTFCVDRIQNGRAP
FT                   ACVEVCPTGVFTFGPIEEVTKAAREEQSKGRVVYGLDLDPYVGGQVRWVFVASRRSFAV
FT                   EQHFPKASTVVSNSIREYLRQAATYLAPAAALGLTILGLAAWRQSRVEKKHER"
FT   gene            complement(378571..382098)
FT                   /locus_tag="Pcal_0396"
FT   CDS_pept        complement(378571..382098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0396"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: pai:PAE2662 formate dehydrogenase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07831"
FT                   /db_xref="GOA:A3MT64"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT64"
FT                   /protein_id="ABO07831.1"
FT                   /translation="MTVQTTRRSFIKISALAALALGLPASAQQGFTAAKTRWALGEVGG
FT                   KTGLQQARVMPTICPYCSMGCSIDMYTDGQRVIWSAGSTDSYINWGALCPKGKAAFQLV
FT                   NNPRRLMYPLIRTGPKPPVEEILAAKTWDELLAVLKKYPPQWRRASWDEALSYIAGKLA
FT                   GILNAWRTSTGAPKQSDGFYYVGAKSPVMIIGSSILVNEEGYLSRKLAAFLGTSNTDSQ
FT                   YRKCHSSTVSSLAVTYGWGAETASIEDVALADVVLFFSSPAEAHPLSFYYFMKGKRERD
FT                   TIFITFDPRYSRTAAASDIWVPFRPGTDTAIFNYILHYAFFERNPPIDQLPEFQRLMAR
FT                   WNITNDDLADLKEMLKEYDVDTASAITGVPKELLRTVAQIYVENSGVVTGHKKHGIVQW
FT                   AMGFTQHTNATINIIRAAAITQLLLGNVGYPGGGTHPFRGHSNVQGVTDVQGGGLGVLP
FT                   GYHSPPSSAFDVRLYQDWKLQGMPDAWNWEIPQWAQGKVATSTPSRGKADLTKVLQVFN
FT                   FYGWRRLELVWGVFCGTVPEDDPVNGVVVCDLPFGTGASEVTFPRKALAGDIRAAFVFG
FT                   ENPAVSNPNAKVVMAGLASLDLLVVSDIFETETAYFADVVLPAASFAEKEGTRTDGNRV
FT                   IQWTWRAVEPVGESRPDYWIMAQLYKYLRRAGAVVLPSEAAGVKSERVKFRKRGQLIFV
FT                   YERPLKPDRSWDYSGGSGEAAPISEIEAAANPRIISKEINYAVFIYQGIYDPVRDEFTP
FT                   MRRNNRLRKPGEIDGTFSQEFKVYKDWGWSWPMNVRFMYNYDSLQAVLGKADVVTAAGK
FT                   QWTVTGETGEIIDEYTGEYRPAFVPGHNFWAPRSFKRRLSGVSDLFGGLDIIEFIRTGQ
FT                   LVIPGKFVVEDGGEVKVLGFEEFAAATGMRYLWANDAVYWDEEALSMKAALKRPFYSGG
FT                   GWAQFKPNYEKMRQLLQQYYQQTGDLRTATLKVIEEMGGWYKGYNFQWPIHTEPVESPL
FT                   VEMALKYPTLAWTNPYNLDVLTNKPAAVKDFPVGVALEPKQLEDLLKQWGVADAVIVAM
FT                   TSNRLTETWHTGAMSRNVPYLAQLVPAPFVYVPRALAQKLGIQSGDYVELWTARGMLKM
FT                   VAYVTDGEAYLNVNGKTVPVVNVQWSFSFMGDVTGPQGNFLTPDVGDVVTTIQESKAWL
FT                   GAIRKARSV"
FT   sig_peptide     complement(382015..382098)
FT                   /locus_tag="Pcal_0396"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.944 at
FT                   residue 28"
FT   gene            complement(382516..382905)
FT                   /locus_tag="Pcal_0397"
FT   CDS_pept        complement(382516..382905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07832"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT65"
FT                   /protein_id="ABO07832.1"
FT                   /translation="MLRAVVEKFPVSKYQLAKGLPLPTSTVYYELERLGREFYVAEEDG
FT                   VVRPTLKGFVKGVELFGCDVVAPAFGRYLSGLGVVGRGGGAVQVFNGAGPQPRRVERRL
FT                   SSRGHAPLGEANYLEVCDWVRPRLG"
FT   gene            383001..383399
FT                   /locus_tag="Pcal_0398"
FT   CDS_pept        383001..383399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0398"
FT                   /product="protein of unknown function DUF59"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   pai:PAE2055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07833"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT66"
FT                   /protein_id="ABO07833.1"
FT                   /translation="MEVTMEEKPVFETNLPPDKVKKLIEVLREVHDPEIPINVYDLGLI
FT                   RKVVMEDGKVKVVMTLTAVGCPVAGSVAETVGYAVQSVLPEAEDVEVEVDFERPWDPTQ
FT                   MTPQGREMFKAIYGYDIVEQYLQAQAES"
FT   gene            383423..383635
FT                   /locus_tag="Pcal_0399"
FT   CDS_pept        383423..383635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07834"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT67"
FT                   /protein_id="ABO07834.1"
FT                   /translation="METIDVSGQQCPDPLKNVASALAAAPQGARFKIVTDDYVCYMMLR
FT                   RLMALNEVKILEATEEGPYILIVEK"
FT   gene            383663..384089
FT                   /pseudo
FT                   /locus_tag="Pcal_0400"
FT   gene            384190..384750
FT                   /locus_tag="Pcal_0401"
FT   CDS_pept        384190..384750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0401"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: pai:PAE2058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07835"
FT                   /db_xref="GOA:A3MT68"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT68"
FT                   /protein_id="ABO07835.1"
FT                   /translation="MESGSLVKYEGKFYRLLHPRPTLVIVSKCPGGRVNLMPASWNTPV
FT                   SEDPPTVAVAVDKSAYTHECLQYHKRATLNVLPIDAADLIYRLGSVSGREMDKSAAVKL
FT                   EPSQYVDVPRVAGALAVYEAEVYKEVEVGEVVLYIFRVVATWAAAGVADQWGFDFKKVN
FT                   IPLHGAGRAFYKVDPRPVFAKKP"
FT   gene            complement(384708..385955)
FT                   /locus_tag="Pcal_0402"
FT   CDS_pept        complement(384708..385955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0402"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="PFAM: VWA containing CoxE family protein; KEGG:
FT                   pai:PAE2059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07836"
FT                   /db_xref="GOA:A3MT69"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR040322"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT69"
FT                   /protein_id="ABO07836.1"
FT                   /translation="MGLLLNVDYGDSLSLARGRDVLRRAGVKAVGVEEAVDAYYLHYRR
FT                   PIFGGRAGNEVWARFVRLYVNSSYYSAVAPLCRLNHRASREAAVRLLRAFESYLLSLER
FT                   RGRAWFGRGSQEAWVEAMRQLRRLFGDPADVSELHRVFKKLGEVLGRGRRGDPASLALS
FT                   TASDPRRARLASLLAKAVDLSALLGDPLGDVGRVEGPGAEFEVAHGSFARVKRAVAYAR
FT                   ALFVGALPVFLHKAASSTLPVRRPRARGDSGVFLLVDKSGSMYSAVGGVEKIALATAFA
FT                   LAVLKRYKRARLRFFDVEVHRVEELGDLVDVLSRAWAGGGTDISRAVEAAAEEAARERL
FT                   RGYSLVVVTDGEDDAFSPAAAREARAVFREVLFVVVGERRLSGVRQVFLRPPPLAAAAP
FT                   QAAYGFLANTGRGSTL"
FT   gene            complement(385986..386363)
FT                   /locus_tag="Pcal_0403"
FT   CDS_pept        complement(385986..386363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07837"
FT                   /db_xref="GOA:A3MT70"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT70"
FT                   /protein_id="ABO07837.1"
FT                   /translation="MLVASALAAAGRPLLPPEAVASPPPDYLDRLASAAVDVALVAALS
FT                   YPALFFLAAGYGVLTPAVAGAHGLSYALLFVGVVHVVLFFYAQLAKYHPLARRLAGGRV
FT                   EWGKYLLWLALSLSLVGVLAL"
FT   sig_peptide     complement(386298..386363)
FT                   /locus_tag="Pcal_0403"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.761) with cleavage site probability 0.751 at
FT                   residue 22"
FT   gene            386436..387650
FT                   /locus_tag="Pcal_0404"
FT   CDS_pept        386436..387650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0404"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; KEGG: pai:PAE2053 pleiotropic regulatory protein,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07838"
FT                   /db_xref="GOA:A3MT71"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT71"
FT                   /protein_id="ABO07838.1"
FT                   /translation="MLAIEGGAPVRREPIVAKPVVYSEELVQAIAEILKSGVLTAQHGK
FT                   WVKAFEAELAAYLGVRHVAAVSNGTTALHVALKAIGVGPGDEVITTPFTFAASATAILH
FT                   ANAVPIFADIDRETLNLDPASVEEKITERTKAIVVVHLAGMPAEMDQLMKIAERYGVKV
FT                   VEDTAQALGAEYRGRKVGAIGHISTFSLYATKHITSGEGGAVATDVTAYAERAKLIRAH
FT                   GEVGKYSYEILGYNYRMTEIQGAIAYHQLKQLPEMQKRREAYVKALLDELAPLEGDLLT
FT                   IPKPKPYMKHAWHLVQILLAMEKLRKPRDWVVEAIRAEGVGNIYVAYPTPLYKTPLFQR
FT                   REGHGLGCPWTCPYYKGKAQYEPLPNAEWAAERVATLLVMPNLTEQDAADTATAIKKVL
FT                   NAVRR"
FT   gene            complement(388001..388873)
FT                   /locus_tag="Pcal_0405"
FT   CDS_pept        complement(388001..388873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0405"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   pai:PAE2050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07839"
FT                   /db_xref="GOA:A3MT72"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR011589"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT72"
FT                   /protein_id="ABO07839.1"
FT                   /translation="MVFDNHAHANEVAGLGAVEVVRRFKAAGGIGIVFVSLLTWSIGGR
FT                   PGDRDWVARLYDHTVGNVGVARGAGLVSGAVVGVHPAECVRLLEAGWGAGEVEEFMRWA
FT                   VDLAARYVEEGRAVGLGEFGRPHWPVERGVVELCNRVLLYVLERARDVGAVVHLHLERS
FT                   GAATVASVAELVKRAGTRPERVVMHHIEGALAGYAWSRGLSPSVPLGRRGEFEEALRAG
FT                   PVFVVESDYIDDRSRPGAVIPPWTLVSKLRQYVQRGVLSVDDLYKISVENVRRIYGDRL
FT                   PLDNVEIKI"
FT   gene            complement(389128..390135)
FT                   /locus_tag="Pcal_0406"
FT   CDS_pept        complement(389128..390135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0406"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: pai:PAE2048 P.aerophilum
FT                   family 417, putative ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07840"
FT                   /db_xref="GOA:A3MT73"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT73"
FT                   /protein_id="ABO07840.1"
FT                   /translation="MSELAEVVREGLTLIYGPPGAGKTSIAMRLADTVGNRVMWISTTE
FT                   GPNFLTLAAKRVGASPEKFAFLDFPRAFREDIAKYVLEHAHEYDAVVVDSVNGLASSIP
FT                   SLEKLAHSVFYQISRDRPVILVAEEEPRNLHYIADHVVHVWYKINSVGHLIRYFQLEKS
FT                   RKRPPGPRYIFDIVEGEGIIYITMAGTRGHQEIIIDDKLGVEVPLKSTICLGAPSVKKV
FT                   VKILSNIKDEAIFLQIGPWTSYRGLEIKSDQEVVVSTFHTFFELWNRLERRELPNVRYL
FT                   VVSGLLNLSEDEIYDYFYILYAFQDYVDFLVIVNIGSSEELEKLEKYCAESVRF"
FT   gene            complement(390453..390848)
FT                   /locus_tag="Pcal_0407"
FT   CDS_pept        complement(390453..390848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07841"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT74"
FT                   /protein_id="ABO07841.1"
FT                   /translation="MELYHAEIRLLHRRVIAEHPEHVREIALGGLKSDGSYSENAYAKF
FT                   VYDFLGLKLEDPQRYIASAKLWKMPDVKVVVEDSLQYNFVKFVHYLNKLTEFILGKARG
FT                   VSIELPQAAEACSAWSRRRDVCVHFLC"
FT   gene            complement(391274..391615)
FT                   /locus_tag="Pcal_0408"
FT   CDS_pept        complement(391274..391615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0408"
FT                   /product="emp24/gp25L/p24"
FT                   /note="PFAM: emp24/gp25L/p24"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07842"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT75"
FT                   /protein_id="ABO07842.1"
FT                   /translation="MAFSRLHPQRARLCGECKGLPTGALRLILLAEGGSRVIVDLSIRD
FT                   EPLPRNNDVRVVLWSPSGNVIADVVARGHYLYEFYAYESGTYYLRLDNTRSVVTAKVVA
FT                   DKVRVEKSF"
FT   gene            391753..393384
FT                   /locus_tag="Pcal_0409"
FT   CDS_pept        391753..393384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE1528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07843"
FT                   /db_xref="GOA:A3MT76"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT76"
FT                   /protein_id="ABO07843.1"
FT                   /translation="MAKWLAVLLLATLLVAAQPLAEILKLKVEPLPCLLNSTCSAYRAT
FT                   ALINASASGQLALGAWALVKGEWKALDWCYPTGSGPCTFVIELKPEYEALGFPLWTNQQ
FT                   GRWVWVQSVDIYGVNAVCTMAYKCPEIDKVEVERGGELGGWRVRVYVKSPSQRMRVALD
FT                   IGGMYVEKEVEQPFATACTTLRVDFGPYDFPQGTCGRVRVYGDCGMVERQVCAQSADSN
FT                   VVVVRVADVVEEKYVKGIGIVKVKAPHVLKVGEEYLTEFNIRVNREELGRLIQLIKRVC
FT                   QLLCQLPWSKPFMPESLCQKCSDLSSYLVLHGGVRAYASESGSGGVALFLALGLQQTYG
FT                   TIPAGPNRYLVFSNIDEFFAIYYVVKGLPPLSLTDLESKGVPISLKITPLGPESYRLTG
FT                   GEEEITLRYKIQLVPNTEYMLNFNNITAEYSKLQYSNDILSRVEALSAAVERAEGQTAT
FT                   VTTTSTAYVTILVTTTATLPITTTKEVTMTSPIVVTSPTVVTVPTTVTQTTTERLVVRE
FT                   TDAALLAAVAVAALAVGVLIGRAKKA"
FT   sig_peptide     391753..391818
FT                   /locus_tag="Pcal_0409"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.846 at
FT                   residue 22"
FT   gene            393946..394314
FT                   /locus_tag="Pcal_0410"
FT   CDS_pept        393946..394314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2046 P.aerophilum family 453"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07844"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT77"
FT                   /protein_id="ABO07844.1"
FT                   /translation="MRRLPAPVVSVGCIVRFLRVAVWGFVDAYQVFRDFYYSLGMPLRV
FT                   VIEYRLRRRGVSLSDVFSKPWLLTKYVAEEMGGHNAELIAALFVEYVRKLGVDASVAWE
FT                   ALRGEEGWARFVSHVERL"
FT   gene            394298..395482
FT                   /locus_tag="Pcal_0411"
FT   CDS_pept        394298..395482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0411"
FT                   /product="putative ATP binding protein"
FT                   /note="KEGG: pai:PAE2044 P.aerophilum family 417, putative
FT                   ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07845"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT78"
FT                   /protein_id="ABO07845.1"
FT                   /translation="MWSGFEFFEGFSLLYGPPGAGKTSLALYAAFRLGDRVLYAGFYET
FT                   GEAVVSKARALGLDVGRLTVLDFFAVSDADVLYSTLVSKYVEVKPDVAILDGINALPQS
FT                   REAAASIYRIFRGPVIAIGEESVGGSHFAYYADSLVEVRQVFHRGARYRLLRVVKTRLS
FT                   PSRGAEYFFTISRRGVHLLRRWSQGSLGGKLAATPSGRRATFSEEVVKALVGRAPAYTR
FT                   PGLLAGSRVGVFLEDHPTPLRLAAAFLCDYLDESRVGVVSTYPLMGSLARQVGCSVEEV
FT                   VVPAAVLDDDAALHEALDKVGDVSVVALYGLEEVLARYGARRVGYVMDFFQTFLPDSAV
FT                   LATFRGVEPTRALLGMFNTAWRYYPDRAVVVKSALGWPVRELRVVERDGRFYLG"
FT   gene            395523..395879
FT                   /locus_tag="Pcal_0412"
FT   CDS_pept        395523..395879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0412"
FT                   /product="Helix-turn-helix, type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix, type 11 domain protein;
FT                   SMART: regulatory protein, ArsR; KEGG: pai:PAE2042
FT                   P.aerophilum family 453, possible regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07846"
FT                   /db_xref="GOA:A3MT79"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT79"
FT                   /protein_id="ABO07846.1"
FT                   /translation="MEDPRKAILEILRREGPVPVYRLAKALGLSYGAVQWHIFTLEREG
FT                   LVETIRVGKRRYVALKTADVARTIKVADALEELALTLRAYGVRPDMSLQEAIELLEKKA
FT                   PHIAEILKRLITRP"
FT   gene            396026..397549
FT                   /locus_tag="Pcal_0413"
FT   CDS_pept        396026..397549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0413"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   pai:PAE2041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07847"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT80"
FT                   /protein_id="ABO07847.1"
FT                   /translation="MKAPWFMFKFLCGVRFVRTLLALVGLALLFLGLASLGPAPSPSSA
FT                   SVLPLPGSSQFSPPVVSVSGGLYFKAWMYARGTGGVMYLRCLVFDSYVDGAWSRAAGDS
FT                   FAVGAGVVTVGSPASFGGEVNLSAPLMGGCVPVATPSVDGLVLGSVRVVAPGASLAASK
FT                   EGLFVVATGGSVGRAASYYGPGAPQPPPSGVYLEVPPGLAPVLKSIAANVTAGCADAAC
FT                   KVAKIKEFLSHFRYDGTMDSLWPSVPPGVDPVLWFLQEGRRGVCIHFASAFVLLARSAG
FT                   VPARLVVGYVSDGPVPGDWALTAFSPHAWAEYYVEGVGWVGVEATPPGSAPQSLPVVPL
FT                   RPEAVQPPPPGPSLPQLAAPQVPEVPWPVVAVAAAAVGALAYFSAGRRAATVGVGEEFL
FT                   VEGPRGFPVYVGRRRVGRAPVAVVFHRPGLYVVRAGPLVYLVRVVDYRRVAGALFVKLL
FT                   RRLGLPATTTPRELAAARPELRELALAFERALFGPAVSKGDVEALRRAL"
FT   sig_peptide     396026..396163
FT                   /locus_tag="Pcal_0413"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.982 at
FT                   residue 46"
FT   gene            397546..398442
FT                   /locus_tag="Pcal_0414"
FT   CDS_pept        397546..398442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07848"
FT                   /db_xref="GOA:A3MT81"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT81"
FT                   /protein_id="ABO07848.1"
FT                   /translation="MIYIAAGLALLLLAYYDPAFRPAAYPLAAFFLGHGVGSLLHRRRR
FT                   HVAGYFSTFLGVSAAVYLAPLPLSLFHRALLVGVAFGFFLNAARFFTRLRRVLAPVSIA
FT                   VTAGSLGAFLYAVGAPLLPVAAWGVGAGAAAASALGLAGGRRGRFFARRTALFGVLGGL
FT                   LGVLYQVSALVGGLQLFASVAAAAVASLLLLGTEAKWPRPRLYDDADVLAAKRVEARFV
FT                   KTGDVALLAAYVAYHLAKAGVEEGRVVEVVRAALSYRDWEPSPFAPPLVAKLVERANRR
FT                   RRERHLRKVEALLRRYL"
FT   gene            complement(398433..399341)
FT                   /locus_tag="Pcal_0415"
FT   CDS_pept        complement(398433..399341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0415"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_3; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG: pai:PAE2039
FT                   moxR related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07849"
FT                   /db_xref="GOA:A3MT82"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT82"
FT                   /protein_id="ABO07849.1"
FT                   /translation="MRKVLEVLSQFYVARRDVLELLLAAVVAQGHVLFTDPPGLGKTTL
FT                   AKLLAKSLGLSFKRIQFTPDMLPSDVVGVNVWRPHEGRFEFVKGPVFTNVLLADEINRA
FT                   PPKTQAALLEAMEERQVTVDGVTYKLEEPFIVLATQNPVEHRGVYPLPEAQLDRFLIQL
FT                   SVGYPGEAEEAEILKRRIAWKRDDPTAYVTPVVGREELLSWMRRAEEVYVDDAVLKYVV
FT                   KIVQALRSHPLNAYGPSPRGSIALVKMARALALLDGRNYVVPDDVKKAAAAVLSHRISP
FT                   RDGDPRSLVEEVVAKTPIPYR"
FT   gene            399378..400298
FT                   /locus_tag="Pcal_0416"
FT   CDS_pept        399378..400298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0416"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   pai:PAE2038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07850"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT83"
FT                   /protein_id="ABO07850.1"
FT                   /translation="MKPLLATAAILLATGLALGNGDVALLAAVPLASYAVNALLPPPRI
FT                   AVAKRREGSYVEVYIQGDRLPGVLYIYDAAPLDAPGGPRRWALFKPPLKRTLRLRYREE
FT                   APGGGLVVEVYNPAMTKRAVVVYAEEPRAAAPPAKPWEGAEEFAEVKPYQPGDPLRRVN
FT                   WRAFAKTGELYVNKYAGSERGRAVVVVDARRLRGAVVEAAAKAAAILAERGYDVSYFVL
FT                   GHGEAQEVPKSFTPSCTGRPPCADVVTYVGSLRDPCPVDCLRVVYIDVAARNPLAAIRR
FT                   LSLYRELRARGAEVLTDVEKLAEVV"
FT   sig_peptide     399378..399437
FT                   /locus_tag="Pcal_0416"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.971 at
FT                   residue 20"
FT   gene            400295..400774
FT                   /locus_tag="Pcal_0417"
FT   CDS_pept        400295..400774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07851"
FT                   /db_xref="GOA:A3MT84"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT84"
FT                   /protein_id="ABO07851.1"
FT                   /translation="MRPLYGLATAAVQYVLFVGHPILSIYPRALDHWASPGAFAAFLLI
FT                   INLALSLKRPYTAAFATLVLYLAEAALASPTLRLFVALPEVPPPSPWLGLAAALLTVAT
FT                   AVEGPHGLYLAAAGAPAAALLLAKDYAPRLDYTAGLALAAIGLALLVWATRPAGS"
FT   gene            400816..400974
FT                   /locus_tag="Pcal_0418"
FT   CDS_pept        400816..400974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0418"
FT                   /product="paREP10"
FT                   /note="KEGG: pai:PAE0648 paREP10"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07852"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT85"
FT                   /protein_id="ABO07852.1"
FT                   /translation="MTSVLELLGPHAYGLWKYGIGPTDDVETAITKLRATAPHLAKFLS
FT                   EVAQRRL"
FT   gene            complement(401277..402089)
FT                   /locus_tag="Pcal_0419"
FT   CDS_pept        complement(401277..402089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0419"
FT                   /product="Protein of unknown function DUF1626"
FT                   /note="PFAM: Protein of unknown function DUF1626; KEGG:
FT                   tropomyosin"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07853"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR012431"
FT                   /db_xref="InterPro:IPR024271"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT86"
FT                   /protein_id="ABO07853.1"
FT                   /translation="MVVDLSQLKAALLKLLKEDEEFRYAVAGLIGLEEILKRLDRHEEE
FT                   LVKIWEELARLREDMNKRFEHYDQLFAEVFKRFEKYDQLFAEILKKLEQHDQLFAEILK
FT                   RLEQHDQLFAEIFKRLDRHEERIGRVEEELARLRAEVERGFRRLDALGARWGVMTEKAF
FT                   RDGLRGVVERELGLKVERWTTYDEEGRVFGFPSEVEVDVAVKDGKVILIEITSHARPYE
FT                   VSLFKKKADLYAEKEGRRPDRLVIITPYAEEDAKKVAERLGIEIYTGV"
FT   gene            402434..403447
FT                   /locus_tag="Pcal_0420"
FT   CDS_pept        402434..403447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0420"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pai:PAE2393 dipeptide
FT                   transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07854"
FT                   /db_xref="GOA:A3MT87"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT87"
FT                   /protein_id="ABO07854.1"
FT                   /translation="MAGLLRYVAVRLALAVPTLLILLTVVFFVLRVIPGNPIVAMVGMK
FT                   APQEYVEQLIKEAGLDKPLYVQYFDYLAQVFTGNLGRSLIFGRREVVAEILDRLPATVE
FT                   LAVASFLVSVALGHLFGFLAARFGGWVDSGARVYSMVAYVLFIPFLGLALQLVFSVWLG
FT                   LFPVAGRITPGLEPPRITGLYVVDSILAGRLDSLADALWHLALPSFTLGLVLSGVFTRL
FT                   IRNNMVKTLSEDFVAAYRAMGFGEWAVLWKAYRAAIVPTVTMMGLQLALLLQGAVLTET
FT                   TFSWPGLGTLLLERIQYLDYTTVQGTVVVFVVIVVLLNVAVDIINALLDPRVRKGV"
FT   gene            403447..404235
FT                   /locus_tag="Pcal_0421"
FT   CDS_pept        403447..404235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0421"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pai:PAE2392 dipeptide
FT                   transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07855"
FT                   /db_xref="GOA:A3MT88"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT88"
FT                   /protein_id="ABO07855.1"
FT                   /translation="MLRVGVLITAAVVALSIAAPLIAPYDPTKSVGEPLAPPSAAHLFG
FT                   TDNLGRDVFSRVLYGGQVIIGVSLLATALSAAVGFPLGLFSGYMGGRVDRGLSMVMDSM
FT                   YAFPSLILAIAIASVLGPSPLNAAVAIAVVYVPTYFRMARNETMVVKSSLFVEAAVSLG
FT                   MPRWKILFRHILPNLVPSFVVVATINIADAALTESALAFFGYTVTPPTPDWGLDLSSAR
FT                   SYIVNGAWWLLAPGFFIILTALGFSLMGEGLGERVGKKEW"
FT   sig_peptide     403447..403503
FT                   /locus_tag="Pcal_0421"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.951) with cleavage site probability 0.944 at
FT                   residue 19"
FT   gene            complement(404242..405819)
FT                   /locus_tag="Pcal_0422"
FT   CDS_pept        complement(404242..405819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0422"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: pai:PAE2391 dipeptide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07856"
FT                   /db_xref="GOA:A3MT89"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT89"
FT                   /protein_id="ABO07856.1"
FT                   /translation="MFLAQQPAQPTTTAAPTTARPTTAPTPQPTTPATTTTPQATPLTI
FT                   TIGVTDKVTDLDPANAYDFFTWEVLYNTMAGLVRYKPGTTEIEPDLAESWTVLEGGKVW
FT                   VFKLRPNLKFCDGTPLTAADVKRSIERVMKINGDPAWLVTDFVEKVEAPNATTVVFYLQ
FT                   KPVSYFLALAATPPYFPVHPKYAPDKIDSDQTAGGAGPYCIKSFVRDQQIVLEANPYYY
FT                   GPKPQVGRVVIRFYKDATTLRLALERGEVDIAWRTLNPPDVEALRASGKFNIVEIPGSF
FT                   IRYIVLNLNMPELKDVRVRQALAAAVCRRDIVNVVYRGTVTPLYTLIPEGMWSSYPVFK
FT                   EKYGDCNITLAKTLLQQAGYSESKKLNIELWYTPTHYGDTEKDLAAMLKQQWEATGMIA
FT                   VTVKSAEWATYVQQLRSGALMVSLLGWYPDYIDPDDYTTPFLKTGANKWLGNGYSNPEM
FT                   DQILDKASVEISQTAREQLYLQAQRILAQDVPIIPLIQGKLYMATRPGIQVVADPTMIF
FT                   RYWTIKVG"
FT   gene            405932..407089
FT                   /locus_tag="Pcal_0423"
FT   CDS_pept        405932..407089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0423"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sto:ST2400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07857"
FT                   /db_xref="GOA:A3MT90"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT90"
FT                   /protein_id="ABO07857.1"
FT                   /translation="MRRVVAVVGVARFVRYFILGHLAVSLPIALEASAGGAAGAGAVLS
FT                   LAGLISLGASIAYSVVGDVVRHARGLAISETAFALGLLALAHVKNPWLLALALGLGGMG
FT                   TLGPGATRGAFVPLILAVIRDHSKSHVESAKAIGVVNSISTLGGILGSATAGFTDLRHS
FT                   IPPYSAVALGTALLIAVALGRGERVRAVNPLKRVATRGREVAGYSLSQFVAGVGIGLSM
FT                   PLLSLWLHAYMGLDEATIGLIFAVGNGAFMVSSLFAYRLVEALGLVRAAVVSRVASGML
FT                   LASLPIFREVVPFAVAFVFYNAAVGIGGTARSSYISSVAPVGSEATTPAVSNIAIRASS
FT                   VPSVALSGYIMELEPAAAMPLAGLMLIAAGAIMWKMLKEPEEFTH"
FT   gene            complement(407079..408623)
FT                   /locus_tag="Pcal_0424"
FT   CDS_pept        complement(407079..408623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0424"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase B/oxoprolinase; KEGG: pai:PAE2028
FT                   N-methylhydantoinase B"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07858"
FT                   /db_xref="GOA:A3MT91"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT91"
FT                   /protein_id="ABO07858.1"
FT                   /translation="MKWELVFKATEYIAEEAGIALRNSAFSPNIRERMDHSVAVVDAEG
FT                   RIVAQAEHIPVHLGSFYVGVKNLLHYLSKEGVELEEGDAVLTNDPYISGTHLNDVMVLY
FT                   PVHWRGRLVAYIASKAHYVDVGGPLPASLNPAAKTLYEEGVVIPPVKILRRGELNREVL
FT                   AIILANFKTPDYARGDLEAQLAASRVGAARVKDLFEKFGDAAKGWEEAVEYGRRLTLAE
FT                   VEKWPKGVYRAEDYLDWRGELLPIRIALEISERGIKADFTGTSRQVEAPVNAVLGVTFS
FT                   SVSFAVRSALGVDVPTNHGFYEVISVEAPQGTLVNPVKPAAVGAGNLETSQRVADVTFL
FT                   ALSKALRGRIPAAGSGTMMNVMIGGFWKGRYWSYYETVGGGTGGRPGSPGVSGVHVNMT
FT                   NTLNTPIEIAEREFPLKFTAYKIREGSGGRGKWPGGDGIVRSFKVLSKSTLSIIASRFK
FT                   MGPWGLEGGEPGKPAKVVIRRKNGAVEEIESATVELEEGDEVVIETPGGGGYGASV"
FT   gene            complement(408620..410563)
FT                   /locus_tag="Pcal_0425"
FT   CDS_pept        complement(408620..410563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0425"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG: pai:PAE2030
FT                   N-methylhydantoinase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07859"
FT                   /db_xref="GOA:A3MT92"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT92"
FT                   /protein_id="ABO07859.1"
FT                   /translation="MIVGVDVGGTFTDFVAVDEEGRVAAFKILSTPREPERAVVEGLSR
FT                   LEFSEVLHASTIGTNALLGQVGLELPKVAYFTTRGFRDVLEIGRQNRPQLYDLFFQKPR
FT                   QIVPRDLRFEVEERTLPDGTVEKQVDPAEVSTLAEKARAAGAVAAAVGFLHSYANPDNE
FT                   RRAAEVLRKYFEYVTASHEVAWEPREYERFSTAVVNAALMPVVGRYLAKLDSYVRSRGG
FT                   RMYVMASSGGLVTVEEAARRPVQLVESGPAAGVVAAAELAKALGERRVVSFDMGGTTAK
FT                   AGVVVDFEPSITTEYEVGGESHKGRIVKGSGYPVRFPFVDLAEVSAGGGTIIWRDAGGA
FT                   LRVGPLSAGADPGPACYGRGGAEPTVTDANLVLGRIPEALAGGAVKLDPRAAEKALAKL
FT                   GDPVDVAASAVKLINLEMARAIRLVTVERGLDPSSFAIMAFGGAGPQHAAEVAEEMGIS
FT                   RVLIPPMPGVFTSLGMLMADFKFEARMAYPRDLAEGFRLLEQQLSIYKPDYYVRLADVR
FT                   YKGQGWELTVPLGADVSPEAVKRAFEERHKATYGFTLDREVEVVTIRAFAVVKRAKPRL
FT                   RDPPSEGAPDVGEREVYFDGWTKAAVYKRAQLPLGYRVKGPALIVEDNSTTVVPPRWEA
FT                   AVGKYGVLEMRL"
FT   gene            complement(410560..411792)
FT                   /locus_tag="Pcal_0426"
FT   CDS_pept        complement(410560..411792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0426"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: tvo:TVN0810 permease
FT                   (major facilitator superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07860"
FT                   /db_xref="GOA:A3MT93"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT93"
FT                   /protein_id="ABO07860.1"
FT                   /translation="MSVKISPGLVIGVASGTVLEWYDAFLFAVAASYVGAAFFPSKDPL
FT                   VQLANVFLTFALGFFARPIGALLFGYIGDRYGRRVAMFWTLTLAGLATALIGAVPSYAQ
FT                   WGLAATITVIVLRLLQGLALGGEWGTAVNYLFENVKRKRLFMMFVQSGVPLGLLLAAGV
FT                   MLAFVQAFGEGATAAWGWRVAFMLSLVLVVIGLLFRLRFGETFEYIEAKRAAEKASNPI
FT                   GDVFTRYWKPLIVGIFLAGAAGAVFYYGNTFLPNVASALKLIDATTRFLLVVIFAVLDL
FT                   LGIIASGFIAERIGNVPPIVFGFLLFIIAALLVEQGLSNVSTLFLLAILTGIAHGIVYT
FT                   PEAAYLAELFPTLVRNTGVSTAYQFGNTIFAGTAPYIMTSILQYGRLTAGLYLAVLAAI
FT                   GLLGVLLYRRR"
FT   gene            complement(412104..413243)
FT                   /locus_tag="Pcal_0427"
FT   CDS_pept        complement(412104..413243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0427"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase, IS605 OrfB; KEGG: sto:ST0998 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07861"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT94"
FT                   /protein_id="ABO07861.1"
FT                   /translation="MACKTDKLIATVKAKVEPTPELIELLKRYRDGLNMAIRWAVEAAR
FT                   AKGRPPTLSKIYRAVYEQLRTMGLPSYIASACYREALAIVRSYLASGARGRMPVVNTLH
FT                   MWLHKNAYRVRDGYLYVTGGYKARVVGIEEKYKEGEWKEAKLVYRGGDMYLYIAVEVPK
FT                   PMLVKPKGVIAVDINERYVYYGNSQWVKKVETPVEKAMRLRELAEKLQRRYSAPRYTPW
FT                   NRRGGIRERIRRLHKKARDIVEDWAKKTAKRIVEEARERQYAVAVEDLTGLKEAIRELT
FT                   KEHRVGLMLLAYRRLLWWMKWQAAKRGVVVVEVEPRGTSTTCPKCGGKMEEVGHRRVKC
FT                   VKCGFEAGRDIVAIYNIEKRAREKLGNPSFSPLAVLTPS"
FT   gene            413637..413900
FT                   /locus_tag="Pcal_0428"
FT   CDS_pept        413637..413900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07862"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT95"
FT                   /protein_id="ABO07862.1"
FT                   /translation="MVICLTSGEARRLDLDFDAVLVFWPSLHISARRALAARGVDPDAV
FT                   ELVNAVQLAGRARRAEVVVFADCRYAKHRQYLEQFYQLEEVG"
FT   gene            413949..416753
FT                   /locus_tag="Pcal_0429"
FT   CDS_pept        413949..416753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07863"
FT                   /db_xref="GOA:A3MT96"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT96"
FT                   /protein_id="ABO07863.1"
FT                   /translation="MGHNFNIQLASTSMSFVAFSKGVVFVLIVVVLAQYALALDAQRQI
FT                   LPPMADVEYVLHVNPGKGGWVVVKFWTYGRGEVSFGIGQFMRGVVNITGASVSYTYDRA
FT                   RGVITLVVGGRAWAWFNYTFPRLVWYYQPSYGGYLPKRVLIVDVGADYVQMWPKEAFFQ
FT                   PYTLTPKTVAIRLDGVLKEWYVVAAYSQRTEDLLYFEYNMFLQSPFLAGKLYKLAEAKA
FT                   EGVTVYFPIFESKLLLNDYLNTMGYDGTYDPLLGAQYKANVIARGIDIMMKLLGLPPPV
FT                   DRAYMHPLRKTLPEGARPESEYITDMGLYGGVWVFHNDMIWRIGHILHHYVTPWLTYVY
FT                   ALDFRDTPEPIWYKGMQDYVGYVAASMATNSSIYNGSLIVPRYILYLRAFEERKYSPGT
FT                   MLGGPSWIKYVYAPLAMFYLDNILREKSGGALDIYKLHGLAVANKKWQFVEVSEVASML
FT                   KREFKIDMYKYFDEVRDLNLNKTLLKRFVEEGKWYSYFYTFLDFIRENFTLAPDTLYAV
FT                   YLEYVAWKGDPEETLYPFNLWRFEEILGDLVKALNGTKPLTKEAFIAALNKITGGKSSD
FT                   FFDFYTKTRLNVSASDVEAFLNGTYPRVLGKIISAKKVIKALPVDATEFKRELDEAYAQ
FT                   LKRGDYSGAELLVDRLLEKLYETKRQLYEAKRLQGGYKVGKIEIDGDIGDWVANSEYVL
FT                   NVTKSRAEDSCPTIPGNAIKSVYVAHDDNYLYVAIQFFDKPYSPQNRIQLVFDRDLDLR
FT                   TDNDRVGLEFAIPNLIGVETLGLGYFGDFVEVKIPLETLRLMGVGRKFLLRVWVDTWGM
FT                   GLPYDVPGLERRCMNSLDVVVDLDSLPNLSHVKAVGATKTVTTTVVQVVTTSVTTTATR
FT                   TVTETSERFTTITQTVEKTATVEKTSTTTVVVEKFDLLGLIALAVMAIALIALALALAR
FT                   RSHK"
FT   sig_peptide     413949..414065
FT                   /locus_tag="Pcal_0429"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.837) with cleavage site probability 0.693 at
FT                   residue 39"
FT   gene            416807..417361
FT                   /locus_tag="Pcal_0430"
FT   CDS_pept        416807..417361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0430"
FT                   /product="Zinc finger, TFIIB-type domain protein"
FT                   /note="PFAM: Zinc finger, TFIIB-type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07864"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT97"
FT                   /protein_id="ABO07864.1"
FT                   /translation="MACPVCGGRAVVVSPDGEYVCVQCGTVIGPVYMWPIRRVDERLAE
FT                   KAAELSKGLRLALVKRGVPLREWLELEGARAWLEQKRRLTAWIPPSKRVEYYIEAAAAK
FT                   LGLGRAALEEALALYRRLDRRALVGKSPRVVAAVIYTATCTPARAAAEALGVSPISVKA
FT                   TVRKLKLAVKICVRRGVPRGA"
FT   gene            417469..417591
FT                   /pseudo
FT                   /locus_tag="Pcal_0431"
FT   gene            418585..418920
FT                   /locus_tag="Pcal_0432"
FT   CDS_pept        418585..418920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0432"
FT                   /product="DNA-directed RNA polymerase, subunit F"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb4; KEGG: pai:PAE3335
FT                   DNA-directed RNA polymerase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07865"
FT                   /db_xref="GOA:A3MT98"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR010924"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT98"
FT                   /protein_id="ABO07865.1"
FT                   /translation="MSVRRIIRSEEVTNAKALEILRELASRSQLSEEQRKTLDYLEKVV
FT                   KRRGDEAEALVKQLMERFGFTRVTAAQLVNLSIDSLEELRVVLSYLEKREYSDSELKEI
FT                   LKLLTGQ"
FT   gene            418917..419501
FT                   /locus_tag="Pcal_0433"
FT   CDS_pept        418917..419501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0433"
FT                   /product="putative nucleotide binding protein"
FT                   /note="KEGG: pai:PAE3336 putative nucleotide binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07866"
FT                   /db_xref="InterPro:IPR007003"
FT                   /db_xref="UniProtKB/TrEMBL:A3MT99"
FT                   /protein_id="ABO07866.1"
FT                   /translation="MKKREEYGYVIDILPPEVAVYKLPPKIRRDFPHDATYAHLVGEEH
FT                   FTLLEVTLKRGVSVEIGERLYVGPGARDKVDKIVRRIKYDDLQPQGRENLVAIVKKLVE
FT                   QQESRFVKWLNEAGPLTLKMHSLELLRGVGKKKVQEILEERKKKPFTSYEDVKQRVGID
FT                   LVELITDRILREIAGEDPYYLFTTPPPATSL"
FT   gene            complement(419488..419886)
FT                   /locus_tag="Pcal_0434"
FT   CDS_pept        complement(419488..419886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0434"
FT                   /product="translation initiation factor 5A precursor
FT                   (eIF-5A)"
FT                   /note="TIGRFAM: translation initiation factor eIF-5A; PFAM:
FT                   initiation factor 5A hypusine (eIF-5A); KOW domain protein;
FT                   KEGG: pai:PAE3337 translation initiation factor aIF-5A"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07867"
FT                   /db_xref="GOA:A3MTA0"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR019769"
FT                   /db_xref="InterPro:IPR020189"
FT                   /db_xref="InterPro:IPR022847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTA0"
FT                   /protein_id="ABO07867.1"
FT                   /translation="MSTKYVEVGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSAKARVV
FT                   AVGVFDGAKRTLSLPVDAQIEVPIIEKFTAQVLSISGDVIQLMDMRDYKTIEVPMKYVE
FT                   EEAKGRLAPGAEVEVWQILDRFKIVRVK"
FT   gene            complement(420074..420916)
FT                   /locus_tag="Pcal_0435"
FT   CDS_pept        complement(420074..420916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0435"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="KEGG: pai:PAE3338 hypothetical
FT                   5'-methylthioadenosine phosphorylase; TIGRFAM:
FT                   methylthioadenosine phosphorylase; PFAM: purine
FT                   phosphorylase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07868"
FT                   /db_xref="GOA:A3MTA1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTA1"
FT                   /protein_id="ABO07868.1"
FT                   /translation="MVVKLTQPPRRPQEIGFDSFPTLGIIGGSGLYDPGIFENAVEVQM
FT                   HTPYGLPSDNVIVGRVAGRVVAFLPRHGRGHKYPPHKIPYRANIYALHALGVKSVVAVS
FT                   AVGSLRPDYAPGDFVVPDQFVDMTKGREYTFYDGPRTCHVQIGLEPFTQEIRKVLVETA
FT                   SKYNKTHDGGCYICIEGPRFSTKAESRIWREVFGCDIIGMTLVPEINLARELGMCYGLI
FT                   ALVTDYDIWVPHQPVTAEAVEKMMTEKMALIRKVIVEAIPKIPEEIPKCAEILNYSCV"
FT   gene            complement(420936..421133)
FT                   /locus_tag="Pcal_0436"
FT   CDS_pept        complement(420936..421133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE3436 ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07869"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTA2"
FT                   /protein_id="ABO07869.1"
FT                   /translation="MGQHRKSGGSGGKGMVGFHKHEWSLVMKYGESGTGWPFYGKHGFN
FT                   NPSPPPSNGALGVFGVIIVK"
FT   gene            421220..421714
FT                   /locus_tag="Pcal_0437"
FT   CDS_pept        421220..421714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07870"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTA3"
FT                   /protein_id="ABO07870.1"
FT                   /translation="MSEVFAPTPTELLRKYGAKRLGERYEVSALNLPWVFKREVEVEIS
FT                   PGKQYRISGVEVVGVSPPWETYVALVDKGGEFGVGYVATPRKRMFQCIRKPYAYPLGVK
FT                   TPQHIVVKPVELLLTDAPGVVECVDRAFTAGYLAVFINAPVSVVQKAQVRIEPVIEEMF
FT                   K"
FT   gene            421737..422099
FT                   /locus_tag="Pcal_0438"
FT   CDS_pept        421737..422099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0438"
FT                   /product="translation initiation factor 1 (eIF-1/SUI1)"
FT                   /note="PFAM: translation initiation factor SUI1; KEGG:
FT                   pai:PAE3340 translation initiation factor SUI1 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07871"
FT                   /db_xref="GOA:A3MTA4"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTA4"
FT                   /protein_id="ABO07871.1"
FT                   /translation="MEIKLPGQDAEDIIDQLLGGGEDTALMQTITKEKALIRIRLENRR
FT                   GHYVTIVDFGNSDDAKQLGIKDLARELKKRLAAGGTIRDSWIEIQGDHRHKVKKLLVEM
FT                   GFKEENILIDEGVTET"
FT   gene            422137..422391
FT                   /locus_tag="Pcal_0439"
FT   CDS_pept        422137..422391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07872"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTA5"
FT                   /protein_id="ABO07872.1"
FT                   /translation="MATLCLELLEATEWLEAWRKIDKLAQSSGEYVLAKFLASAYALAN
FT                   DGIYGALSPMTREFLARDIVVCLEKASQVLESQLFSQPL"
FT   gene            complement(422386..422922)
FT                   /locus_tag="Pcal_0440"
FT   CDS_pept        complement(422386..422922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07873"
FT                   /db_xref="GOA:A3MTA6"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTA6"
FT                   /protein_id="ABO07873.1"
FT                   /translation="MKEVGVVGECIAAEALRQRGLRVFKPGEFVRALELAAVYHSLEGQ
FT                   CAAEPPRPLAYTLATPYGYVKVGYWRGRCLEGLPDATPLEASAYAPCVKKCIEAELGSL
FT                   LQALSRHIHLLAYRRALATVDLFAEKDGEIYAVEVKTNTGRLTEAQREKAEALELKHLL
FT                   VRVHIQNPIVEIRPL"
FT   gene            complement(422919..424808)
FT                   /locus_tag="Pcal_0441"
FT   CDS_pept        complement(422919..424808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0441"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: pai:PAE3343 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07874"
FT                   /db_xref="GOA:A3MTA7"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTA7"
FT                   /protein_id="ABO07874.1"
FT                   /translation="MDPLQPAREEFGRVVAEVAKRLGIGEVPEVERAKRFGYFTARFHK
FT                   YKVDPGQLKAAAEGDWGLEYLQWVSADGLYLNAELNVARLAGLVFDAVAEMGRRYGSDV
FT                   CPGGSFLVEHTSANPVHPLHIGHGRNAILGDSLARLLKFCGAKVETHFYVDDCGVQVMY
FT                   AAIGYRAVRKEAAEAVARGAKPDLVVGYIYSATNAVAEINRLKKELTAAGEEEKKREII
FT                   AQIDEWVAVLKRLMDVEGGLVNKVVEVLGQRDVAQEAVELNRRYEAGDAEAREAVREVV
FT                   DLVLRGQRETLARLGIEIDYWDYESDISVWSGEAMRIVRELQRRWPQYVENKGGAVVFR
FT                   ADKFAEDFKLHEVLDLPKFIPPVTLTRSDGTTLYVTRDVAYALWQWKRGLGKVIRVVST
FT                   EQTHEQAHVRIILYALGHEDAAKNVVHYAYEMVNLPGAKMSARRGQYISLDEILDEAAE
FT                   RSAALVKEANPEVAGVIAERVGVGSVRYAFLSTGPRKPIEFKWDAVLNMRQNSGPFLQY
FT                   TYVRAYSILEKAQAPPARPEIPGEMLPEEKTLVVKVAEWPTVVKEAFQALRPDYVAEYL
FT                   DGLALVFNSYYEKAPVLKAEEPLRGFRLALVNAVKTVLEAGFYILGIPTLTKM"
FT   gene            425094..425282
FT                   /locus_tag="Pcal_0442"
FT   CDS_pept        425094..425282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0442"
FT                   /product="LSU ribosomal protein L24E"
FT                   /note="PFAM: Ribosomal protein L24E; SMART: TRASH domain
FT                   protein; KEGG: pai:PAE3345 ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07875"
FT                   /db_xref="GOA:A3MTA8"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR023438"
FT                   /db_xref="InterPro:IPR023442"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTA8"
FT                   /protein_id="ABO07875.1"
FT                   /translation="MKIHKCSFCGADIPPGYGIMYVRSDGTVQRFCSRKCFVSAVKYGR
FT                   NPRKLAWVRKKKAKTSK"
FT   gene            complement(425432..425881)
FT                   /locus_tag="Pcal_0443"
FT   CDS_pept        complement(425432..425881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0443"
FT                   /product="LSU ribosomal protein L7AE"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   pai:PAE3347 ribosomal protein L7"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07876"
FT                   /db_xref="GOA:A3MTA9"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR022481"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTA9"
FT                   /protein_id="ABO07876.1"
FT                   /translation="MAVTIDPKTFYANPLPGKPFYVRFEVPSDVAEKALEILSIARQTG
FT                   KIKKGTNETTKAVERGLAKLVLIAEDVDPPEVVAHLPLLCEEKKVPYVYVPSKEKLGKA
FT                   AGINVAAAAAVVIEAGQAAGELEALVNKINEIRAKHGLNAIPVRR"
FT   gene            complement(425913..426992)
FT                   /locus_tag="Pcal_0444"
FT   CDS_pept        complement(425913..426992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0444"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: pai:PAE3348
FT                   branched-chain amino acid transport permease protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07877"
FT                   /db_xref="GOA:A3MTB0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTB0"
FT                   /protein_id="ABO07877.1"
FT                   /translation="MFLQIDVFIRETVAIAAIYAIYVLSLNLEVGYLGLPQFGKVMFLA
FT                   LGAFAVGGIATKVALLLYGGLIQSRLGINPLANLDAYCTAYQYQAADVIKGIFLSNPLE
FT                   AVAFFLMALIIAAALAGVFGVVMSWPAIRLREDYLGILLLVSAETIRVITTYTPQLACG
FT                   VFGAVVPDPFVWMGELRPWGYALVVVLLLVLTFFVAERLGNSPFGRALRAIRDAETAAA
FT                   VFGKDIVRFRVRVLAVASALSGVAGALLAFYNNFVNMGQFVPLYTFYAWLMLIIGGSGN
FT                   NVGALVGVGIYYAADRLLSLYKEGIRQVVNVDPVFFQYMVFGIVVILVLMFMPQGVVAE
FT                   RPVKTLKRRRLEELRREAA"
FT   gene            complement(426994..427929)
FT                   /locus_tag="Pcal_0445"
FT   CDS_pept        complement(426994..427929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0445"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: pai:PAE3350
FT                   branched-chain amino acid transport permease protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07878"
FT                   /db_xref="GOA:A3MTB1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTB1"
FT                   /protein_id="ABO07878.1"
FT                   /translation="MDLFIDYPTLARAIIFSNIYALLGLGLNLTYITTKIPSFAHGDLA
FT                   TVGAYVSYFTIVFLLGGAAASVYLSLPLVVLMSGAVAVATYIAVFRPMIRRGASITALM
FT                   IASFGVHFVLFSAVAIAADYVQNTYKVLTRNVLLANYEFVWPGTDFLTSSLINTSLAVA
FT                   AVSALLYFILYRTRYGVVMRASIDNIYLAKAVGINVEAVFAIAWFLIGAVTGLAGVYMA
FT                   MFFPMTEELGWLRLALVFVASVVGGLSNIFGGLLGGYVVGLSTVLGAAYILAPLNVPIE
FT                   FQLIIPFSIVIVILLFMPQGLVSLLTKRGR"
FT   gene            427998..429353
FT                   /locus_tag="Pcal_0446"
FT   CDS_pept        427998..429353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0446"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pai:PAE3353 branched-chain amino acid binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07879"
FT                   /db_xref="GOA:A3MTB2"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTB2"
FT                   /protein_id="ABO07879.1"
FT                   /translation="MLLYTRSWASMASKAYIWVAIAVVIIAVIAAVLLMQQPTTPAPSP
FT                   TTAPATKTTATPTATTPAQQVKVVKIGALTPLTGGLQSYGIGMKNAVELAVEDANQMCA
FT                   GKGIKFELLVEDTATDPNQALQKLQVLYGKGARLIAGPMSSREVSAVKSFADQNHIIVV
FT                   SPSSTSPLLAVADWVFRMVPTDFAQAKAIADLMQKLGIKRAAIIYRNDAWGVGLKDAIV
FT                   SEAQKLGIQIVAVKGYDPDPKAFPQAMPTVVNEVSKAIGQPSPDAAVVFLTFEDDGVAA
FT                   MSAAGGDPVLSKVRWIGTDGFAYSEALIKQVGQYMAAAKLLGTIAAPDPNDPNYQAFKQ
FT                   KYKAKYGRDPVAYDPYSYDAAMMLMKIVCELGTDDPDKVKATLEQWAKEGKYSGVTGKV
FT                   YLDEYGDRAYPNYLIWGVVVEGGQPKYIDAGYYYGTDRKIVVYDQGKPLFQQ"
FT   gene            429383..430147
FT                   /locus_tag="Pcal_0447"
FT   CDS_pept        429383..430147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0447"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pai:PAE3354 branched-chain amino acid transport
FT                   ATP-binding protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07880"
FT                   /db_xref="GOA:A3MTB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTB3"
FT                   /protein_id="ABO07880.1"
FT                   /translation="MSFILTAEGVVKQFGAFRALDGVDIAVERGKVTLIIGPNGSGKTT
FT                   FVNVVTGVYKPEAGRVLFYKDGRAVDITGWPPHKVFEAGIVRTFQIPQIFLKLTVLENL
FT                   LVVARGQRGEGVLPALTRNWVKQEEELAKRAFKILKAVRLEDKWDSPAYLLSAGELKLL
FT                   ELARALMAGAELIILDEPIAGVPIDQAHEVFKTVKEINQTGTTFLVIEHRIDIAFKYVD
FT                   YVYAMASGRVISKGTPEQVANDPKVKEVYIGG"
FT   gene            complement(430268..430352)
FT                   /locus_tag="Pcal_R0007"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(430268..430352)
FT                   /locus_tag="Pcal_R0007"
FT                   /product="tRNA-Ser"
FT   gene            complement(430375..431238)
FT                   /locus_tag="Pcal_0448"
FT   CDS_pept        complement(430375..431238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0448"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: pai:PAE0606
FT                   oxidoreductase, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07881"
FT                   /db_xref="GOA:A3MTB4"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTB4"
FT                   /protein_id="ABO07881.1"
FT                   /translation="MYTNTHVKCLKRVGCVPPMGVGTFGIGGDFWHRDDSRDYHWIQAL
FT                   RRAFELGLTLVDTSELYGRGHAEELVKYASSDIRDLYIVAKIQPTAPTPEEVFKRLAAS
FT                   AERLGRRVWLAMFHWVPVGASICDVVKALEAAVEKGLANHYGLSNVTAQQLRQALTCYK
FT                   KTPPAAVENRYSLLHRRDEVDIFPIVEKEGMLYIAYSPLERGALALDPFLAEIGKRYGK
FT                   TAAQVALNWYTRWPHVVPVPKAADIKHVEENAGALGWALTEKDWELINTHYYAYRFEVA
FT                   PQRDKT"
FT   gene            complement(431249..432250)
FT                   /locus_tag="Pcal_0449"
FT   CDS_pept        complement(431249..432250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0449"
FT                   /product="Protein of unknown function DUF1297"
FT                   /note="PFAM: Protein of unknown function DUF1297; Protein
FT                   of unknown function DUF1246; KEGG: pai:PAE0608 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07882"
FT                   /db_xref="GOA:A3MTB5"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTB5"
FT                   /protein_id="ABO07882.1"
FT                   /translation="MSAALKRYDLDKLAVATVASHTALQILRGAKRYGFRTIAVAQRNA
FT                   DFYRQFSFIDEVWTADFSNFRHVAEKLVEKNALFIPHGSYVEYVGWRQALEAPVPTLGC
FT                   RELLRWEADQYKKMELLAAAGIPTPRYYKRAEEAEGPVIVKLFGAKGGRGYFVAKNREE
FT                   LAKRIKAVEGDYIIQEYVFGVPAYYHYFASPVYNRVEIFGMDIRYETNVDGRTFGWVEP
FT                   TFVVVGNLPLVLRESLLPVVHKYGVDFAKAVREKVSCELAGPYCLESIIRDDMTIVVFE
FT                   FSGRIVAGTNVYMGVGSPYSVLYFDEPMDMGERIAHEIKEAAARGILEKLFT"
FT   gene            432431..433435
FT                   /locus_tag="Pcal_0450"
FT   CDS_pept        432431..433435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0450"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: formate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07883"
FT                   /db_xref="GOA:A3MTB6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTB6"
FT                   /protein_id="ABO07883.1"
FT                   /translation="MAKYKIVVLSPAPEALLKMWATPIAQKYGIAIDEVEVVTFFEPNY
FT                   EEIGRHVADADVVVGDYTFRIKIDASLCEKMSKVRLIQQPSTGYDHIDVEACARRGIPV
FT                   ANIGGANAISVAEHTIMLALMLLKRAVYAHRRLLEGQWTQGELMNVIGEVFGKTWGVLG
FT                   MGRIGREVAVRAMALGAKVIYYDVVRNEEMEKRGAEYRPFNRLLAESDILSIHVPLTPA
FT                   TRKMIGERELRLMKPTAVVINVSRGEIVDEEALAKAVREGWIAGAGVDVFSVEPPPPDH
FT                   PLIQAAREGYNVVVTPHIAGATNEARMRIINVSLENVFKVLAGLKPDNVVNMP"
FT   gene            433432..435081
FT                   /locus_tag="Pcal_0451"
FT   CDS_pept        433432..435081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0451"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: afu:AF1780 acetolactate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07884"
FT                   /db_xref="GOA:A3MTB7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTB7"
FT                   /protein_id="ABO07884.1"
FT                   /translation="MNVAEAVVKCLEQLGVKRVYGLIGTSILDFVDALRDSKIRYISTR
FT                   HEQVAVSMADAEGRITGRPGVAAVHAGPGFLNSLISVAAAYKDVSPLLLISGAVKRRLA
FT                   GLDSWLEVPQRDIIRPLVKGVYRVDKPLEIGKVISEAYSLAASPPQGPVFVEVPEDVWN
FT                   MSSQAEKCEVKIAPPPTVPKDFVDKVAELLSKSKRPLILAGGGVNNEEGRRLLLDVSER
FT                   WKIPVAVTGNGRGAYPEDHPLFLGKVGFGGGNIVADRALVEADLVLAVGAGLSDTTTYG
FT                   YNFVPRGDIVAVNLDPLAEKKPVPYTLYHYADAVDFLKKLAALDLKYEPSVEWFREIEE
FT                   WKAAWNALLSEALSRSYKGFVNPSKFFHRLNKSLPRDFVMVGGQGMHLVYTFAFITVKA
FT                   VRGYLAAFNLGAMGFAFPAALGAKVVAPERDVYAVLGDGEFMMTVQDLETAVREKIGVK
FT                   IIVVNDNAYRVLYARQKAQKMGRIYGTLHTNPDFVKLAEAFGVEAMSISQDEEIEKAVN
FT                   FITRPTDKPLLLELKIHPDDLPPMNIDGALRF"
FT   gene            435112..435771
FT                   /locus_tag="Pcal_0452"
FT   CDS_pept        435112..435771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0452"
FT                   /product="Protein of unknown function DUF1626"
FT                   /note="PFAM: Protein of unknown function DUF1626; KEGG:
FT                   sso:SSO2946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07885"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR012431"
FT                   /db_xref="InterPro:IPR024271"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTB8"
FT                   /protein_id="ABO07885.1"
FT                   /translation="MELVEAVKKVLMENPSILVEVLVAKPEILYQALAKIAPWQLLATK
FT                   EDIRRLEEKMATKEDVKRLEERVAALERRFDSEMRRLETTITALGARWGVLSEEAFREG
FT                   VRRLLAEAGWAVEKVMLFDREGYVYGEPSEVEYDVVVKDGKTFLVEITSALKRSDLPTL
FT                   RRKREYFEKAKGVKVDAVFVVTPFIHDRVPERVKAMAKDMGIEVVYPTDTLFASAL"
FT   gene            436136..437947
FT                   /locus_tag="Pcal_0453"
FT   CDS_pept        436136..437947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07886"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTB9"
FT                   /protein_id="ABO07886.1"
FT                   /translation="MSEALEELRERLERWDELCAQLKELYYKYLDLAAFRSDKCYFPGR
FT                   KCKRSWDRQYDMGDLTLMWTYIANTAPLCGKLIRALAEVEYKIRLKALESLERYGGVEK
FT                   KSRPSNEIVNWQLRKPVYSYLVIDGEKLYVIWGEPKGVPHRGRQRSVVLERKILDALLK
FT                   IKSGIFDELHFNVFNIDHEYERLWLEVPLSESASKLLGGRDKAPVALFRSLGWLLSDDS
FT                   RVKLVHEAGNPGQVALRLFDWIALVKYATKRLVFDEDKPLVFKLAVRYITKTKIGENPR
FT                   VYIRPIGFSARVIKETYLRFGIPFGNPKAVIAHGYEVIGVLNNMAIRRHKVESVVDDVN
FT                   SWMALSATLTSLIIGDGTISPYLIRISAKAKPEGGAARELAKALKVSWHEGKVALWPRL
FT                   MKLLLPAPPTPAFKKTVKLYKTLLEYPVAVVVNIGGKKYLLNNEKGRFRIGGKKAVELR
FT                   ELLRRVGVEAGYNGRLYIKYKDLMNLAKRGFEVKFLNQMEKEAVKRVPRAVSVPDHETL
FT                   RRIFEKIAEVARFRTKTYGKHKSIVISLIDKSKFEEVLKLLEASGLRFSVYQKKKMFII
FT                   YEQTLVEAILSVVSHLFSAPSLCFSCV"
FT   gene            438229..438354
FT                   /pseudo
FT                   /locus_tag="Pcal_0454"
FT   gene            complement(438506..439663)
FT                   /locus_tag="Pcal_0455"
FT   CDS_pept        complement(438506..439663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0455"
FT                   /product="proteinase inhibitor I4, serpin"
FT                   /note="PFAM: proteinase inhibitor I4, serpin; KEGG:
FT                   pai:PAE0049 serine protease inhibitor (serpin)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07887"
FT                   /db_xref="GOA:A3MTC0"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTC0"
FT                   /protein_id="ABO07887.1"
FT                   /translation="MGAIALVLLEALSSSVGSPAAPPPRNCSPSPALNFNASGYNEFAV
FT                   EFYKRLALSHLGENFAVSPFSVYKAFAMVYAGAGGETREEIKRVFGFGEDPCEVAPAGR
FT                   GMEEATSAWLQTGATFTQQYLEKLACLCAEAHRVDFRGNFKATVEEINKWVEEKTRGLV
FT                   KDLIPSSPKRDVVAVLVSALYFEAGWWPRSFSRVGEGSFAGAAHPVEYMALDLRSCGDP
FT                   SLVGKIEDNITVVKLPLKNTETAMYIVVPLDFKAYVASLNYEKLREDLSNLTAEVVYVK
FT                   MPIFVAEFKGSVKDVLKEMGIIRAFDPSKADFSPMDGSRDVYLSDVFHGTYVKAYENGV
FT                   VAAAATAVEVAVCAKVGGAEVVVDRPFLFVLADDRVIYFIGHVVG"
FT   gene            complement(439735..439971)
FT                   /locus_tag="Pcal_0456"
FT   CDS_pept        complement(439735..439971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0612 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTC1"
FT                   /protein_id="ABO07888.1"
FT                   /translation="MAKYDLDVVARILLSLLESPKGRTALYMRTGLNYPRFLQYLDFLK
FT                   DRGLVAEVDGSVRLTERGKEVALALAKALEDLT"
FT   gene            440871..441926
FT                   /locus_tag="Pcal_0457"
FT   CDS_pept        440871..441926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0457"
FT                   /product="protein of unknown function DUF1130"
FT                   /note="PFAM: protein of unknown function DUF1130; KEGG:
FT                   pai:PAE0614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07889"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTC2"
FT                   /protein_id="ABO07889.1"
FT                   /translation="MVVYTVGYSAFTPEGLLAELKRRGVEVVVDVRRFPRSKMRGFSQG
FT                   ELEELLKGAGVEYLWMGELGALGVRGVRAGCSQSPTFDAYVWRLYRYGPAILSLEELNK
FT                   LAAERTAALLCKEEDWRHCHRQFIADYLAARGHTVVHIRKGGREEPHVPTPCYSVLQPP
FT                   PVELVARAAGDFAHLCKTHSVYLFGGALYNSGGDIDVVAYGEPAGELPQGYDAQTIPAP
FT                   RPDLFHLFVTRGVLLCGKPLLVDPREALENELREAEALAQYFREGTHPVLVCKAAKRLV
FT                   FLAAVLKCGLWADTWQKATQCLGEVPGVFKDCLSPPPLEEMRRHSHFVEKLVALINERR
FT                   KAGALSLPGGL"
FT   gene            complement(442275..443354)
FT                   /locus_tag="Pcal_0458"
FT   CDS_pept        complement(442275..443354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0458"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: pai:PAE0616 metallo cofactor
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07890"
FT                   /db_xref="GOA:A3MTC3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040088"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTC3"
FT                   /protein_id="ABO07890.1"
FT                   /translation="MRLVFGRHLVEIDGSFPQVGTLAFGIVDRGTNVVEVRPTTVCALS
FT                   CVFCSVNAGPGSRVRWVEYVVDVGALLVALEEVVRFKGVDDVEVHIDGMGDPGNYPALA
FT                   ELVAGAKAIRGVALVSMQTRLFMLGEEGLRALASAGLDRLNVSIDALDPELAKRLAGAP
FT                   WYNVERVVELVKKALDLGINVVVSPVWIPGLNDGEMAKIARWAAEAGLGRGLTPVLIQK
FT                   YVPHKRGRKVKVRPMGWGEFWRRLRELERETGVPLVPRPGEFNIHRAPELPKPYKVGEV
FT                   VSVEVVERGIFKGEVLAVPVAKRGTAVWDRTLTVAVGRGAEELLGARVKVRILENEHNI
FT                   YIAAPVGRRLPPQAHYSGE"
FT   gene            complement(443397..443675)
FT                   /locus_tag="Pcal_0459"
FT   CDS_pept        complement(443397..443675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0459"
FT                   /product="HTH DNA binding domain protein"
FT                   /note="KEGG: pai:PAE0567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07891"
FT                   /db_xref="GOA:A3MTC4"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTC4"
FT                   /protein_id="ABO07891.1"
FT                   /translation="MHRDKAVGIGLLVVGIVGILLYGWLVFFSPWSAFVIQLTAFVAVA
FT                   AVLGILAWVGYALATTPPPKPIEEIEKEIEEELKKLEQEAKSGQSTS"
FT   gene            443797..444435
FT                   /locus_tag="Pcal_0460"
FT   CDS_pept        443797..444435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sai:Saci_2135 DNA repair ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07892"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTC5"
FT                   /protein_id="ABO07892.1"
FT                   /translation="MASDLKRQFLKLLEEDEEFRYAVAGRLGILEVLKRLDAIAEEQKN
FT                   INRNIENINQKIEKTWEEIAKIWAQIEKIWKEIKDMKKTLNRVEKTLEHITISIEEEAQ
FT                   EAVAWLLSQRGITMEIGDVKVDEKYEFDIYGSNGQITVVGEAKTRASPRAVGKLLERVE
FT                   KAKKLRPDIFKGRVVPVIYCLKYVGNPKEAEERGVWVIKSGKELTKPPL"
FT   gene            444617..444811
FT                   /locus_tag="Pcal_0461"
FT   CDS_pept        444617..444811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE1943 paREP5"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07893"
FT                   /db_xref="GOA:A3MTC6"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTC6"
FT                   /protein_id="ABO07893.1"
FT                   /translation="MDEDVYYVISFSLTIIGMLGVALYWLGGKFKKLEKRFEQIDDNMG
FT                   SPSEKKGKPAVGCPPTRSG"
FT   gene            444787..445155
FT                   /locus_tag="Pcal_0462"
FT   CDS_pept        444787..445155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0462"
FT                   /product="HEPN domain protein"
FT                   /note="PFAM: HEPN domain protein; KEGG: pai:PAE2550
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07894"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTC7"
FT                   /protein_id="ABO07894.1"
FT                   /translation="MPTYEKWIERAKRYAALAREMATRGFYPEACLFAQQAAELYLKGL
FT                   LIKATGARPYTHSILHLLRSYLALSGREPGEEETRCAKLLTEHYLGARYPDARMLEYDD
FT                   KDAEECLRCMDAVLNAAV"
FT   gene            445142..445525
FT                   /locus_tag="Pcal_0463"
FT   CDS_pept        445142..445525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0463"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: pai:PAE2551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07895"
FT                   /db_xref="GOA:A3MTC8"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTC8"
FT                   /protein_id="ABO07895.1"
FT                   /translation="MQLYRQIFLKAAQEAEEWIRRLCEAGYTVILFGSRARGDARIDSD
FT                   WDLLVVGKDPPPEPPHDLVQVVFLKPEDVEPQIEKFNTLVIDALYEGKLICGPKDLYHK
FT                   WRETTLRKTANYAKTPQGWLPRS"
FT   gene            complement(445522..446076)
FT                   /locus_tag="Pcal_0464"
FT   CDS_pept        complement(445522..446076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0464"
FT                   /product="PaREP1 domain containing protein"
FT                   /note="PFAM: PaREP1 domain containing protein; KEGG:
FT                   pai:PAE2716 paREP1"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07896"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTC9"
FT                   /protein_id="ABO07896.1"
FT                   /translation="MEEAIERPLPKPSSADYASARLLEALVEARLALEFLRRGLTRNAA
FT                   GKAFQAWRAVLAALLRLELDRLKTLAKTEEERRWLEERAVPRVPTTKMIPLSQMLEQLG
FT                   YEDVTYITYGALNLHDYQYHGPDPDMALSKYRTREEAAAAVKSLVKAVIRYIERLKSGV
FT                   AWTEEHERAYKALVEEVGGLR"
FT   gene            complement(446479..446637)
FT                   /pseudo
FT                   /locus_tag="Pcal_0465"
FT   gene            447464..447961
FT                   /locus_tag="Pcal_0466"
FT   CDS_pept        447464..447961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3076 P.aerophilum family 1964 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07897"
FT                   /db_xref="GOA:A3MTD0"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTD0"
FT                   /protein_id="ABO07897.1"
FT                   /translation="MWIGIALAQIKEFGERGTFPVYVVYGPEGCGKTAFLKQAKAVLEE
FT                   EFGYHVIYASPLADDAKEILYTPSIREIVEEVLKAPPDPRLKLVDVVVAIVKRVVRKVR
FT                   RPKIAVLMDDVFQAVGLDEAERYTKTLLNLIEHPPEKYEKSSSSSPPARALHGSAWDGT
FT                   AG"
FT   gene            448088..448444
FT                   /locus_tag="Pcal_0467"
FT   CDS_pept        448088..448444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1271 P.aerophilum family 1964 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07898"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTD1"
FT                   /protein_id="ABO07898.1"
FT                   /translation="MLFKRQWDTGQVVKWLIASKGLGDVLPVLSRVKLEVLREAVEDPD
FT                   VILERIREREVQELRDLLVEKNLIVRVWDRDQYPWVDTPPPERDPELGIGKHYAWQTPL
FT                   HREAVRRALETLRD"
FT   gene            448526..448885
FT                   /locus_tag="Pcal_0468"
FT   CDS_pept        448526..448885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0438 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07899"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTD2"
FT                   /protein_id="ABO07899.1"
FT                   /translation="MPSPPVLHRLLAVRSLALRRGVWFRVRPAARALIDAVILHLRRGG
FT                   RVKSPALLEAVRRAVEEVVALAAPLRVKAKALGYAIAAKLGITVDEEKAIALGIQWINT
FT                   PKRYRGEAPPIFTWL"
FT   gene            449036..450052
FT                   /locus_tag="Pcal_0469"
FT   CDS_pept        449036..450052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0469"
FT                   /product="Protein of unknown function DUF1245"
FT                   /note="PFAM: Protein of unknown function DUF1245; KEGG:
FT                   pai:PAE0356 P.aerophilum family 1964 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07900"
FT                   /db_xref="GOA:A3MTD3"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTD3"
FT                   /protein_id="ABO07900.1"
FT                   /translation="MKRIKLIFAGRDVEFTDRDVALEQIAKLAERGTYTVHVVYGPEGC
FT                   GKTALLKQAKAVLEEEFGYHVLYANPLAKRTEEILQYSPSARELVEKAFSVFSDPLAKA
FT                   VDLVINVAGWIIQKFHKAKVAVLMDDIFQAIGVENAEAYVKALLNLIEWPPAEYDKIVV
FT                   LVASSEGITRERVGRHRWATIKVMWNMSKDGFRQLYDVLPDPKPPFDDVWRWTGGNPDA
FT                   LEGLFEAGWDVERVVEDLAVDKGLSAAFAERWRAHLAKALEDPDYLWEEPEAEGLAKEL
FT                   VEKNLVVLLKGRRPDAWVDQPPPERDPELGIGKHYAWQTPLHREAVRRALEQAQKSA"
FT   gene            450129..451169
FT                   /locus_tag="Pcal_0470"
FT   CDS_pept        450129..451169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0470"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: tko:TK0019 predicted
FT                   ABC-type transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07901"
FT                   /db_xref="GOA:A3MTD4"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTD4"
FT                   /protein_id="ABO07901.1"
FT                   /translation="MGYVKGLEVEGYRGLRKASLTDFAGINVFVGKNGSGKSSLLEALY
FT                   IALKPFDGLKHVVKRRGWFGLASAEALFHGRDSEIKIRITLEDGSWEEVIIRRSAPTVG
FT                   HIEALKAKGLDASKLYALSISAKGKVAGDATFYVDPSGKCLTLFEKGEGMVYGATFIDW
FT                   NSVYSYGTPEEAYSTMVKEGGEEAKEAVIKTLQAEYEELRDIAVLRAYDEWVLHLTFKD
FT                   GAVPYYVAGDGIRYALMYLMAVSTPKEAVLLMEEPELHAHPRLMKIVANSILHTHRERR
FT                   NQVFLSTHSLELIEMLIEQAEKLGLKDQDLKIYRLALKNGVLYSKVYTLSEALDAVKKL
FT                   EWDLRR"
FT   gene            451181..451882
FT                   /locus_tag="Pcal_0471"
FT   CDS_pept        451181..451882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07902"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTD5"
FT                   /protein_id="ABO07902.1"
FT                   /translation="MILLTEGLVEEIVYSSMLEKLYGGRQVECEDAPTPLEALIDPLIR
FT                   RAKCYTLEHGDLIVIVNSRGYENLRNTIRQLLTQPELPEALGQLDLRIAVAADRDKNPT
FT                   ESIRGVLSSMGLQATGGDTLTVELGNGAKLAIHVIEQGGEGDTATGEIEDELRKLVETL
FT                   KPELQHAAKKVEEIYGPLTDKQKLLIYLALLERKPKIRELYELFREAVAAASRDAIEHL
FT                   GLAKGLGKALG"
FT   gene            451894..452991
FT                   /locus_tag="Pcal_0472"
FT   CDS_pept        451894..452991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0472"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   pai:PAE0419 glycosyl transferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07903"
FT                   /db_xref="GOA:A3MTD6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTD6"
FT                   /protein_id="ABO07903.1"
FT                   /translation="MLLEAIAIALTAAHFGAPLLYYWRAKRWLKKPWDVAPDPTYRPRV
FT                   TVIVPTYNEAPLIEEKLDNIYEQDYPRDKLEVVVVDSASTDGTPSAVRRWAETHPDLAL
FT                   TLVEETERRGKAHALNTALRHATGEIVVITDADALWPARDTLANAVKWLADPTVGAVSC
FT                   VKRPAGPAGVEDSYRDFYNVLRVAESKAWATPIFHGELAAFKRELLERLGGFPTDVGAD
FT                   DSHTATKIAMMGYRAITPPDVVCVEAVPKRGYHAWRIRRAQHLVQHFAKAIRDGKAPPP
FT                   FKPILHAEAYLHLANPWALPTAAAALAAAAAAGSLPAAALLATGAALALYKPYRTWTTM
FT                   QAYLIAAAVKNLWDKELVWEKQEKR"
FT   gene            452996..454066
FT                   /locus_tag="Pcal_0473"
FT   CDS_pept        452996..454066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0473"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   pai:PAE0430 glycosyltransferase (type 1)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07904"
FT                   /db_xref="GOA:A3MTD7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTD7"
FT                   /protein_id="ABO07904.1"
FT                   /translation="MRVVYAAPTYHPHVGGVEYVVKAVAERLAKRGHEVVVLAGEPNAE
FT                   RPAEEEVSGVHVVRWPTWTPGGAYHVPRHRARLEEALRELLRGADVLHVHSIHAILPVW
FT                   AGLKARELGFRGRLVASTHYHGTGHTPLRRALWALWRRYAARLVKAADVVHAASAYEAK
FT                   LLEEHFAVRPTVVEHGVDEDVAEVQWTPRDYAMYSGRLEKYKNVEKLAAVVKALSRLGH
FT                   KLRLEIYGEGPHRPSLEKALRRIGVDYSIYGFQPRRRYLEKLAGAALFGLLSTHEAYGQ
FT                   TANEANAIGVPTLVAKPWGEHFAARPRTLAVDPHEDAEKIAKKAARLIEEAPRQPRPRV
FT                   PTWSQTVDTYLKLYTP"
FT   gene            454068..455384
FT                   /locus_tag="Pcal_0474"
FT   CDS_pept        454068..455384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07905"
FT                   /db_xref="GOA:A3MTD8"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTD8"
FT                   /protein_id="ABO07905.1"
FT                   /translation="MRRLALAVAAVAAAAPYLYLYVTAYAKFFAHYRGALIPLGDDYPM
FT                   HVYFALQFCHDPATVMQGQYPGLLHIAASLPCDLWKTATALSTMAILLIPLAVAAWGLV
FT                   YRAVGAGKWAWPLAALAVLSQPRLLQSVGDGQLPEKYTLLVILPAAAYLWLRGRRAAAG
FT                   AVAGLAAWTSYLGATYVALFALATLSPTLAATAAAVAAAGWPRVQTAFTTAAEAAGGPA
FT                   LIPYMDPIRASFYVYFNPIALPALAAAALWLAAKKPRTLPLLATALALWAAAFALPPLN
FT                   ERLARAAGFLLTASTLAAAWEKDRRVLAATALLIAAGPAAAGWAWAAAHIAPVPYGEQL
FT                   LQYGLFQPAVRTLPCKLDAYQEIAKEIPRGATVSVAWQLDLWLLPYLYQTRPDVKVNVT
FT                   VCPWDMEGLRVVSGLVPGSWYLPCYSGWPTGPCNVTLVR"
FT   sig_peptide     454068..454130
FT                   /locus_tag="Pcal_0474"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.412 at
FT                   residue 21"
FT   gene            455381..456337
FT                   /locus_tag="Pcal_0475"
FT   CDS_pept        455381..456337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0475"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   pai:PAE0431 glycosyltransferase (type 1)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07906"
FT                   /db_xref="GOA:A3MTD9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTD9"
FT                   /protein_id="ABO07906.1"
FT                   /translation="MRVLAVVEDWPDRGGGLLATELWLKAACREVEVVVVGPRPFPPCP
FT                   HLPHPLPHQRPKLWLTRPRVDLAKFDVLYIPRYAYHLIPAAKRLGLRAVVHMHGYPTYL
FT                   STGQPHDWRYETATVKRLYAAAAAKAVETLIDKWLRQADAVICVSRAHCARLEKYRVVY
FT                   VPNPPPPVPQISAPRARRFVYPWGPRPFKGPHIARAVAKALGTELVETGELSRGEYYHV
FT                   VATSKALLAPALWDEPYGYAVVEAMMLGTPPVAFARGAIPELVEGTEAEAYLAHNLAEF
FT                   AKAAKKALEEPPPPKLAKEAREKFRTELDRFLKALMG"
FT   gene            456334..457344
FT                   /locus_tag="Pcal_0476"
FT   CDS_pept        456334..457344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07907"
FT                   /db_xref="GOA:A3MTE0"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTE0"
FT                   /protein_id="ABO07907.1"
FT                   /translation="MTWDATLALLWFLAPEAGRALSPRDPAKAVALGLAALAASLAFPP
FT                   AALLIIVTKRHRPDPWFLAALKPIAVAAALGHLLPHPEPLAFAKGGVWSQYAPLTYYMY
FT                   KLAWWATPEAVALGGTAAAAAILYQALAAWRGARDAALLTLMWPTPAFQYFSHHAYTFA
FT                   AIWTAWLMWEKGRRRAWLGYTALATAFHTIMGPLAAAPLLKRRAIQALAALWAIYFAIR
FT                   GAWPIGDVVAGAAAALADPSRLAAGAIALLDSLPTLAALPTYLYILATAHRGGIYYAVA
FT                   LLGIAIAALTAAHVPPSVARGYISRFIFLALPFAGTAAWPLGLAAYIYQASLTAV"
FT   gene            457341..458657
FT                   /locus_tag="Pcal_0477"
FT   CDS_pept        457341..458657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07908"
FT                   /db_xref="GOA:A3MTE1"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTE1"
FT                   /protein_id="ABO07908.1"
FT                   /translation="MTERVAKTGFHIYGQSIAFAIGGGLYWIIAAALVGPAEMGKAAYV
FT                   VSLAALASTTAGLGLDSAVLKMQPRDWGAMYTATALYLALSAPAAAVAAYVAWQSLGLP
FT                   GAIAAAVLALSWLSNIYTSAVVASFNAQRLPLYAAASIAARFAVTFAALGAGWAAVAYG
FT                   YAAGSALYLALTAATAAALWGRPRRLGEFREVAKAGLSAWPSQLVAAALMGGGTALAFS
FT                   KAHEAAGAYYLAYTVATVAVGLPSAIARAAIPYFAATGSPAERVAAVTAYVGAPFVAAA
FT                   VAAPTQILALIRQDYAAGGPDLAALAPALWLNAVASVHLNKKYADGRYATYALAYAAFG
FT                   ATLAVASAYIGYGPAALAASAVLYALSGAPLRHLALLATAAPAPLLGAALPWPAAVAAA
FT                   FLLSLAASAPLVGAEERRIVVELAPKYLKPLVKRLTWTA"
FT   gene            458645..459760
FT                   /locus_tag="Pcal_0478"
FT   CDS_pept        458645..459760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0478"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   pai:PAE0437 glycosyltransferase (type 2)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07909"
FT                   /db_xref="GOA:A3MTE2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTE2"
FT                   /protein_id="ABO07909.1"
FT                   /translation="MDCVTLVIPTLDEAEAIGKVIEEARRAGFTKILVVDGGSRDGTPQ
FT                   IAAEKGAVVIGQRGRGKGDAIATALDYVDTPYLVVIDGDYTYPPEEAAKLVAYLRHYDL
FT                   VLGARQGPMPLIYRVGNWLLARAISLMYGVRLRDPLTGMYAARTEVLRRAAPTAQGFDI
FT                   ETEIIAKAVEQGASVREVPIQYRKRLGRKKLKPWHGLHILWRAVRAAYTANPLLALYLA
FT                   GALLAAPGLALGGWVAYRLFYQGVPHYMLGLLALGLLLLGLVSLALAPLAAAVVRLRAQ
FT                   IARATPRQEPTDCLPPLPPPPPPQPRRRPTIWDRLEATARGLTIAFAATLSAAAYFLAV
FT                   GDTPTANKLAEYAYYFLAAATVIYLAVAAKQ"
FT   gene            459757..460272
FT                   /locus_tag="Pcal_0479"
FT   CDS_pept        459757..460272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07910"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTE3"
FT                   /protein_id="ABO07910.1"
FT                   /translation="MSWRLTATVAITATLIALVAALLPPTDLLTQLRSATYTAHYPWGL
FT                   VAADGSHAYAELGPYRVALNLWKIVICDGGCTSQNINAIQLYAQLKAQGQLVIEDRGGG
FT                   CYHAQLKPTQLAGRVVAADVTFCLQRGIPTRIDGTVTIDGHEIRLGGEPHIEPTFPMDK
FT                   YLEIHEKT"
FT   sig_peptide     459757..459819
FT                   /locus_tag="Pcal_0479"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.322 at
FT                   residue 21"
FT   gene            460296..460658
FT                   /locus_tag="Pcal_0480"
FT   CDS_pept        460296..460658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0438 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07911"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTE4"
FT                   /protein_id="ABO07911.1"
FT                   /translation="MPSPLVLHRLLAVRSLALRRGVWFRVRPAARALIDAVIIHLRRGG
FT                   RVKSPALIDALKRAVEEALSLAAPLRVKAKALGYAIAAKLGITVDEERAIALGIQWINT
FT                   PKRYRGEMLLTWTVAP"
FT   gene            460640..461605
FT                   /locus_tag="Pcal_0481"
FT   CDS_pept        460640..461605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0481"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   pai:PAE0439 dolichol-phosphate mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07912"
FT                   /db_xref="GOA:A3MTE5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTE5"
FT                   /protein_id="ABO07912.1"
FT                   /translation="MDSGAVGGIEVSVVVPTYNEEKNIGTLLRALDEALHGIPYEVVIV
FT                   DDASQDKTIEVANATPISGHLVVYRKPKRTGKPESLAIGLKVARGRYISFLDADLEYPP
FT                   KAIAQMYHEALETNADIIAAARIDKRPLHRRVISWGAKLLAKLMIRELRRLRDPTTELI
FT                   LAKKEALVKVGFEKYAKYIKPITAALRHTAKLGYRIAEVPVEVTPRQHGSSSFKTKWIT
FT                   AYLKELMDLTDWLIPKYIAIALVAALIAHVLNPAIGIASLAMSLAIRYIPLRRLINPLG
FT                   LITAEATSTALKIASASLIGLPLAWLIASALEVALVMWLR"
FT   gene            461605..462423
FT                   /locus_tag="Pcal_0482"
FT   CDS_pept        461605..462423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07913"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTE6"
FT                   /protein_id="ABO07913.1"
FT                   /translation="MGRYGGKPTPPEIAYIDEKAIATYEPYVVPVIWAPEAPTPEAAVV
FT                   TIDGTRGLFAFNNSGCPRNPAVVQHLKKKIERVRRLGYSLAVLDELNYPTPHDGELFYS
FT                   CFCQYCLTHSPRLKMLKKGDLQGLAEVRKDLVRSVLREVAQYAEGLGLRLEAAVHAPTI
FT                   AHLAGQDYHTFLRHVDRLQVMLYRKCPGPACLNRELAMLARFGYNPYGIDPDAVEKAGV
FT                   PIRVLKQEAQKARELAGERAIPILWADEKLPEAIRAVEEVGFEEVIIFTP"
FT   gene            462420..463532
FT                   /locus_tag="Pcal_0483"
FT   CDS_pept        462420..463532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0483"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG: CapM
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07914"
FT                   /db_xref="GOA:A3MTE7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTE7"
FT                   /protein_id="ABO07914.1"
FT                   /translation="MRILWLNWRDIKHPLAGGAEVYTHEVAKRLAARGHEIILVTSRPK
FT                   GLPPREEIDGYTVIRRGGKYTVYLEARRLYHQLKKEGWRPDVVIDEINTVPFLTPKYVK
FT                   EPIVALIHQLCKDCWKYAVHPLAQPLGWWLEQRLHKPYIQAAKRGNLKVITVSPSTAQD
FT                   LYDLGYPPYAVAIVPNGLDWELYKDCNSQKRDLVTYVGRITPYKRLEDLLKAWKTVEKS
FT                   YDAELIIAGRADPRYLARLTKLAKRLDLSRVNIKANITQQEKKALLAEAKLLVYTSVRE
FT                   GWGQTILEAAACKTPSVVYNVPGLRDAVKHMETGVIVKPGNIEELAKTIVLVMTEEELG
FT                   KRLGEMAYLYAQTFSWDFTAKLFLKEINTS"
FT   gene            463536..464441
FT                   /locus_tag="Pcal_0484"
FT   CDS_pept        463536..464441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0484"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   cps:CPS_5020 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07915"
FT                   /db_xref="GOA:A3MTE8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTE8"
FT                   /protein_id="ABO07915.1"
FT                   /translation="MQNKEGVTIGIPVYNEEKNIQRLLKSLAIQKNVNIDQTIIVNDGS
FT                   TDNTTAKIHELNTSIKNKLNLHIINLEKNMGKANALNIIFNKANSEILIILDADVILIK
FT                   SNTLEELLRCFQMDKNIGLVSGWYIMEPLKSTNIIARAYRFSNILLENLSKKKPLYSAT
FT                   GAIMALHKSIYKKLSLPHNVVRDDAYIYLYTVKNGKKYVFCPNARVIIPIYEKMTTKTF
FT                   LYRQLRATRIPKVFVKEFGQIAIDELKINPSIAIKSFIKSYIKQPFDGTIYLILKVVSS
FT                   IYKRLSTNTSVRIHWKNYEK"
FT   gene            464443..466566
FT                   /locus_tag="Pcal_0485"
FT   CDS_pept        464443..466566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tko:TK1725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07916"
FT                   /db_xref="GOA:A3MTE9"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTE9"
FT                   /protein_id="ABO07916.1"
FT                   /translation="MIILLLYIFISLIPLVLIYYDNDFRIVIFHDSPYPLNSKELAYLF
FT                   FYIWRDNFNFGIADVTGIPLSLFYLFIYILETITVDKALAQILLLFILNLLALYSIYLL
FT                   AKDIGLNNSLALVASLLYSFNPYSLYYCWRIFNTNIFLYSVFPLYILSINKIYRDKKYK
FT                   YVVLILISTVIAYPSFTNPAFFLSLFVALLIYLLTLSVLIKKSLIETFATFIIIIFPIF
FT                   TLTFPVYTNLYFAVKENNIFTKDVIHSLVKIYEFNTHNVTLLNLFTLTAMPPVYENIEW
FT                   YPFQDLYKTNNFTIALGLFIVFMLTLSSIIQKNRLIYDLLPYISLFLFASFFTFNNEFG
FT                   HYIFSNLINLLAPWRDPYHKLGFIIALSLSLIFSKSLQLLIKLFAKNNYIRLFIYLLVM
FT                   PILLFYLFPFFTLNFIPESLTYENTIITPFTQVIYDYSRVIEILKNDNSFNHSIDRILV
FT                   YPFTNTLWCENGYLGSDILRLYGFNTISTLSHTNSLESIKFLENILENVTVIRQSNFVD
FT                   IISRLGVKYILIRKQTCQRYLVDRAIVIKTILENKSNIIKVLETERFALFKIKNATVSR
FT                   FAILTTTTTEDSNLDILNVLLTSRAVVASKVDPSTWELNVSSDTPFYLIFANSYDQYWE
FT                   AYIYKNGTLVRTIKPISFYGIFNAFWINETGNLYIVVKYKLQEFFILFLLISFIFLSIF
FT                   IFFIFHIKGDPLQ"
FT   gene            466638..466808
FT                   /pseudo
FT                   /locus_tag="Pcal_0486"
FT   gene            467122..467976
FT                   /locus_tag="Pcal_0487"
FT   CDS_pept        467122..467976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0487"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   pai:PAE0446 glycosyltransferase (type 2)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07917"
FT                   /db_xref="GOA:A3MTF0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTF0"
FT                   /protein_id="ABO07917.1"
FT                   /translation="MTEPLVSIIIPTRNSEKTLPLCLRSIEKQTYKNIEVIVVDNYSKD
FT                   KTVEIAKSYGARVYFKGPERSAQKNFGALKAQGDYVYFIDADFVLHARVVEEAVSLAKE
FT                   GYDAVVILNISDPRPSLVAKIRFYERLSYYGSEMYEAARFIKKDLFLKVGGFDIRLYAN
FT                   EDYELHQRLLRAGAKIAKTKNSFEIHIGEPSSIKEFIIKNLYYASNISTYFRKNPNIRH
FT                   MTPLRPTFFRKSFIGHLGRKWLPGLFLVILFKVLQATVIGLGILIKSNVLPYENIQKLR
FT                   RVI"
FT   gene            468158..468403
FT                   /pseudo
FT                   /locus_tag="Pcal_0488"
FT   gene            468503..468773
FT                   /pseudo
FT                   /locus_tag="Pcal_0489"
FT   gene            complement(469645..470016)
FT                   /locus_tag="Pcal_0490"
FT   CDS_pept        complement(469645..470016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0490"
FT                   /product="paREP15, putative coiled-coil protein"
FT                   /note="KEGG: pai:PAE0506 paREP15, putative coiled-coil
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07918"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTF1"
FT                   /protein_id="ABO07918.1"
FT                   /translation="MDAAASIAIETAVKHVMEKIKRGKKLTTEDILILYLGSISEDVRA
FT                   MRAEATEREKALREEIAQLRREMYARFDATDAKFDAKIEELRKEMNAKIDALYAEINRK
FT                   FDELYRLLITALTQKRQES"
FT   gene            470998..471537
FT                   /locus_tag="Pcal_0491"
FT   CDS_pept        470998..471537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0491"
FT                   /product="PaREP1 domain containing protein"
FT                   /note="PFAM: PaREP1 domain containing protein; KEGG:
FT                   pai:PAE0422 paREP1"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07919"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTF2"
FT                   /protein_id="ABO07919.1"
FT                   /translation="MEQVIERPLPKPTSADYASARLLEALVKAKLALDFLERGLTRNAA
FT                   GKAFQAWRTVLAALLKLELERLKALAKTEEERRWLEERAVPRVPTTKMIPLSQMLRVLG
FT                   YRDVAFITDRALNLHDYQYHGPDPDMALSKYRTREEAARAVVELVSAVVDYVERLRDKC
FT                   AGCEELLGDLREEVAR"
FT   gene            complement(471693..472382)
FT                   /locus_tag="Pcal_0492"
FT   CDS_pept        complement(471693..472382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0906 paREP7"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07920"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTF3"
FT                   /protein_id="ABO07920.1"
FT                   /translation="MEPALKRQLLKLLEEDEEFRLAVAGLLGLREILEELRKLREDFNT
FT                   LIKEQAKRWEENERRWRENEKRWEENEKRWEENERKWQENFRRWEEADKKFKWIMAALG
FT                   EIRDSLGGAFEYYTANVVKALLAERGIICGIRVNVTLPVDGYREVDIFCPDPLVVGEAT
FT                   TSLKTVEEAEREVEKLLSAAEAAEKFTGKKTYLKVLAVENAPTEVVQHLQKRAKELEIY
FT                   LIVGREY"
FT   gene            complement(472412..473704)
FT                   /locus_tag="Pcal_0493"
FT   CDS_pept        complement(472412..473704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pab:PAB1420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07921"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTF4"
FT                   /protein_id="ABO07921.1"
FT                   /translation="MVPISTHVRQRACEEVHSRIPRERSPRGKKPRELRIEKVKNKATC
FT                   IVGPRRAGKTYYLFSLIKKVEDYLYVDFENPVFYNASPKDIITIVDAYKELYDRDPIVL
FT                   LDEVQNVPDWERMVRYLLDKGLEVYVTGSSSKLLSKEIATHLRGRSLTYRLLTLSFREF
FT                   LTFKGIDFRGRNFYKNYNRIRGAVEEYLHYGGYPEVVLSQLKERILKEYLELIIKKDIL
FT                   ERFRIRNIPLINELIYYTLNNYAGHTSYDSLYRLLGQRTAATKRTIINYLSHLEDAMYI
FT                   TLLRRYTPSLRQRIAAPRKIYLIDTGYALFGQKDVARDMENAVLLELLRRHEPPAEIYY
FT                   FHTKEGYEVDFLVKQEGRIAQLINVTYAKAYDEVDRREIRALLHAYEQFKQDNPQLTII
FT                   TWDYEDQREHTWYRKRGVVTYVPLWKWLLNT"
FT   gene            473780..474169
FT                   /locus_tag="Pcal_0494"
FT   CDS_pept        473780..474169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1870 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07922"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTF5"
FT                   /protein_id="ABO07922.1"
FT                   /translation="MELLAWLWRRVEWGRLGVRLAVVFGSILRSPRARDVDVLVFVDEG
FT                   VDEDEAALRVMEAVENAVGLEADVYVVGDVSSVNCFLLLEALRDGVIVYRDVVGLERLV
FT                   FAVGVCNDFMISRRKLGSTPTKWLI"
FT   gene            474681..475079
FT                   /locus_tag="Pcal_0495"
FT   CDS_pept        474681..475079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0495"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: pai:PAE1848
FT                   P.aerophilum family 453, possible regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07923"
FT                   /db_xref="GOA:A3MTF6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTF6"
FT                   /protein_id="ABO07923.1"
FT                   /translation="MESAEIRRRIVEYLKSVGSASVYEVAKAIGLSYGSAQWHLYVLER
FT                   EGIVFSVAKGKKRIVMLKDSLDAYIKTLKVRDFFRDFWQLLRELGIESDMDVVDALKIL
FT                   EVERREVASSILSIARNLYEARRGRGQT"
FT   gene            475103..476002
FT                   /locus_tag="Pcal_0496"
FT   CDS_pept        475103..476002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0496"
FT                   /product="protein of unknown function DUF125,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF125,
FT                   transmembrane; KEGG: pai:PAE1846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07924"
FT                   /db_xref="GOA:A3MTF7"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTF7"
FT                   /protein_id="ABO07924.1"
FT                   /translation="MESGSSSNLVLVAREAAVDEYKEYLTYSTLAKIERNPARRAVLMR
FT                   LAEQEFRHFQFWSRLAPVEPRGWLLRLYAWLMALLRLILGVTFVAKFMERGEEKAIERY
FT                   RSVEPLLSGRDLEELRQIIRDEEEHERALISQLDETIVKYMGALVLGLADAIIEITGAH
FT                   AGTLGATDSTITAGVIGLIVGIGASISMASASFLQTKHEVGKSPTVAALVTGVGYIAAV
FT                   ALMSLPYFLTHDIYVAFAASIAVGIFLTFVLTLQASVYADRDFKFEFLQTVGLLLGTAL
FT                   LTYFAGTYLGELFGIRTI"
FT   gene            476027..477475
FT                   /locus_tag="Pcal_0497"
FT   CDS_pept        476027..477475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0497"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="TIGRFAM: UbiD family decarboxylases; PFAM:
FT                   Carboxylyase-related protein; KEGG: pai:PAE1844
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07925"
FT                   /db_xref="GOA:A3MTF8"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTF8"
FT                   /protein_id="ABO07925.1"
FT                   /translation="MFSDLRDFLSALEERGWLARVREPLSPELEIPEVLRQVMYARGPA
FT                   VLFESVRGFPGWRVVGNLFGSLERIRLALGVERLEDVGRRLLAPLASPPPLTLTEKFKA
FT                   AADLFELGKYAPRLVRGGPVKEVVEERPNLLSIPAFKTWPKDAGRYITYGLLVTRREGV
FT                   TNIGVYRIQVVNESEAIVHAMVHKRAAELFGQSSGCVEAAIVIGGDPALLLSGMMPTPY
FT                   PLDEYLFAGVLRGGGVEVTRGVATDLYIPARAEAVVEGCIDVGDLRKEGPFGDHYGVYD
FT                   PGGLYPVFKARAILRREDPIYYGTVVGKPPLEDAYMGKAVERIFLPILQFLLPEVVDLN
FT                   LPEYGLFQGVAVVSIRKRYPGHGKKVMFALWGLGHMMSLTKIIIVVDHDVNVHDFNEVL
FT                   FALAQRVDPQRDVVVVPGAHVDVLDTGSPIPGYGSKLGIDATRKLPEEYGGRPWPEEVA
FT                   PDPEVAKRVRDVVAEVLGRVASRV"
FT   gene            477456..478094
FT                   /locus_tag="Pcal_0498"
FT   CDS_pept        477456..478094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07926"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTF9"
FT                   /protein_id="ABO07926.1"
FT                   /translation="MWRLEFRGGELAKVEEPALRVPPGHIALKVKAFLVDDFTLWSLRR
FT                   GGRSPSRWAFGVVVANGEVGRYVVAYAENAAAQYAASRLYVYASPDPSSLELVHVAYVV
FT                   EALNRLPRFRPVEVVGDDPRGSAVRKLAEVGKSKWRVVLQDGVVEGGVAVALSRLVEVR
FT                   GNALVRFVDVPSRRALEAAAKMRLRLGLPVVGLEDLAFDRWAIVKVEGA"
FT   gene            478122..479570
FT                   /locus_tag="Pcal_0499"
FT   CDS_pept        478122..479570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0499"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (D, K and N); nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type; KEGG: pai:PAE1840 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07927"
FT                   /db_xref="GOA:A3MTG0"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTG0"
FT                   /protein_id="ABO07927.1"
FT                   /translation="MSERQSGEKVEEWRRILDSLRKAGVEPYPHSFSPTHSIKALNELR
FT                   RQALLDPWLGAVIRVAGRVTDVRRHPNVVFLDLYEDGARFQAMADPKLPLLEHIWRGDY
FT                   VGVEGPLVKTQRGDYAVRATSITLLAKAVQPLPEWGKVDRDSPFYMRYRSVAMVLDLQL
FT                   RWRIAARARLIQAFREAMWRRGFVEIPTPVLQPIYGGAAARPFTTKVWAIDEEWYLRIS
FT                   PELYLKRYIIAGFPKVFEIGPQFRNEDIDALHNPEFWSLEAYQAYADYREIMKLTEEVV
FT                   YEAIVAVLGTPVVKYREWSINFSPPWRRITLHDALREFGGEDPEKLTDDEIKQRLREMQ
FT                   VPLKVYNRGVALVKLFEKLVEKKLVEPTFVLDYPEESTPLCKPHREKKGLVERFEAFVG
FT                   GLEIANAYTELNDPVKQYEYFVREEELFPKDEAHPLDWDFVEELSFGMPPTGGVGIGVD
FT                   RLAMIITNAESIKDVIPYPIVKRK"
FT   gene            complement(479579..481072)
FT                   /locus_tag="Pcal_0500"
FT   CDS_pept        complement(479579..481072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0500"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   pai:PAE1839 glycosyl transferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07928"
FT                   /db_xref="GOA:A3MTG1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTG1"
FT                   /protein_id="ABO07928.1"
FT                   /translation="MANITFLNITIPRDILNETLQVINKTREGPVVISNAPLLPEWLQN
FT                   TLILIYLALLLLSLLLISHYIYYARHAVRESHADPPQASGGFLSIIVPVKNEDVDTVTA
FT                   AVKRLAALPCPDAEVVIVSDDPPEKFEKLKEAVDALGLTNVRILRRPNPVGYKGVALNW
FT                   AAERARGDVLLFLDVDSVPPLDMCARARAVGDREILFLGWDGYAAVNTPIASLQLFLYK
FT                   YLLYHLAILGRFNAGHPLLALGSGIAVRKKFFEEIGGFCNCTADDYDISLRAYVHGGQV
FT                   RYTPGPPVYVEVPAGYNAFKRQYARWTYNSAYVFAKYASALFSLKMPKSHKLSLFLNVA
FT                   THPLMVATTFAIMAAGLAMGYAGILLPPIYVLMAQAALFALALAQVYYVYKIAKRDGYS
FT                   FWTVVKRMAQSASLLLILSPYLTFYVLLGLFKRRIRWYVTPKGLSALAKGALGLYEALM
FT                   AALLSMLVAIGVYLGNWVLASNSAFVLVVLAYVLLKIAK"
FT   gene            481151..481891
FT                   /locus_tag="Pcal_0501"
FT   CDS_pept        481151..481891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0501"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /note="TIGRFAM: thymidylate synthase, flavin-dependent;
FT                   PFAM: thymidylate synthase complementing protein ThyX;
FT                   KEGG: pai:PAE1837 thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07929"
FT                   /db_xref="GOA:A3MTG2"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTG2"
FT                   /protein_id="ABO07929.1"
FT                   /translation="MFILESPRVRLIGAWGSEALVSAFTDMLYRGVEPEEALKAQSADV
FT                   VERRISAFYRQGHWSVFEFMGAQFLVECSRACHTQFIRHRLASYWSESQRYVDYTKREV
FT                   RFVVPRGFPADVLKRAYEDYLALRGQYKPEYARMALPNATAVLFAVQMNARELLLNFVP
FT                   LRCAATAQAEIRHVCWQIFAHAWRLWPTLAKLVWEDLPNLHRDFCTKVPKGADCREYAI
FT                   RDAEEKHGPLPEKPWLYASPYQRA"
FT   gene            481866..482717
FT                   /locus_tag="Pcal_0502"
FT   CDS_pept        481866..482717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1836 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07930"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTG3"
FT                   /protein_id="ABO07930.1"
FT                   /translation="MRVLIRGLEAGSAYLAYLLRESGVEVDIYTSNPADPLLDIPPFEP
FT                   LFTLEFLREVLAVRFVEKPEGNYDAVVDSCDVVGFDGVKKALGDKKPTYVVGDGWLSAS
FT                   ISLHWSLPLPDVEVDVPGERTGEFQEVGIKYRLYTGGQYSICGSFRDSWGGCLYTPLRA
FT                   LERISAAVDIYASLMGLEAPKRRLRLEYAVGGGRAYVAIGCRPEGKVSKINLGDVQTWM
FT                   YGEEGGPRYVFIQAKAEHLPWVFAMYNLARAVDSAFLYDFGASGRGPLNYAYVGHLFRK
FT                   LR"
FT   gene            482824..483216
FT                   /locus_tag="Pcal_0503"
FT   CDS_pept        482824..483216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0503"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="PFAM: Protein of unknown function DUF54; KEGG:
FT                   pai:PAE1832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07931"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTG4"
FT                   /protein_id="ABO07931.1"
FT                   /translation="MALKPGFAYSVRCRYVELSVVVHATESLDKVIDLLKKAFGDLPFV
FT                   VEIYEGHHGNPIYLVTSFVENCDTLLDKLCGWFNGSIPATRGEDEGLYYLRLDKQALAA
FT                   GVVRQAFHDDVVRLKIRVKGEMCRSS"
FT   gene            complement(483188..483487)
FT                   /locus_tag="Pcal_0504"
FT   CDS_pept        complement(483188..483487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE1829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07932"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTG5"
FT                   /protein_id="ABO07932.1"
FT                   /translation="MSKRRYLIIRAADPPSCYVELLEYYLVVGFAALIEPLQLVAIYDD
FT                   VLVVGVPRDALRRVRALVALLEGCRTVRVAGTSKKAKAVAASMRRAKRSGTSPP"
FT   gene            complement(483480..484004)
FT                   /locus_tag="Pcal_0505"
FT   CDS_pept        complement(483480..484004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07933"
FT                   /db_xref="GOA:A3MTG6"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTG6"
FT                   /protein_id="ABO07933.1"
FT                   /translation="MKVVKRGFVEWDLVRVGPEVEAALWEVGVRAAVLREEAETEVIAP
FT                   FVRGVDIRWAVASGREKFNKLVYRDDVQVIEVNPQTPITRDQARAALRYGKYVALPLKP
FT                   LLKDLPLLAQWLDVLEPEATVVATGVENASDVKSPLDVAALLVEISGDENWALPIKNSL
FT                   GILTELVASDV"
FT   gene            complement(484084..484983)
FT                   /locus_tag="Pcal_0506"
FT   CDS_pept        complement(484084..484983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0506"
FT                   /product="SSU ribosomal protein S6P modification protein"
FT                   /note="TIGRFAM: alpha-L-glutamate ligases, RimK family;
FT                   PFAM: protein of unknown function DUF201; RimK domain
FT                   protein ATP-grasp; KEGG: pai:PAE1818 ribosomal protein S6
FT                   modification protein (RimK)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07934"
FT                   /db_xref="GOA:A3MTG7"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTG7"
FT                   /protein_id="ABO07934.1"
FT                   /translation="MRIGIIRPYEVEFNPGDVLDLEEAIRRRGHSAVRVYVDMLEVRMG
FT                   PSGVEVRHAVGREAPAPVELDGALLRHLGIFRDFEQFLYRVWAVRALEEAGVYVMNPVL
FT                   PWVVAGDKMAALMTLSKAGLPVPPTVVTENMFIAYRAAGEFGKAVVKQMRGAMGYGAFL
FT                   VEDPDVAFHIFSMLVNINKPMYVQKFLEKGDGDYRVVVVGKRAIGAEYRRAAGWKSNVA
FT                   QGARPEPAYLTQELEELAVKAVEVLGLDFGGVDIAETKDGYYILEVNPTMSWQGFKAAV
FT                   GINPAEHIVDLLLEKIKR"
FT   gene            complement(485006..485386)
FT                   /locus_tag="Pcal_0507"
FT   CDS_pept        complement(485006..485386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07935"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTG8"
FT                   /protein_id="ABO07935.1"
FT                   /translation="MAKVEIKEVPELRGFSTVKKVANRNALLGDLKPNTILIFHGKEGH
FT                   EMVVEIFTPDPNGDKTLPPATVASTKFTGPVEKVDNAYATLLFWALGQGKSLGTPTREV
FT                   YHKVDLKQDPPEAEVEVQAPLA"
FT   gene            485446..486171
FT                   /locus_tag="Pcal_0508"
FT   CDS_pept        485446..486171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0508"
FT                   /product="protein of unknown function DUF91"
FT                   /note="PFAM: protein of unknown function DUF91; KEGG:
FT                   pai:PAE1797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07936"
FT                   /db_xref="GOA:A3MTG9"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTG9"
FT                   /protein_id="ABO07936.1"
FT                   /translation="MYLERPSAKEAAQVVNWGKRRGIVVVVGLCEVNYAGRAAASLKRG
FT                   KRLLVVKRDGTLLVHEAEKAQPKIWNPPGSSTAAFEENGRLVVKSVRQRPFETVKVVFE
FT                   EVDFVGVFDVGASELELIGSEKDVVEALVRAPWLIEEGLEIVGVEVPTEVGHIDILARD
FT                   REGRYVVIEVKRDLATHDAVFQLARYVEVYKARGHDVRGVLVAGDISSTAYEYLKRYNL
FT                   KFVKINPRELTASKDKNRL"
FT   gene            486363..486581
FT                   /locus_tag="Pcal_0509"
FT   CDS_pept        486363..486581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1798 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07937"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTH0"
FT                   /protein_id="ABO07937.1"
FT                   /translation="MYRVLVNKSLDRILVTGKERDLRLLDEGWEIVYEAGDWEEAFEYA
FT                   MEIAEDEIVEWYYDEAVKKKVHVLAFA"
FT   gene            complement(486578..487903)
FT                   /locus_tag="Pcal_0510"
FT   CDS_pept        complement(486578..487903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0510"
FT                   /product="4-aminobutyrate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.19"
FT                   /note="PFAM: aminotransferase class-III; KEGG: pai:PAE1799
FT                   4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07938"
FT                   /db_xref="GOA:A3MTH1"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTH1"
FT                   /protein_id="ABO07938.1"
FT                   /translation="MPKWHWPIDPDEVPRIVVEPPGPKAMEIVRRDEELIMQSFARWYP
FT                   LVIKRGYGPVVEDVDGNLYIDFNAGIAVTNVGHAHPKVVEAIKRQAELFTHYSLTDFYY
FT                   EVAVKLAERLVSIAPISGKKKVFFTNSGAESIEGVLKIARGYFKGQRPYVIAFLGAFHG
FT                   RTYGAMSLTASKPVQRRHFSPLVPGVIHAPFPHPVHCPFKASTPEECGEYALAFLEDWV
FT                   FKRLVDPSEVSLVIVEPIQGEGGYVVPPKNFIQGLRKLTAEHGILFAVDEVQTGFGRTG
FT                   RWFAVEHFGVEPDLMATAKAIAAGLPLGAIIGRADVMSLPRGSHANTFGGNPVAAAAAL
FT                   ATLEVIEEEDLLRHAESLGEELKKVFREELGEGYDVRGLGLMIGVEMLKKSDLEGVLTR
FT                   AFKRGVAVIGAGFSTIRIAPPLVIPREMALKAASIIIDVVKS"
FT   gene            complement(488022..488729)
FT                   /locus_tag="Pcal_0511"
FT   CDS_pept        complement(488022..488729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0511"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   pai:PAE1589 3-oxoacyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07939"
FT                   /db_xref="GOA:A3MTH2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTH2"
FT                   /protein_id="ABO07939.1"
FT                   /translation="MKILVTGANGGIGSALVQLAKSRGDYVVGVSRTPSTAHVTYQCDV
FT                   LEVSCLSRAAAEVGQLDGIAALHGHGDAALWNKGLEELTADDFVEVYKVDVAGAFNVVK
FT                   AFRKNLKPTSSLVFVSSTPGLVGDVYGLPYAAAKGAIVALVKSLAKILAPVRVNAVAFG
FT                   PIETRWTQWIAAEEVEEFKSRTLLRRMGTPAEAAEAIYWLLSPASSYVTGQVIVVDGGE
FT                   TLVGLYRPTRSRT"
FT   gene            complement(488726..489301)
FT                   /locus_tag="Pcal_0512"
FT   CDS_pept        complement(488726..489301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0512"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: pai:PAE1588 GTP
FT                   cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07940"
FT                   /db_xref="GOA:A3MTH3"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTH3"
FT                   /protein_id="ABO07940.1"
FT                   /translation="MNRRLCMLQQRKNEAEDAVAALLRHLGEDLRRPGVANTPKRFVKA
FT                   MEELTRGLREPPPEVVFFPLEYDAEPGPVVIENISAVSICEHHLLPILLKISVAYVPGD
FT                   GVPGLSKVIRLVKWAAARPIMQERFTEWLADLLMEKLRAKAVKVKVCGVHMCSLIRGVK
FT                   DEHHNMVTEAKRGDIEVALKCKRPLNCR"
FT   gene            complement(489326..490231)
FT                   /locus_tag="Pcal_0513"
FT   CDS_pept        complement(489326..490231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1584 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07941"
FT                   /db_xref="GOA:A3MTH4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTH4"
FT                   /protein_id="ABO07941.1"
FT                   /translation="MLPAALAIFIYELAHLAAEVKMRKKRCGRCRAVVIVPTKRPQSLA
FT                   AFSGLVDYVVVDSEDEARQAEALGFRYLVNKYGGKSGALATALEEVEADAYVFVDDDAV
FT                   PGVWLEELKEAGCCGFATAYRWIVDDLLQNTFSLGGLDWMAWRRTRFLYGGAMAVPRWA
FT                   KQAAVKALLSCPVDDMALTAVASGRIEVLPVLVPMRRAGDALEFMLRQATAAKLGNPLL
FT                   WAVELLYYLAWTVAAVYMPALLVIHAARTALRSRRALGKIDWRQVALSPVERPLQAAIF
FT                   MASAFAKCFRWHGRRVCKRC"
FT   gene            490249..491466
FT                   /locus_tag="Pcal_0514"
FT   CDS_pept        490249..491466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0514"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 49kDa;
FT                   KEGG: pai:PAE1582 NADH-ubiquinone oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07942"
FT                   /db_xref="GOA:A3MTH5"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTH5"
FT                   /protein_id="ABO07942.1"
FT                   /translation="MFKPMKMEEYGIVLKEERLEGGRRVLDIFWGPQHPSSGHTRFIVE
FT                   VDGDIVVNVTPDPGYVHRTMEKLGETRHWIQNIPLFERLSLPDAINVTWAYAMAIERLA
FT                   GLDVSPRAQYLRVIMGELSRISTHLYDLGLHAIMIGSSTGFMWAYGLRELLVQLWAMVS
FT                   GSRTTPTWVLPGGVRTAPPDAFYEQTRGFLQYLEKKIDEFVRVVIKNPVGYYRLKDVGY
FT                   LSKEDAARLMATGPGARGSGIDWDARRVYRYGIYDEFEWDVCVEDGGDSLARAMVRICE
FT                   IMQSARIIRQALDRAPRDGPLVGESVAHRIPPKQREKVNELVRLQALFTMMLPQGEGTG
FT                   ITEGGRGRYYFHVLGDGSEKPYRVRISTPSWQNLRAMIKAFIGARLMDLPAIYGSFGYF
FT                   PPEQDR"
FT   gene            491495..492520
FT                   /locus_tag="Pcal_0515"
FT   CDS_pept        491495..492520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0515"
FT                   /product="NADH dehydrogenase subunit H"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase, subunit
FT                   1; KEGG: pai:PAE1581 NADH-ubiquinone oxidoreductase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07943"
FT                   /db_xref="GOA:A3MTH6"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTH6"
FT                   /protein_id="ABO07943.1"
FT                   /translation="MDLWGLLFSARLWFFVLMLAVSGIVLLTVVWFERKAAARVQMRVG
FT                   PYHVSPWLGGYLQLLADAFKFIISEPIVPRGAHKLLFTWGPPLFVTLAFGASLLLPLTP
FT                   ELRLIKDPNLLPYGLVFSLVVLLLVSIAIVIIGWSVNNKFAYVGAAREALLVAAYELPL
FT                   VLSVLAMFILYGTLDPLKIVEKQSILVGAVLNPFAFLVYLVATAMATARFPFEIADYEG
FT                   DVATGPYSDYGGVFLVLSFAGGTYYATFSYSFLASLLFLGGWNLPGFAVGSWPQDILGH
FT                   LVLAAWVMFKTLVLMLFFAFLRAAMPVLRLDHTLALGWRGLLILGVAAVLWSTALKLAG
FT                   L"
FT   gene            492517..492984
FT                   /locus_tag="Pcal_0516"
FT   CDS_pept        492517..492984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0516"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: pai:PAE1580 NADH-ubiquinone oxidoreductase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07944"
FT                   /db_xref="GOA:A3MTH7"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTH7"
FT                   /protein_id="ABO07944.1"
FT                   /translation="MSGTSIVKATVGALRVAARNFVKPERITIYYPYEKLDYGRMRGWI
FT                   GLWTEKCTSCMLCARICPTNAIKMYLAPNNKRYPGIDYGRCIMCHFCIDICPTDALYPT
FT                   DIKELTWYDYREMVYTPDMEREPPKVQEPYKSVKVVIKYINGVPKKVVQSK"
FT   gene            493015..493440
FT                   /locus_tag="Pcal_0517"
FT   CDS_pept        493015..493440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0517"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 6; KEGG: pai:PAE1578 NADH-ubiquinone oxidoreductase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07945"
FT                   /db_xref="GOA:A3MTH8"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTH8"
FT                   /protein_id="ABO07945.1"
FT                   /translation="MIDLILLSAALFFGILAVYSRDNVYSASSLAAAAGAVGAYYAYLM
FT                   QFAAAFLLFVIYIGAVMLLVIMTAAMYGGVQRQGGKYFLATTLVTLVVVLLSVVVWLGP
FT                   QAKPQAYLPADLATVVVLLFGVVVVSLLTGVEVARRV"
FT   sig_peptide     493015..493077
FT                   /locus_tag="Pcal_0517"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.907) with cleavage site probability 0.844 at
FT                   residue 21"
FT   gene            493437..493730
FT                   /locus_tag="Pcal_0518"
FT   CDS_pept        493437..493730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0518"
FT                   /product="NADH-ubiquinone oxidoreductase, chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 4L;
FT                   KEGG: pai:PAE1577 NADH-ubiquinone oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07946"
FT                   /db_xref="GOA:A3MTH9"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTH9"
FT                   /protein_id="ABO07946.1"
FT                   /translation="MTAALVVGFVLILLGVYGIATTRHLVRILISLELATVGAFAMLAP
FT                   ALVTSPALAFYGVLLLVIISVSEATILAALIYRSYVLTKSTDLSALSEGREV"
FT   gene            493727..495157
FT                   /locus_tag="Pcal_0519"
FT   CDS_pept        493727..495157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0519"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: pai:PAE1576 NADH-ubiquinone oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07947"
FT                   /db_xref="GOA:A3MTI0"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTI0"
FT                   /protein_id="ABO07947.1"
FT                   /translation="MMILISVLFPMILSFVAYAAAKRSAYMAGYISAAALLPLLALSAY
FT                   VVFGGVDLSEGTFQGFDVLAFRIMPFNGVFIFTVALVGLFVALFSPPYMEHRSHELGRD
FT                   SAVFYLTYGFFVGGLAGAFAAANLVVVYVFIEVALIASLFQILYYGYGDRVRITVMYLV
FT                   WSHVGAFLVLAGFLLLYLKGVYYVPLLIGGRGTGPDALAFVLILIGSLIKMATLGVHMW
FT                   LPYVHAEAPTPLSALLSPVLVGIGGYLIASVAMYVLPNSEWTQWLVYYAVATAIYGGLM
FT                   AFLQRDIKRLFAYSTVSQMGYLLLGVALANVYGYTAAALFYLSHGLGKAVLFMTAGYFI
FT                   MYLGTRDVEKMGGLYGWRPELAGAAIVGFLNLAGILSIGMISEITLTVGYAQYFQTDYA
FT                   FYIPYALVLLVTGIYAFNTIRVVFFGPPKREDRGPVDIALASIVAVAFISLLLFIPPFS
FT                   NTIADNIYKAVGAVGPWR"
FT   sig_peptide     493727..493786
FT                   /locus_tag="Pcal_0519"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.982 at
FT                   residue 20"
FT   gene            495148..497010
FT                   /locus_tag="Pcal_0520"
FT   CDS_pept        495148..497010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0520"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: pai:PAE1568 NADH-ubiquinone oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07948"
FT                   /db_xref="GOA:A3MTI1"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTI1"
FT                   /protein_id="ABO07948.1"
FT                   /translation="MEVILFTIFAPLIMSIVSLFSTSEKFKAWAVTLGTFISALLATYA
FT                   YFAVSPGVYGFDWIKAIGARVELWINWTSLTMGLLVAWLVAAISLYSVKYMEGDYRPGW
FT                   YWFFFGFFATSMLIIVYAGNLWFLLVGWEGVGLASWALIGHWYRDEYDKWVGKEEKVAG
FT                   VPYWWTPSKAGLRAILTVRFGDAFFLVAIALFYVLTGTVSLSGLMSPPALDALKQLGVV
FT                   PLLFFALGPFTKSAQFPFHEWLLTAMTGPTSVSALIHAATMVKAGVYVLIVTAPIFAVV
FT                   KGSELYFTVVMWVGVATALLATIIALTSMEFKLVLAGSTAANLGIIAAATGAAGVLGLH
FT                   ETQLLNALLFFAFLHIVGHAVSKASLFMGFGAVIHEAGTRFLGEVGKLWRHMKITAVAM
FT                   VLSMLSLVGIPPFVGYITKDLALENVFEAGHVLGVEALAALLYILLFLTPIYGLRLIGL
FT                   TFFHGKEPEEVHEAPVLMWLPYTALALATIVLGTYFAVSIKFPLTEALVAVLLGFLTGF
FT                   VLYIALPGFKSETLRPLWEFAYRRFYLPILYDGVFPWLYTWFAKFIFVVFDKGLFDGLY
FT                   HNVLPGLFGAVSNWLRRLVAGALNIYLLYAIVGILITLLLLVVA"
FT   gene            497007..498242
FT                   /locus_tag="Pcal_0521"
FT   CDS_pept        497007..498242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0521"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: pai:PAE1567 NADH-ubiquinone oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07949"
FT                   /db_xref="GOA:A3MTI2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTI2"
FT                   /protein_id="ABO07949.1"
FT                   /translation="MIVEILYLVIALSLTAPLVWRLDGRYISLATSIVLMALSVYYKLP
FT                   VGVLLSVLALSLSLDWRWGPFGVALSFSAVAAVLATYVYYAGQSIVYGLLALALVTAAV
FT                   YGLLAMDRRRENVEGAVKYLVFSGIGKVLIVAGYVIAVSGWWQGAYLLVLGFLFELGIV
FT                   PFHAWVVDAYALGTPRGVAALTAFSKLTALYVLLAIFRQLGGVPSHIGAVALIVALASM
FT                   LVANVAGLTAKTLGRVMAYSSVAHMSYALTAVALVWWLGDRPTSLFGVPVRASDVAALT
FT                   VVLEALTSGIAKSGVFGYLPTSLSDVLPPRRSVLNVANVFSLLGLPPLLGFWPKLFLVL
FT                   LVLSYPATWLSVFLVSWIVLNSATATPYYLRAIRMVAEAPSPVADNVTSAYTALASVAV
FT                   GLLMPLIVYILA"
FT   gene            complement(498333..498985)
FT                   /pseudo
FT                   /locus_tag="Pcal_0522"
FT   gene            499051..499599
FT                   /locus_tag="Pcal_0523"
FT   CDS_pept        499051..499599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0523"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="PFAM: nucleoside diphosphate kinase; KEGG:
FT                   pai:PAE1561 nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07950"
FT                   /db_xref="GOA:A3MTI3"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTI3"
FT                   /protein_id="ABO07950.1"
FT                   /translation="MPVERTLVILKPDAVARRLVGEIISRFEKAGLRIVGLKMVKSSAE
FT                   QIERFYPSSEEWLKSVGTKLLKAYQELGISPRERLGTDDPVEVGKMVKKKLVEYMTSGP
FT                   IVAMVLEGNRAVEVVRKLVGPTSPHSAPPGTIRGDYSIDSPDLAAEEGRVVYNLVHASD
FT                   SASEAEREIRFWFKPEELV"
FT   gene            complement(499596..499985)
FT                   /locus_tag="Pcal_0524"
FT   CDS_pept        complement(499596..499985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE1560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07951"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTI4"
FT                   /protein_id="ABO07951.1"
FT                   /translation="MAKGPLPGLYYVATSPPECGQIRVRLMELPTNEEPPFKAVAIRAG
FT                   GGVALINLTKISLVDYFFQHIGNVIEGEVKNGVLEGVVCNKKVKLRVTDRTLSGPVLAV
FT                   VPVAKRRRVLPRVAVVVYAYEVKIA"
FT   gene            complement(500114..501133)
FT                   /locus_tag="Pcal_0525"
FT   CDS_pept        complement(500114..501133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0525"
FT                   /product="putative ATP binding protein"
FT                   /note="KEGG: pai:PAE1557 P.aerophilum family 417, putative
FT                   ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07952"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTI5"
FT                   /protein_id="ABO07952.1"
FT                   /translation="MDLKRIFAERISFVYGPSGSGKTVLVSEIVRQFADEGRRVVWISF
FT                   NESRDVLVNMWKSFGWDVGRITVYDFPFVPQYRETLFNQVVDLAYKEKAEVLVVDGVDA
FT                   VVFDRATADALSKVGLYSTIGIDTKYNPLADIADTIVRTSIKFIQSAAIRRLEIVKVRG
FT                   MEVATPVYYLAVLPQGPVVLSRYPRHEPTRKIAAPGHLANFIGEIYKGVQIALYGPYQG
FT                   VSARVVDVAEAVAYIHKPYQRDFFKRARTYLVSPQEHLRLEHYAVKHDAEYVVVLDAEV
FT                   VPKFFREFRRPDVVWIDVYTTPPPMSDYDYIFYVSRETIRLEKSPEPTDVVGLPIALE"
FT   gene            501224..502246
FT                   /locus_tag="Pcal_0526"
FT   CDS_pept        501224..502246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0526"
FT                   /product="Dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /note="PFAM: glycosyl transferase, family 2; GtrA family
FT                   protein; KEGG: pai:PAE1555 dolichol-phosphate
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07953"
FT                   /db_xref="GOA:A3MTI6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTI6"
FT                   /protein_id="ABO07953.1"
FT                   /translation="MPTYNEAENLPELVERLHRAFGGVGYEVVVVDDNSPDGTANTARR
FT                   LGERYPVRVVVRERRAGLSSAVVEGARAAEGNVVVVMDADLQHPPELAPQLAKIAERGC
FT                   LAVASRYVKGGRVEGWSLSRRVVSRGAVLLARLVVPEARGVKDPVSGFFAYKRDCLRAV
FT                   TPTGLYKILLDVLVQCRPPCVVEVPYVFGLRTRGRSKLGAKHILDFVRQILALSKWRPL
FT                   KFAAVGATGVAVATAVLAATSWMTPLASVALAIEISLTTNYLLNRLWTFSERHTPLLAG
FT                   WAKYHLATAAGNLTNYATTLALHFAGVWIYLAYLVGVAAGYFVNYALSELVVFSKPPAH
FT                   "
FT   gene            502404..503447
FT                   /locus_tag="Pcal_0527"
FT   CDS_pept        502404..503447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0527"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Semialdehyde dehydrogenase, NAD - binding;
FT                   Saccharopine dehydrogenase; KEGG: pai:PAE1554 saccharopine
FT                   dehydrogenase, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07954"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTI7"
FT                   /protein_id="ABO07954.1"
FT                   /translation="MRVLLLGCGNIGRYIYAMLSKHEVVAVDKAGGCPGALSQDALEVP
FT                   LGGYDLVINALPGAISFKASKRALEAGLDVIDVSFYPEDPFALHEVAAKAGARYIPDAG
FT                   VAPGLSNMLAGRAVAELGDVDELGIYVGGIPERPVGPLGYSVTWSPVDLIEEYTRPARV
FT                   LKDGVVTAVDPLSEVETVPSPVGTLEAFYSDGLRTLLKTLAGRAKTMYEKTLRWPSHVE
FT                   KMRLLRELGFLSDQGDPPPRFITAKLLSRLKFDVPDLVYLKVVAAKGEKRVQYETLVKP
FT                   RGGWTAMQIATGSVAVAMQYVIKDLDPGVTPPEYIGMSTKLFPRVISAIKQQGVRIAQE
FT                   VVTRTEL"
FT   gene            503444..504709
FT                   /locus_tag="Pcal_0528"
FT   CDS_pept        503444..504709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0528"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: pai:PAE1553 histidyl-tRNA synthetase; TIGRFAM:
FT                   histidyl-tRNA synthetase; PFAM: tRNA synthetase, class II
FT                   (G, H, P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07955"
FT                   /db_xref="GOA:A3MTI8"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTI8"
FT                   /protein_id="ABO07955.1"
FT                   /translation="MSGLPDHLRRPVRGMRDWLPHQYYALQQLEALLSRVAESFGYRRV
FT                   ETPVVEHFEVLARKAGQEIVNEIYYFRDKAGRELGLRFDMTVPIARVVSYNLDLPRPIR
FT                   WYYFTKVFRYDEPQHGRYREFYQFGVELIGSASPRADAEVVHLLAESLAAAGASNYVIK
FT                   LNDRRVVDKLLEGMGLAAYKDVVYKALDKRYKAPREEVVGIMTRGGVPPSKAEELYEKA
FT                   TEMPLQEAVDFVTRIDKELGGFYAAFVKYLEAAVGLERLIFDLSIVRGLDYYTGVVFEA
FT                   FAGEYKLAVGGGGRYDDLLQLYSGVKTPALGFAIGVERLMEAVGLQAVEKPLDYYIYIF
FT                   DESAYQTAIYIARELRRKGYSAVVELGDKGLKDAFEYVLKIGTRFLVILGKKELEKGVV
FT                   KVRDLQKREEVEKPIDEFIRGA"
FT   gene            complement(504732..505628)
FT                   /locus_tag="Pcal_0529"
FT   CDS_pept        complement(504732..505628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0529"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   pai:PAE1552 carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07956"
FT                   /db_xref="GOA:A3MTI9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTI9"
FT                   /protein_id="ABO07956.1"
FT                   /translation="MLVVVALGGNAFNRPGDPITQETHLKNADIAARIVAKILREGNQV
FT                   LLTHGNGPQVGYLAELQKGQEGFRLDALVAATQGLLGYFIVSSLDKYVGVGKTVALVTR
FT                   VKVDCNDPAFENPTKFIGPTYPEEVAKSLAERYGWQFRQDPRGGWRRVVPSPKPLKVVE
FT                   SDVVKVLIERGYIVVAAGGGGVPVCDGAGVEAVIDKDLASAVLAAEVGADLFMILTDVD
FT                   GVYINFKKPGQRKLASVSVGELEKYYLEGHFPPGSMGPKVEAALYFVKRTGKRAAIGAL
FT                   EEGYEVYKGLSGTQVYA"
FT   gene            complement(505649..506731)
FT                   /locus_tag="Pcal_0530"
FT   CDS_pept        complement(505649..506731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0530"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pai:PAE1550 transport protein, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07957"
FT                   /db_xref="GOA:A3MTJ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTJ0"
FT                   /protein_id="ABO07957.1"
FT                   /translation="MRLILAARALYALMWFYVAPVLPQMLKEFGVDASSAGLLPAMFIV
FT                   GTGVMQIPASYLGGKLGFNKVAGAGMAIFGASSLLLSLSNSWWEALLLRALGGVGAGLF
FT                   FSTAGALIVAYMPDAVATALGWYSASFNIGAFVGFYWGYVASLTGWRLALAIPGALAIV
FT                   LGVLIFRGPPLKGASKFSWRAYSFGLASFPFWGSVYAANSLAATWAHLHRGVAESVAGA
FT                   LSSAAMASGFLGGFFGRLYDKTQKKLRFLTAAPLLAAGAYALTPFAPVYALFLLAFTYG
FT                   AAFSAYITAIYATASKVSQDPSSALAVVNVTNMALGLHVSYIFSWLMAYSPALPWEFLA
FT                   ALAASSSLATYAVAQRTKFI"
FT   gene            complement(506778..507164)
FT                   /locus_tag="Pcal_0531"
FT   CDS_pept        complement(506778..507164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07958"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTJ1"
FT                   /protein_id="ABO07958.1"
FT                   /translation="MRNIKEVMSLAGIRFDYIHAERLGAPPPGAQLQMNMQVMIEGERA
FT                   VKRGGFVEIPFTIGISSVPSVVTVTIRGTATVQGDVDLKNLPPHIATPIMQAALFEAAL
FT                   IMRELGFPPPLPVQPQQPQAPHYA"
FT   gene            507175..508008
FT                   /locus_tag="Pcal_0532"
FT   CDS_pept        507175..508008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07959"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTJ2"
FT                   /protein_id="ABO07959.1"
FT                   /translation="MITQIVDYTAEVHVAYEVDVVVSPLCRAPPPTPRIEAWATLGELF
FT                   RDLYGVGVSEHLADQAALGLERVDPVLLFAQLPLGVMYTARLMPYGRDTAQCTSAWPDP
FT                   ATAAVAVVSNGVSSIAVDLRLWQGDPRPLLRYAAAKGAKTQLILTKPLDLPGDVVFHSS
FT                   VPPYARERYVRAPGDLSATGRAVALKAVAPMSRVDEEQSPAFKEALARVAEVLDLGEEV
FT                   FADLVEQGVVSHGFLLDLAQPSQLAYLVKWGLVERVAGGWGASAKLIYLYGLLKG"
FT   gene            complement(507981..508811)
FT                   /locus_tag="Pcal_0533"
FT   CDS_pept        complement(507981..508811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0533"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /note="TIGRFAM: Sec-independent protein translocase TatC;
FT                   PFAM: Sec-independent periplasmic protein translocase;
FT                   KEGG: pai:PAE1547 membrane protein (mttB family)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07960"
FT                   /db_xref="GOA:A3MTJ3"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR011532"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTJ3"
FT                   /protein_id="ABO07960.1"
FT                   /translation="MPLWEHLRELGQRLKRVLIAFVVVFIVMWMPAPDLHGGSIMSILA
FT                   SFFVTGEYRPLAYWAFFETIRPMLDDLNKTANIKIALIAGEVWNPLGAVMYASLYLAAL
FT                   VVFPLLVYEMWLYVQPALYPHEERAVKKYLWVALLLFYAGNLFGIFVIFPALFRFIAGF
FT                   AAILRIEQIFSVSSVVSTWMQLAFWTGVIFETPIVIAILSEICLLNPWTLAAYRPVVYA
FT                   VALILIAIVTPDTTLVSTFLTFIPFAILFEVGLVWSRRIVKKCPDIQPLSKPYR"
FT   gene            508914..509216
FT                   /locus_tag="Pcal_0534"
FT   CDS_pept        508914..509216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0534"
FT                   /product="Sec-independent protein translocase TatA"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: pai:PAE1546 putative sec-independent
FT                   protein translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07961"
FT                   /db_xref="GOA:A3MTJ4"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTJ4"
FT                   /protein_id="ABO07961.1"
FT                   /translation="MYLLLGGQEWIVILIAVVILLIWGPSKLPSLARGLGEAIREFRKA
FT                   TSGIEEEPRKVEKREEIDQKLLETARALGISIEGKTKEQILDEINKKIAELKKTQ"
FT   gene            complement(509253..510074)
FT                   /locus_tag="Pcal_0535"
FT   CDS_pept        complement(509253..510074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0535"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: pai:PAE1545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07962"
FT                   /db_xref="GOA:A3MTJ5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTJ5"
FT                   /protein_id="ABO07962.1"
FT                   /translation="MDVSIGVLSAVLATAAFSINAPLANAATKLGVSPTSLVAVRNLVA
FT                   LLTLLPLADFKISALGLLVVVASALLGPGLGDAAYFNAISKSGVAAAVTIGYTYIFTAQ
FT                   FFSALLGVEPLTSRVIVGAALAFSGVAVALGGVPRGSGAFYGLVASLAWGLASALLGVA
FT                   TKGASVYTIAVLRSAVLAPLFFALSGFKRPPLRGLIYAVSSGVVGLALGSAAFIYAISA
FT                   IGVSKTVIATSLTPILSQIFDKALNKTPIRQRYILGATLVSVGIVISVMNN"
FT   sig_peptide     complement(509994..510074)
FT                   /locus_tag="Pcal_0535"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.978 at
FT                   residue 27"
FT   gene            complement(510064..510240)
FT                   /locus_tag="Pcal_0536"
FT   CDS_pept        complement(510064..510240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0536"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: pai:PAE1544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07963"
FT                   /db_xref="GOA:A3MTJ6"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTJ6"
FT                   /protein_id="ABO07963.1"
FT                   /translation="MCHVGEKREKMVLISFHVPQSYVEMLDELVKSGVFPNRSEAVRAA
FT                   LRELLNRYMSNGR"
FT   gene            complement(510254..511273)
FT                   /locus_tag="Pcal_0537"
FT   CDS_pept        complement(510254..511273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0537"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pai:PAE1543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07964"
FT                   /db_xref="GOA:A3MTJ7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTJ7"
FT                   /protein_id="ABO07964.1"
FT                   /translation="MVLGGGIAGVFTAYFLRELGFDVVGVGGDVAYPLTSLVLTLSMPY
FT                   GEDVELAKESLEIYRKFVQPREVTSVDIFPRWVTLPKLEVPHEVTDSVEGLRLGPDEVA
FT                   VLTRDYLIPVRKVVNRLRRELGFASSYGFLKVEDGKAYVVAEGRRIAGDVVVLAAGYNN
FT                   RALAEKAGLRLPLQPYECYAVAYAAWGKGWRYSVGDHVLGWYGRPIAPFMYVAGDGCGR
FT                   YGQGPPANYVEKMTNLLRQRIGAALPLGLRVGYCEVGPHGGPVYGKHPDVDNLYVIGGL
FT                   DGYGSMVGPSLAKRLADLIAGREEFDEFKVERYMAHMDFDPCAVSERHDWGSVILRKA"
FT   gene            complement(511311..512033)
FT                   /locus_tag="Pcal_0538"
FT   CDS_pept        complement(511311..512033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07965"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTJ8"
FT                   /protein_id="ABO07965.1"
FT                   /translation="MKAGCTASHKLLSPETHVESPRRVVLLQYPPPPVVTPHLITAASL
FT                   ISTKLYGLFDLGSYIARLVEAGVQKYGEPLDPCWLYAVLPSGYKHFAYFSDQAPGAEGE
FT                   YASLYPDPYLGTLFVAASGRRAVFRPLSGDYLDGLFQSLAGAEGWNIRVANYVEYELYE
FT                   NRHVVNRECVVERLRQILPREFTYEKDALLSVLVPTMPQAFLTDPQMTKLVALGFMEYR
FT                   ETTIVPTPLLVSLLSMIL"
FT   gene            complement(512005..512622)
FT                   /locus_tag="Pcal_0539"
FT   CDS_pept        complement(512005..512622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0539"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pai:PAE1540 conserved protein (possibly
FT                   metallo-beta-lactamase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07966"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTJ9"
FT                   /protein_id="ABO07966.1"
FT                   /translation="MEVQWVEAGPLLTNTYVVCDLDECVVVDPAGGVREVLRLVGKRAV
FT                   VAVVATHLHFDHVLSAAEVVEAVNAPFHAHYDDWRIYRELNSVAVEWGFEVPVLPAPRP
FT                   LGERLWKLEVIHTPGHTPGSVSLLGDGFVLTGDTLFKGTVGRTDLPFGDWRLLVKSVCK
FT                   LYQLPGGYRVYPGHGPATYLGEEALYNVVNRSVCESGVYRIT"
FT   gene            512670..513911
FT                   /locus_tag="Pcal_0540"
FT   CDS_pept        512670..513911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0540"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; KEGG: pai:PAE1538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07967"
FT                   /db_xref="GOA:A3MTK0"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTK0"
FT                   /protein_id="ABO07967.1"
FT                   /translation="MRTLLAVLAAAFLAYSLTIGQLHFTDVNSGDDFNRALVDGPVLIF
FT                   IHQPNCLGCAKLKGEVFPKPQVAQALRGVNLVSIDLAAYPVTSIKVVADGSVYVYQGSL
FT                   RVSKASGQVEVPIYATPTLVLGYVKNGTIHLTMVIVGAVEAPQLIELVKLAYTQPTEAT
FT                   PRPSTTQTAEPTTATQTTSPLGTVAQIALSFAAGAASVFSPCVLPVVTIAATTYLARRN
FT                   LALVLLGMVISFAALAALATTAAAWARAAATTALYLIGGVVLVAIGLIFVIERFNKAFL
FT                   MWVSSLQTRAYKLTKRGAGAVGDLALGASLGAVWMPCVAPFLGVVAMGSLVAAALSRDY
FT                   LAVFFNTLAYAAGLAAVIYAVVYAVQKSARRTATLKWSRLGRRIEYAVGIASIVLGILL
FT                   IGEAFGLRTITLLV"
FT   sig_peptide     512670..512720
FT                   /locus_tag="Pcal_0540"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.925) with cleavage site probability 0.571 at
FT                   residue 17"
FT   gene            513908..514405
FT                   /locus_tag="Pcal_0541"
FT   CDS_pept        513908..514405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0541"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="PFAM: Dual specificity protein phosphatase; SMART:
FT                   protein tyrosine phosphatase, catalytic region; KEGG:
FT                   pai:PAE1536 conserved protein (possible dual specificity
FT                   phosphatase)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07968"
FT                   /db_xref="GOA:A3MTK1"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTK1"
FT                   /protein_id="ABO07968.1"
FT                   /translation="MMECPYWVDERVAGSCMPRRDDVDKWAKAGIRTVITLAEAWEVEY
FT                   YGRWGLLEFRRALEERGIEWIHWPTPDGYPPRGLIELVELVKAKARSGAVLVHCVGGMG
FT                   RTPTLLAAYLIATRCLKADDAIRHVERVNPHISLTDQQYYALLEVEATYRDVCNIQGKN
FT                   IK"
FT   gene            514425..514522
FT                   /locus_tag="Pcal_R0008"
FT                   /note="tRNA-Ser1"
FT   tRNA            514425..514522
FT                   /locus_tag="Pcal_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(514742..515179)
FT                   /locus_tag="Pcal_0542"
FT   CDS_pept        complement(514742..515179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0542"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B; PFAM: molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; KEGG: pai:PAE1759
FT                   molybdopterin-guanine dinucleotide biosynthesis protein B,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07969"
FT                   /db_xref="GOA:A3MTK2"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTK2"
FT                   /protein_id="ABO07969.1"
FT                   /translation="MTCVIQITGGKDVGKTVVAERLIKRLKASGKTVLAVKISHHDPEP
FT                   PTKDTHRLRKAGADKVLFYNGQIYVLYTTAVKCEDLQADYIIVEGLRDAKLGYKIHIGP
FT                   DPPPDADLVLNSAEAEPEVACVRQDPCTLLEAISKYKPPSH"
FT   gene            complement(515176..515478)
FT                   /locus_tag="Pcal_0543"
FT   CDS_pept        complement(515176..515478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0543"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: pai:PAE1760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07970"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTK3"
FT                   /protein_id="ABO07970.1"
FT                   /translation="MKAYQRFKRCIGKGNLWLYVVSLLNKKGPLHGYAIIQELRKLGFN
FT                   ISTVYGYVLLKRMVTDGVLVEVEEGGKKLYAASPQAQENFKKAIEELQDLIKALT"
FT   gene            complement(515475..516530)
FT                   /locus_tag="Pcal_0544"
FT   CDS_pept        complement(515475..516530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0544"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /note="PFAM: Myo-inositol-1-phosphate synthase;
FT                   Myo-inositol-1-phosphate synthase, GAPDH domain protein;
FT                   KEGG: pai:PAE1761 myo-inositol-1-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07971"
FT                   /db_xref="GOA:A3MTK4"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTK4"
FT                   /protein_id="ABO07971.1"
FT                   /translation="MSIRVGIVGVGNCASALVQGIEMYKRNPEAEPAVAFKEIGGYTPR
FT                   DIVFTSAFEIDARKVGLDLAEAIFQPPNNASVVYKPPRLGVVVKPGPALDGVPEGGLVP
FT                   KIVEGSVDDVVKELNSTNTEVLVNYLPTGAKKAAEAYAEAALRAGTAFVNAMPAPIATS
FT                   EYWQRKFSERGIPLLGDDTQNQIGATVLHKTLIRLLALRGVRIKHTYQINVGGTPDFVN
FT                   LMYRRGDKEKTKTAAVKMMAQGQEFDAYISPVAYISFLGDRKIAHTLIEAEIFGGLPIR
FT                   IEATLDVHDAWNSAAVVTDAVRLAKLALDRGIGGPLIAASAWGFKNPPVHMSPDEAYRA
FT                   VLEFIEGKRER"
FT   gene            complement(516566..518332)
FT                   /locus_tag="Pcal_0545"
FT   CDS_pept        complement(516566..518332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0545"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region domain protein; KEGG: pai:PAE1762
FT                   iron-sulfur binding reductase, probable"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07972"
FT                   /db_xref="GOA:A3MTK5"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTK5"
FT                   /protein_id="ABO07972.1"
FT                   /translation="MINEVLLSLFLLTFIIFAVLLWKRIKLYNKKIDFVKLIIHEFKEA
FT                   ARGGVGYMHFSIASGVVLSVVLALLDFAPAAKLALWLISLPIIAGLIAAALYRVGVFIR
FT                   SGVIHRRLGEDKKFVSESNKMQLVLLFIIILTTLDLSLSIFNSAISNTIGILRNILLAA
FT                   FYVKPAANLMVNYDRELSHFRIPFRLEDVIEGKIKPEEVKFGYEKIADVDKDVVLSCQS
FT                   CGEIGACDAGCPAVAAGRLLSPRVVVRTVALNSNNPEFELAVKLEQQAWACTTCGYCVY
FT                   ACPVRVNHLDVIFGVRRALVAQSKVDKKIADVLMSASQYGNTMSTPNTGRHDWLYSLGV
FT                   KHISENPNAEYLLWVGCMGSFDGRARQIVQALVEVLKKAGMLEKIAVLGDEETCCGDPI
FT                   RRLGEESRFQEIVLNNKEIFNKYRIKKIITICPHGYNTFKNDYKRLGVELEVYHHVEIL
FT                   QKLADEGKISVKSLGASLTIHDPCYLARYNKVVEPQRKIVVKLGELKEPPRRGDKTFCC
FT                   GAGGGNYWYDVPEEKRISHIRFEELEKTGASTIVTLCPFCNAMLLDAKRTKESKVEVKD
FT                   LVELVAESLGGA"
FT   sig_peptide     complement(518276..518332)
FT                   /locus_tag="Pcal_0545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.626) with cleavage site probability 0.455 at
FT                   residue 19"
FT   gene            complement(518375..519016)
FT                   /locus_tag="Pcal_0546"
FT   CDS_pept        complement(518375..519016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0546"
FT                   /product="CRISPR-associated exonuclease, Cas4 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas4; KEGG:
FT                   pai:PAE1763 putative RecB family exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07973"
FT                   /db_xref="GOA:A3MTK6"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="PDB:4R5Q"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTK6"
FT                   /protein_id="ABO07973.1"
FT                   /translation="MELLSPKPLCSVVNCEDLEKLDHVSALNELRREQEIFKLLPGIYA
FT                   HRYDFRRVSPSIINDFEYCPRLLWVQHKLGLKLLSEKSVVSIIRGRILHERYERLLSQY
FT                   ENVVAEYKVEIGDLVGVVDLVIKRGGEYIPVEIKTGFSKEAHKTQLQIYISMLKARFGY
FT                   LVYRNHVEVVHRNDAALDVLKKIREILSAREAPPAKCNSCIFKPICKNLL"
FT   gene            complement(518997..520559)
FT                   /locus_tag="Pcal_0547"
FT   CDS_pept        complement(518997..520559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0547"
FT                   /product="translation elongation factor 1A GTP binding
FT                   domain family"
FT                   /note="PFAM: protein synthesis factor, GTP-binding;
FT                   elongation factor Tu, domain 2 protein; KEGG: pai:PAE1764
FT                   GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07974"
FT                   /db_xref="GOA:A3MTK7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035531"
FT                   /db_xref="InterPro:IPR039263"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTK7"
FT                   /protein_id="ABO07974.1"
FT                   /translation="MDFYPPESEEGNVEYKLVLGEGDLDKLGGQLKRRLLEGGGEAIYV
FT                   IGVSNDGRPLGLPDDELFKSLGVLREVAKRVGASLHLLRISEGVRGKVAEVLIRAVGRE
FT                   EPPPTVTIIVLGNVDAGKSTLVGVLTTGKLDDGRGLARAYASRYKHEVLTGRTSAVSMR
FT                   LLGFVGDSVVNHKLVDPLDEAEVYRRSDKLALLVDVGGHERYVRTVLRGLFSSEPDYAA
FT                   LVVAANSGVQKMTKEHLGVAVALGIPVFVVVTRVDIAPPEVFQRTVEELVRLLKMPGVS
FT                   KIPYVVKDMGDVVLAARAMSSGRVAPIFYVSNVTGQGVDMLAKFIALLPRRRRWDSGGE
FT                   PLLYISDIYMVKGVGVVVGGLVERGAVKVGERLWLGPYEDGRWAPAVVKSIHLNRTPVE
FT                   RVGAGNFVTIALDRVEDVEKGMVLAARPLPSVREVVAEVLVLRHPTAIRAGFSGVFHYK
FT                   AIRASAYIKELDRGVLMAGDNGVARIAFTRPWYIEGGVFIFRNGPTRIFGRVVRLENGT
FT                   AIS"
FT   gene            complement(520579..522735)
FT                   /locus_tag="Pcal_0548"
FT   CDS_pept        complement(520579..522735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0548"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: pai:PAE1771 vacuolar-type H+-pyrophosphatase;
FT                   TIGRFAM: V-type H(+)-translocating pyrophosphatase; PFAM:
FT                   Inorganic H+ pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07975"
FT                   /db_xref="GOA:A3MTK8"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTK8"
FT                   /protein_id="ABO07975.1"
FT                   /translation="MFIPIFGLIVGAIGVVYAIYLARWVLSQDPGNEKMRFISQAIATG
FT                   ARAYLFRQYRTLAILLAVLAVLILIAIDLPRGTNGLTALGFVVGALGSMLAGYLGMYVT
FT                   TRSASRVAQAAAIGGMGKALLVSWRAGAVMGLSLAGIALLLISGFYLAFRAVTSDWAVP
FT                   LVALGFGASLVTLFMRVGGGIYTKAADLGADLVGKIEAGIPEDDPRNPGVIADNVGDNV
FT                   GDVAGMAADVYESYIVTVTAAIFLAAILGLASAYIDAIILFAALALIATFIGVNLLKTT
FT                   GVKHPLSSINMAVYFTIGIAIVLFFAGTFVLGLDFAKAAALAAAASLGAALAPIIVKIT
FT                   DYYTSYNYGPVRRIAEQAKISPATVIITGYGEGLMSAIPVIAIIVAVLGVSYAIGYYTV
FT                   PVQGFGEWSKYLAGIFGTAIASVGLLVVAGIIITADSYGPVSDNANGVVEMAGLPESVR
FT                   EVTDVLDSVGNTTKATTKGYAIASAALAALVLFIALIFEIVQAYSKIVGTTNLVAVLSD
FT                   SLRGLSIINVNVLIGAFIGVSLVYFFTSRTLGAVGRTAMEIVEEIRRQFREKPGILEWK
FT                   EQPDYARVVDIATRRALGEFLVPGLAAIVVPLLTGLVLGWNALAGLIMGAIVAGVPRAL
FT                   LMANAGGAWDNAKKYIELQGLKKTEMHKAAVIGDTVGDPFKDTSGPSLNPLIKVLNTLS
FT                   VVFAYAIVLANVALGIYPMGLLPF"
FT   gene            522833..525130
FT                   /locus_tag="Pcal_0549"
FT   CDS_pept        522833..525130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0549"
FT                   /product="V-type ATPase, 116 kDa subunit"
FT                   /note="PFAM: V-type ATPase, 116 kDa subunit; KEGG:
FT                   pai:PAE1773 H+-transporting ATP synthase subunit I (atpI),
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07976"
FT                   /db_xref="GOA:A3MTK9"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTK9"
FT                   /protein_id="ABO07976.1"
FT                   /translation="MPLERVVEFRIAGNVELLPELIYFIGKAGVAMFEDRPEKLPKPRD
FT                   PAILQQAKRLGEMLGQLSAYLQPKTVPLPLSSLEEQIGQVLEKLEGVTKEVSYYARLMD
FT                   ELKTKLAISRELSSFKALRPPATEAVDVFIVLAGRSAKEVAELCKSFNAAVVQQGNVFM
FT                   ITAERKFAQQLKSALEKLGVQLFTFKELEEIEPQEALEEKLRQAERGLREALERHREVL
FT                   DYAHTLREALALVIDVFNRSAIDEGTEMGRLFASYEAEIKRLEAQLSNLHKIRKVLDAL
FT                   SGGVKIPEGFKLFIDPQMPINAPHIIQEIDGVKVALVKGEAKGVEVPSEYLLDVENGKR
FT                   VVEEAIKSTEAALQRVKREREALERLYSEYSVYGDKRWDEHNDVATLIFYVLERDVKKV
FT                   DDALVEFVRKNSAKLDIVKRVRYKYIDRVPAERRPTLEKYPAPIRQFTKIVYMYGVPKP
FT                   IEISPVPLVALIFPVFFGWMYGDLGHGSLLFLLGILLLTKLYGGRHRDWGVIWTITGLV
FT                   SMFFGAFVYQEAFGFHLEEFGIHLPTAPILPLFGHKTFVEVDGVKASLAAAFLLGFLLL
FT                   LLAFLSKLINTVLKGEGDVALAIALPQLLFFFSLGMVFFSLIWQPMGMYYLEPLMGLPW
FT                   GYLALLFIVWSAIGVVVIRARYRHHEEAPPVVDEFIVGIVEGALGALANIPSFSRLVIL
FT                   IMIHGVLTKLVNGVALGLGAPGILFAVFGHALIAAAEGLFSFVQSLRLVFYEVLSKFYE
FT                   GKGRLFQPLVLP"
FT   gene            525130..525804
FT                   /locus_tag="Pcal_0550"
FT   CDS_pept        525130..525804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07977"
FT                   /db_xref="GOA:A3MTL0"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTL0"
FT                   /protein_id="ABO07977.1"
FT                   /translation="MEVVAEITSSLNRDLILKKLAKLKTLVDKVDIPEAPGGKATAHSL
FT                   AVGVLAMQQGLEPIVHIRLLDVNKTGLKSLLGAARLLGLEYVVLLQGDPPAEGSPVRDV
FT                   TTEEAIAEAKKMGLKAGALLSLRREYAKRLEAGADFYLALHFSHKDQLRGLPRNVYPYI
FT                   IVETPKNAPLIQRLRQTAVPPQRAVELAEEIDGLVDAVIISAPGDFEALVEVLKQIKAS
FT                   HR"
FT   gene            complement(525785..526027)
FT                   /locus_tag="Pcal_0551"
FT   CDS_pept        complement(525785..526027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1777 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07978"
FT                   /db_xref="GOA:A3MTL1"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR036980"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTL1"
FT                   /protein_id="ABO07978.1"
FT                   /translation="MSPRCLDLLGREVSTYKCSYKVRGVVVGETYNTFLVLSGGRVVTV
FT                   PKAPCHFYIHDIGKLVNGIYLVGYRDRRLFTCGLL"
FT   gene            complement(526024..526263)
FT                   /locus_tag="Pcal_0552"
FT   CDS_pept        complement(526024..526263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0552"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: pai:PAE1778
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07979"
FT                   /db_xref="GOA:A3MTL2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTL2"
FT                   /protein_id="ABO07979.1"
FT                   /translation="MSERKLKPKALREMSPEERRELLNQLRAELVKLQTQRSRGFVEKP
FT                   GRIRQVRRMIARILTIERELAKAGARAEKGGAKA"
FT   gene            complement(526294..526956)
FT                   /locus_tag="Pcal_0553"
FT   CDS_pept        complement(526294..526956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0553"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: pai:PAE1779 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3-C-terminal
FT                   domain protein; KH, type 2 domain protein; SMART: KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07980"
FT                   /db_xref="GOA:A3MTL3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027488"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTL3"
FT                   /protein_id="ABO07980.1"
FT                   /translation="MSVAMSTAQRRLPVYKKILEENKKKWMIKEFLEYRLAKYGYIDSE
FT                   ILKTPLGTRIVIYAERPSRIIGRKGAIVKEVSSILANKLGVENPQIDVIDVSKIEAPEL
FT                   FPKVVAYRIANAMARGVRFRRVMFVAVRQLMEAGAKGFEIVVSGKLSTERAKFEKITYG
FT                   KLYKIGYDAKNRVRRAVVHVLLKPGIYGIEVRITPATLRYSDEYKIKPPTRPEAAAQ"
FT   gene            complement(527031..527726)
FT                   /locus_tag="Pcal_0554"
FT   CDS_pept        complement(527031..527726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0554"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: pai:PAE1785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07981"
FT                   /db_xref="GOA:A3MTL4"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTL4"
FT                   /protein_id="ABO07981.1"
FT                   /translation="MATVLVDLDGTLIPLDAWEPVFLEVCERIARQVGATAEEVWKRAR
FT                   RRNLELMRAFAVEAFDWQSLFRSVAEELGAREVPDLVEVLYKHIHTFRVNRGAFEALRR
FT                   LREAGHRVEIATNGLAVYQMVVIKHLGLDGLIDGVRTSDRFGCPKTCPQYFQGADVMVG
FT                   DNAVFDVYFPQRFGLLTIFYGDWDRAARVYGERLGVDLTSTRPDAEIDSLEELPEAVET
FT                   VLKRRLSKG"
FT   gene            complement(527711..528583)
FT                   /locus_tag="Pcal_0555"
FT   CDS_pept        complement(527711..528583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0555"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: pai:PAE1784
FT                   hypothetical 4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07982"
FT                   /db_xref="GOA:A3MTL5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTL5"
FT                   /protein_id="ABO07982.1"
FT                   /translation="MLVINISLLSPVASLLGLWRLIRGEHGVLAALASTASYMVAGGRS
FT                   LEAVALLAVSTFLAEAGLFAHNDLANLEEDRVNRPGAPLVTGEVGLGAARAVAYGSLSA
FT                   GALAAALLGLLPLVIYLSAAILGTAYNAKLKRVPFLGNFIVAFLTSMTYIYGMAAAGGF
FT                   SPVLALLFASSLVANLGREFVKTAIDVEGDLRAGVRTAASLLGPERAAKLGASVTALSA
FT                   AIGLWLVAAALDSRLYILATGAAATSVLLLYFSASAWRGAWERYRRGTLAAFGVTLVAL
FT                   VVEALWLLS"
FT   gene            528645..529151
FT                   /locus_tag="Pcal_0556"
FT   CDS_pept        528645..529151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0556"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: pai:PAE1782 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07983"
FT                   /db_xref="GOA:A3MTL6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTL6"
FT                   /protein_id="ABO07983.1"
FT                   /translation="MFKKYGVRITPEQIAKAYAPEQRMSWKKSVEVARFIKGMTLKQAK
FT                   AWLEDVVKLKRPIPIKTFKKKQAHHATPWEGWPVAKWPVKVAKRYLQLLENLENNAKFK
FT                   GLDVERLVIIHAAAHKGIKIPNIMPRAFGRATPFNEETVNVEIVAAELPKEVVPKRYKL
FT                   NLVKR"
FT   gene            complement(529148..529609)
FT                   /locus_tag="Pcal_0557"
FT   CDS_pept        complement(529148..529609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07984"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTL7"
FT                   /protein_id="ABO07984.1"
FT                   /translation="MHIEIRDPSLVERLRRLLPRPDAPFDDVIVKLLEQPCKLRIREIV
FT                   EEVFASANLEERVAKAVEQAVSRSVGDLERRVVHAVERAVRDFLRSLPAGELAGGGWDA
FT                   VIREAKRRPDGCLTFSEIRRLYGKNLNSVMLRKRGFVQRERGLWCLPKD"
FT   gene            complement(529659..530504)
FT                   /locus_tag="Pcal_0558"
FT   CDS_pept        complement(529659..530504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0558"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /note="PFAM: Conserved TM helix repeat-containing protein;
FT                   KEGG: pai:PAE1788 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07985"
FT                   /db_xref="GOA:A3MTL8"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTL8"
FT                   /protein_id="ABO07985.1"
FT                   /translation="MLLQFGIDWNQLLQNAIYYGVQALIAIGIIVIAWVVGIILGKAVN
FT                   RLVERTGLEKAFDKTDVGKAFRAAGVDLSNLVGMLVTAFVIVIGIVIALDYLKIGGEAG
FT                   RIVADVARYLPRLIGGIILLSVGIILVAILTDYIGKLLTGLFPQQFVEIGEMLRNLLLI
FT                   GLVALIVSIALDLMLFTGPLVYPLILGTVIIGAGIFIGHTIVRNIVEDHPEFAGVAPYA
FT                   KFLVYLVFLMVGLGAIFAEFPQTAHVVQNVAWGVAIAVGILLAPVIYTLAKRMVEEAKK
FT                   "
FT   gene            complement(530849..531061)
FT                   /locus_tag="Pcal_0559"
FT   CDS_pept        complement(530849..531061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0559"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07986"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTL9"
FT                   /protein_id="ABO07986.1"
FT                   /translation="MKGPDLKEVWTSKRKTPDGYYVVALGLYAKEALGLEAERVGKFYI
FT                   YKTKSWEEVKKIINRAKALGLEVRE"
FT   gene            complement(531066..531947)
FT                   /locus_tag="Pcal_0560"
FT   CDS_pept        complement(531066..531947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0560"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   beta subunit"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, beta subunit; PFAM: thiamine pyrophosphate
FT                   enzyme domain protein TPP-binding; KEGG: pai:PAE1558
FT                   2-oxoacid ferredoxin oxidoreductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07987"
FT                   /db_xref="GOA:A3MTM0"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTM0"
FT                   /protein_id="ABO07987.1"
FT                   /translation="MKIQLKPQDYAVNRPPIWCPGCGDYGILEALRRALAELSVPNHEV
FT                   VVVSGIGCSSQLPHFMKTYGIHGIHGRAVAIATGVKLANPRLKVVVVGGDGDGYGIGLN
FT                   HMIHAARRNVGLTYIVSNNQVYGLTTGQMSPTTLRGVKTKTTPFGAIDEPVNPLALALA
FT                   AGATFVARGFSGDIAHLTTVIKKALTHRGFALVDVLSPCVTFNRINTYDWFRARVYKLE
FT                   EAGHDPSNYYEAYKRALEWPTLDPYGKIPIGIFYATEDKPTYEEEWVKLLGGAPIDQKL
FT                   QPNPAEVLKAFQ"
FT   gene            complement(531944..533569)
FT                   /locus_tag="Pcal_0561"
FT   CDS_pept        complement(531944..533569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0561"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; KEGG: pai:PAE1559 2-oxoacid ferredoxin
FT                   oxidoreductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07988"
FT                   /db_xref="GOA:A3MTM1"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTM1"
FT                   /protein_id="ABO07988.1"
FT                   /translation="MDLTIRISGAQGEGVETVGRLLAKSFAQLGYHVFAYRQYGSIIKG
FT                   NPTMFYQVRVSDEKIYSHGTWRSYDVLVALNDKALQAHRGGARHVISESEIPFTEIAVK
FT                   HGDRIMRNTAALGALAALIGMELTPIEGVIRREFGERGEKIAEANIAVLRAAYDAALKR
FT                   LGSVYEVKRVGEPRVLMSGAEALAVGAVMSGMKFYAAYPMTPASPILHWLAEWGPKFGV
FT                   AVVQPEDEIAAINMAIGAAYAGVRAAVGTSGGGFDLMHEAFGLAAMIETPLVVFLAQRG
FT                   GPSTGVPTETEQSDLLMALSPSHGEYPHVVIAPRWIEEGLYATAKAFNIAEKYQVPVIV
FT                   LVDLYFTESLATVEFDPHRFKIERGELLQGPLVWEEYKRYKIAESGVSPRALPGTPGGM
FT                   HIATSDEHDERGDVITDTHQPAIRKAMHQKRMVKLTKIVEEMEPPMIQEGDVVALAWGS
FT                   TAMPLLDYAKGRKVGLALFRDLYPLSVDGWAQRLNEAKEVVAVELNYRGQFAEYLASKG
FT                   VKVTRRVLKWWGEPFSIDELGEWL"
FT   gene            533740..533858
FT                   /pseudo
FT                   /locus_tag="Pcal_R0009"
FT                   /note="tRNA-OTHER2"
FT   tRNA            533740..533858
FT                   /pseudo
FT                   /locus_tag="Pcal_R0009"
FT                   /product="tRNA-OTHER"
FT   gene            complement(534028..534201)
FT                   /locus_tag="Pcal_0562"
FT   CDS_pept        complement(534028..534201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0562"
FT                   /product="paREP10"
FT                   /note="KEGG: pai:PAE0648 paREP10"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07989"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTM2"
FT                   /protein_id="ABO07989.1"
FT                   /translation="MYGVLMASVLELLGPHAYGLWKYGVGPTDDVETAIIKLKATAPHL
FT                   AKFLSEIAQRRF"
FT   gene            534357..535595
FT                   /locus_tag="Pcal_0563"
FT   CDS_pept        534357..535595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0563"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="KEGG: pai:PAE1689 citrate synthase; TIGRFAM:
FT                   2-methylcitrate synthase/citrate synthase II; PFAM: Citrate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07990"
FT                   /db_xref="GOA:A3MTM3"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTM3"
FT                   /protein_id="ABO07990.1"
FT                   /translation="MGMSEQKVCIETSGKILQSPCGPIIHGLEDVLVKTTSITDIDGDR
FT                   GILWIRGYRVEELAAHGSYEEVAYLILRGRLPNRRELQEFSERLKASRELSPAAVEVLR
FT                   SLAKAHPMFALEAAVAAEGAFDEDNLKLAEALRAGRYKEEEKALAVKVAEKLVAKIPTM
FT                   IAYHYRFSRGLELVRPRHDLSHAANFLYMMFGREPDPLAVRGIDLYLILHSDHEVPAST
FT                   FTALVVASTLSDMYSAVAAAVGALKGPLHGGANEAAVKSYLQIGDPSKAKEVVEAATKP
FT                   GGPKLMGVGHRVYKAYDPRAKIFREFSQEYVKKFGDPQKLYAIAEAIEREVLSSPYFQQ
FT                   RRLYPNVDFWSGIAFYYMGVPYEYFTPIFAASRVVGWVAHILEYWENNRIFRPRACYMG
FT                   PHDVPYVPIDQRS"
FT   gene            complement(535592..536896)
FT                   /locus_tag="Pcal_0564"
FT   CDS_pept        complement(535592..536896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0564"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: malic enzyme domain protein; malic enzyme,
FT                   NAD-binding; KEGG: pai:PAE1688 malate oxidoreductase (mae)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07991"
FT                   /db_xref="GOA:A3MTM4"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTM4"
FT                   /protein_id="ABO07991.1"
FT                   /translation="MADKWYRLSVEVHKKYGGKIAVMPKVPIRSMDDFAIYYTPGIAEV
FT                   SRRIHEEPDLSFELTSRWNVIGVITDGTRVLGLGNIGPEAAYPVMEGKALIFKYLGGVD
FT                   AIPLPIRVKTPEEFLFVAQALEPALGGINLEDIESPKCFYLLEELRKRVKIPVWHDDQQ
FT                   GTATATLAALINALKIVGKKISDVTIALIGAGASNIYTANILIKYGAKPGNLIMVDSRG
FT                   ILHPEREDIDKMMIENPWKYKYAIETNAERRKGGIPEAMKGVDVVIAASRPGPGVIKKE
FT                   WVASMNKDAIVFALANPVPEIWPWEAKEAGARIVATGRSDFPNQVNNSLIFPAVFRGAL
FT                   DVRATTITDEMLIAAAEEVAKFAEERGINEEYIIPKMTEWEVYVREAAAVAATASAQRV
FT                   ARIPKSYKEELEHAREIIGKNIRLVELLMKEGIIA"
FT   gene            536939..537334
FT                   /locus_tag="Pcal_0565"
FT   CDS_pept        536939..537334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE1687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07992"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTM5"
FT                   /protein_id="ABO07992.1"
FT                   /translation="MNTNNNKLRIHITIYSSTLNSDMIMLKSKKSSIIKNIPSQRKNVY
FT                   LSKLKNTKKVIRVKIVNIYGRRIEIDKEVYKSGWLVFPRHRYAAGVVLFGKFGIVSAPS
FT                   LPSTSALFVPLDLPIIHLLDVVVDDFY"
FT   gene            complement(537413..538429)
FT                   /locus_tag="Pcal_0566"
FT   CDS_pept        complement(537413..538429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0566"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase;
FT                   3-dehydroquinate synthase; KEGG: pai:PAE1685
FT                   glycerol-1-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07993"
FT                   /db_xref="GOA:A3MTM6"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR023002"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="PDB:5FB3"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTM6"
FT                   /protein_id="ABO07993.1"
FT                   /translation="MKKVERFEVPRTIIFGPGALEKTPEVIPPSGRVLIITGKSSTRKY
FT                   AERVAELLKQNCEIISYDQVELEKPGFDLVIGIGGGRPLDMAKVYSYIHKKPFVAIPTS
FT                   ASHDGIASPYVSFSLTQRFSKYGKISSSPVAIIADTSIILSAPSRLLKAGIGDLLGKII
FT                   AVRDWQLAHRLKGEEYSEYAAHLSLTSYKIAVGNAQKIKNFIREEDVRVLVKALIGCGV
FT                   AMGIAGSSRPCSGSEHLFAHAIEVRVEKEDEVVHGELVALGTIIMAYLHGINWRRIKRI
FT                   ADIIGLPTSLRQANIDVDLALEALTTAHTLRPDRYTILGDGLSREAAKRALEDVELI"
FT   gene            complement(538416..538970)
FT                   /locus_tag="Pcal_0567"
FT   CDS_pept        complement(538416..538970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07994"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTM7"
FT                   /protein_id="ABO07994.1"
FT                   /translation="MPKALLYVIDTAKRDEYPTLKNFLVKGGYEVDVAVGSRDVNVNYT
FT                   VDLMTLPSDKLPTLFEEYDAFALAGGFKIYYHVLQKKPPLKIWDLNIDKERLAQLVVEF
FT                   NRRRKLLIAPMAVPAYVAQLGLLSGRHATVYPVTELIKILRDNKVNFVNKQVVRSENII
FT                   TVKDITTTSEKEFLAALREKG"
FT   gene            complement(539217..539870)
FT                   /locus_tag="Pcal_0568"
FT   CDS_pept        complement(539217..539870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0568"
FT                   /product="3-hexulose-6-phosphate synthase"
FT                   /EC_number="4.1.2.43"
FT                   /note="PFAM: Orotidine 5'-phosphate decarboxylase; KEGG:
FT                   pai:PAE1679 D-arabino 3-hexulose 6-phosphate formaldehyde
FT                   lyase, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07995"
FT                   /db_xref="GOA:A3MTM8"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTM8"
FT                   /protein_id="ABO07995.1"
FT                   /translation="MKLQVALDLVDLRKAIALTRDLCEVGLEIVEAGTPLIKMYGLPVV
FT                   GALKAACPRAEVVADLKTADVGALEASLAREFGADWATVLGATNMETIEEFVREGKRIG
FT                   LKTAVDLIGVANPVERAKEILRVATPDLFVFHLGIDVQKRAGLRFEELLDLAYRVKEGG
FT                   VGVGIAGGLTEKEIEYVVKSGKSIDIIIVGRAVTQADSPKTKFMTINNILKSKS"
FT   gene            539916..540359
FT                   /locus_tag="Pcal_0569"
FT   CDS_pept        539916..540359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0569"
FT                   /product="archease family protein"
FT                   /note="PFAM: protein of unknown function DUF101; KEGG:
FT                   pai:PAE1678 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07996"
FT                   /db_xref="GOA:A3MTM9"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR022952"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTM9"
FT                   /protein_id="ABO07996.1"
FT                   /translation="MSCRKPANYRYGEHTADVLVQAFGCTLEEAFKNAAVALADLTYYS
FT                   ERVEPRMAKKVEVEYDDLEGLLFKWIDELLFLFDAEKFAWGRNIEVELRQGVGYRISAT
FT                   LHGEMYDINKHGFTGLIVKAMTFHMMEIKKVDDYWVLQYVVDI"
FT   gene            540356..540751
FT                   /locus_tag="Pcal_0570"
FT   CDS_pept        540356..540751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0570"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: pai:PAE1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07997"
FT                   /db_xref="GOA:A3MTN0"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTN0"
FT                   /protein_id="ABO07997.1"
FT                   /translation="MRLDEVGERIVLPTPVRTVKQAAQAVGVSEDKIVKTLVVKCGEEY
FT                   RAYILRGTKRLDLDKLGCRMATPGEVAEVTGYNVGGVPPVLRIPVYIDRELLAEDYVYG
FT                   GGGDEYSLLRFRPAELVERGLATPVDI"
FT   gene            540852..541133
FT                   /locus_tag="Pcal_0571"
FT   CDS_pept        540852..541133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0571"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE1674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07998"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTN1"
FT                   /protein_id="ABO07998.1"
FT                   /translation="MARFNLCIGNFNLADRNHVEAAVATTYRCPLCGGALELMEDGRYL
FT                   WFGCWRCKIYVRREKGELAKKFVDYRRRRFMWSQMMEELYRIFMSPVG"
FT   gene            complement(541130..541489)
FT                   /locus_tag="Pcal_0572"
FT   CDS_pept        complement(541130..541489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABO07999"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTN2"
FT                   /protein_id="ABO07999.1"
FT                   /translation="MDEIDNILRKKALELAKTQLREVAQPQRKTLTDEEVIRIVRQITK
FT                   GDRAEEIINNALELYKPYVLPLFRKIAELHLQGVIKELADYELYQMLLRAGLRVPVKTE
FT                   VRIVRHGREYKLGGD"
FT   gene            complement(541517..543064)
FT                   /locus_tag="Pcal_0573"
FT   CDS_pept        complement(541517..543064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0573"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   PFAM: tRNA synthetase, B5; KEGG: pai:PAE1669
FT                   phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08000"
FT                   /db_xref="GOA:A3MTN3"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTN3"
FT                   /protein_id="ABO08000.1"
FT                   /translation="MPVIDVAKFDLERLVGLRFEEIVKLLEYVKCEIEEDVGERVRLEV
FT                   THDRPDHFSAEGLARTLKGVAGVETGLPVVSLTTSSVKLVADYIEERPYISMAVVRDVA
FT                   LDDEAIRQLIQLQEKLHETYGRGRRKIAIGFYDVSKIKPPIRYTRVSRDDEYTPLGFTS
FT                   PIPIREMYEKTEQGRKYSQLINRENPPALVDAAGQIMVVVPVLGSECCKITEKTRAVLI
FT                   DVTGTDLQAVSNAMSVLIYALIERGRSKEVEIVEGGNTYVHRYTRIKVSKEDVENLLGM
FT                   RMRQEEFERYLGKARLGYEAGEAVAPPYRINMLSWVDVAEEVAIVLGYNNLPLETPPIF
FT                   TAGRRHKTEIFTEELRKTLLAMGFAEVNNYVLTSGVVTTFCKPATVLNPISELYDTVRC
FT                   SIIPQLIATAALTRRKEVKLFEVGDVVREGRTRRTLTLLISREGATLTDGLSVVKTLCR
FT                   LHGLTCEIGPTAAEWALPNRSAAVRGDVEGYVAEVNPQILISLGYTVPTVVAELFVD"
FT   gene            543070..543408
FT                   /locus_tag="Pcal_0574"
FT   CDS_pept        543070..543408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08001"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTN4"
FT                   /protein_id="ABO08001.1"
FT                   /translation="MGKCKYKKRKLVIGMRQQVEQYFRELQGKIDAEAFTVEWRQHEAL
FT                   AQIQLGDDFYLFIIFSWSDNDCVVEYMIGDENAVIQARHLDKLDQAVATLKLAHRLATE
FT                   KFSCLRPS"
FT   gene            complement(543374..543976)
FT                   /locus_tag="Pcal_0575"
FT   CDS_pept        complement(543374..543976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08002"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTN5"
FT                   /protein_id="ABO08002.1"
FT                   /translation="MGFAKRLKMRLSDLIRLEKPDLLSSRYGKAFEKAVLILIKAKDSV
FT                   AAIRTFIEHYGEPHTGAFNKLLKLTPWAKKVVEIEPAPPVSLSLDGVTISAQADFIVKY
FT                   ADGKKELVELKSHILKKGEWKTKAEWSLATKIMRMLYRRSGYDYPLRLIYFVERGDGVV
FT                   VPEEEVFIYPNDDKDDEVLINVLRERIRKALGRKTSQ"
FT   gene            544028..544969
FT                   /locus_tag="Pcal_0576"
FT   CDS_pept        544028..544969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0576"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="KEGG: pai:PAE1659 C-5 cytosine-specific DNA
FT                   methylase; TIGRFAM: DNA-cytosine methyltransferase; PFAM:
FT                   C-5 cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08003"
FT                   /db_xref="GOA:A3MTN6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTN6"
FT                   /protein_id="ABO08003.1"
FT                   /translation="MNVVDLFAGGGGFALGFRQAGFRILTAVEIDRDAARTYSFNHPDV
FT                   VVLQEDIRDVDYKDLEAWGKVDVVIGSPPCEPFTAANPNRMDDPADRLYVDPAGQLTLE
FT                   FIRLVGELGPKIFVMENVAALAEEPLRTYLEKEFKRWGYEVYFNVLHAEDYGVPSRRRR
FT                   VFVSNVEIRPSKTGVVTVRKAIYSMPPPDSGLLPNHESVAISPRKQERIMRLRPGEALM
FT                   KYRGAGGFYENYIRLVWDDVAPTVMGSRRFVHPEEHRVLTVREQARLMGYPDYYVFFGS
FT                   KDSQFNQVGESVPPPLAYAIAVEVKKYLERRE"
FT   gene            544974..545831
FT                   /locus_tag="Pcal_0577"
FT   CDS_pept        544974..545831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0577"
FT                   /product="NMD3"
FT                   /note="PFAM: NMD3; KEGG: pai:PAE1653 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08004"
FT                   /db_xref="GOA:A3MTN7"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTN7"
FT                   /protein_id="ABO08004.1"
FT                   /translation="MAKVPCPSCGRLVDKLIEGLCEDCYIERHPLVEYREGEILRCKYC
FT                   GAVFLKGKWMRGRGDQVFLKILSEKGKVVGKVEQIDARDFTDYAELFLTLHGSPHPEIP
FT                   PRTLKYNIRIPFKLDICNVCMEKLSKREVAVLQIRASPRPLDAEFKKKILHIVEQELLK
FT                   LKSKKIGFVSSIKEAASGIDIYTTSANLARHLARVIHETWPSYAMETAKVVGIRDGKKV
FT                   YHMTYLVRLFTYRVGDLIIVGGSEKVVTELNNKYIGVRDVQSGGYEQIPISDFVHKTVL
FT                   YKGS"
FT   gene            545863..546336
FT                   /locus_tag="Pcal_0578"
FT   CDS_pept        545863..546336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0578"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pai:PAE1652 N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08005"
FT                   /db_xref="GOA:A3MTN8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTN8"
FT                   /protein_id="ABO08005.1"
FT                   /translation="MYPTVVIRPARREDLDAITQLIVRLKRLNAEFDPLLEVVPEIVEA
FT                   SRKYVENALESPSSVVLVAVEGDRIVGVFKGDVEDRIFYKPRYAGVIREFYVLPEYRRK
FT                   GIGKRLMMEGIELLRKKGAELIMASFPALNEIAVNFYKKMNFRPIEYLFAKEI"
FT   gene            complement(546340..547656)
FT                   /locus_tag="Pcal_0579"
FT   CDS_pept        complement(546340..547656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0579"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.42"
FT                   /note="TIGRFAM: isocitrate dehydrogenase, NADP-dependent;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase; KEGG:
FT                   pai:PAE1651 isocitrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08006"
FT                   /db_xref="GOA:A3MTN9"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTN9"
FT                   /protein_id="ABO08006.1"
FT                   /translation="MSINLDKLRESIPNLVPYNGKYVEPPEGEYVQYTGPGQLKVPDKV
FT                   VIGYIEGDGIGPEVAYAAIRVANAAVEKAYGKARKIIWYEVVVGEKAEKLFGNRLPDQS
FT                   IEVLKKVKVFLKAPLETPVGGGFRSINVTLRQLFDLYANIRPVKYFPGLPSPLKKPQVD
FT                   LVIFRENTEDVYAGIEWPYNSPEAAKLREFLKREFGISIRDDAGIGIKPISKFGTQRIA
FT                   RLALKFAVENKRRVVTVMHKGNIQKYTEGAFREWAFEVARNEFRDYVVFEDELAQYGGK
FT                   VPPGKILVNDRIADNMLQQLLTRTNEYDVILAPNLNGDYVSDEAAGLVGGLGVAPGLDV
FT                   GDWGMMAEPVHGTAPKYRGKNYVNPTATILALELLLRFMGWREAADLIMKGIEKAYTEG
FT                   YFTGDLARQMDEEERKQRVKEVLGTQEFADKVVELIKEL"
FT   gene            547752..548423
FT                   /locus_tag="Pcal_0580"
FT   CDS_pept        547752..548423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0580"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   pai:PAE1650 enoyl-CoA hydratase, probable"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08007"
FT                   /db_xref="GOA:A3MTP0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTP0"
FT                   /protein_id="ABO08007.1"
FT                   /translation="MAEGSGRPVVVTLEGEKRNAFTYRLIEKLLGIECKDITVITNSGN
FT                   VFSSGLDLSVFLQGRDAVLEYLFRIHRLVKKLLSCEGRLIAVVNGDVYGFGVEFLYFMD
FT                   YVVAAKRDYKFSLQGVNLGVFPPYTAAVGRRLFAPAHLRVVLNREFTAEEAFHFGIVSQ
FT                   VGDLELKKLFSPPAYVAEVVSHRRWLVSFVDEAIPVFYKLAEVATREETVKRLREFFKK
FT                   S"
FT   gene            548449..549618
FT                   /locus_tag="Pcal_0581"
FT   CDS_pept        548449..549618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0581"
FT                   /product="TGS domain protein"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; TGS domain
FT                   protein; KEGG: pai:PAE1649 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08008"
FT                   /db_xref="GOA:A3MTP1"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTP1"
FT                   /protein_id="ABO08008.1"
FT                   /translation="MPANLPAEAKAAWLKVMEAKTPEDKLKALEEFLSTVPKHKGTEKL
FT                   IKQVRRRIAELRREIQERREKERSLRSGGGSRLYVSKEGDLQVAVVGPPSSGKTALIRC
FT                   LTNTPLQPDDIPFSTVEPVPSMFIEDGVYVQLVKTPSILVQQQSDVNVITLASVRNADA
FT                   VILVVDSGVELETVERLISYFEDEGIYLYQPRNYVKIERRGLGGIQILGSGRVVGKTLN
FT                   DVKKLLNEYGIYHAVVYINGEVTLDDVEEALYIERQYKPTIVILSKRDLYKPRGEVLEY
FT                   LNKLGIPYYEANLASCDISRRSLLENLLRLTGRIRVFTKPIHMKTYMEKPLVVKAGSTV
FT                   GDVANQIHSSLVKTFKYAVVWRRENFPNWPKRVGLDYVLQDGDVVEIHA"
FT   gene            549615..550052
FT                   /locus_tag="Pcal_0582"
FT   CDS_pept        549615..550052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08009"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTP2"
FT                   /protein_id="ABO08009.1"
FT                   /translation="MSCDEVKKILERLDEIEILLNTLLEEVRELKRGTSAREERPRAFI
FT                   EVLREKKLLPLSEVKSRQALRQALEKGLVVVLRDEGANREVVVLKEAARKLLDKLPMSA
FT                   KDVEKLDERDYELLQLLNRLGYVLQKGGQYIKTELAEEFYV"
FT   gene            550049..551023
FT                   /locus_tag="Pcal_0583"
FT   CDS_pept        550049..551023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0583"
FT                   /product="replication factor C small subunit"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_3; ATPase
FT                   associated with various cellular activities, AAA_5;
FT                   Replication factor C; SMART: AAA ATPase; KEGG: pai:PAE1646
FT                   replication factor C small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08010"
FT                   /db_xref="GOA:A3MTP3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTP3"
FT                   /protein_id="ABO08010.1"
FT                   /translation="MSELFWFEKYRPRSFEEVVDLEEVKARLREFVKAGNLPHLLFYGP
FT                   PGTGKTTMALVLARELYGEYWRENTLELNASDERGIGVIRERVKEFARTAPVGKAPFKL
FT                   VILDEADNMTSDAQQALRRIMEIYAQNTRFILLANYVSNIIEPIQSRVVMIRFNPLPKE
FT                   AVISRLRFIAENEGVKVSDDALEAIYEFTQGDMRKAINALQVAASVSREVTEEEVAKAL
FT                   GMVSPRLLREVLQEATKGSFNKALTQIYGFVVDGGVGELEIIRQLHREVLRLDVPEYVK
FT                   PELVYIVGRAHYAILRGARGLAQIYGALAKIRKIVVFHQPSVK"
FT   gene            551063..552058
FT                   /locus_tag="Pcal_0584"
FT   CDS_pept        551063..552058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0584"
FT                   /product="Transcription initiation factor IIB (TFIIB)"
FT                   /note="PFAM: Zinc finger, TFIIB-type domain protein;
FT                   Transcription factor TFIIB, cyclin-related; SMART: Cyclin;
FT                   KEGG: pai:PAE1645 transcription initiation factor IIB
FT                   (TFIIB)"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08011"
FT                   /db_xref="GOA:A3MTP4"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTP4"
FT                   /protein_id="ABO08011.1"
FT                   /translation="MSTATPPGKPLKFRIHRDSEGYLSLVSETGEVYSCPVCGNDKFVY
FT                   NYERGEVVCIVCGTVVQEQLLDLGPEWRAFTSEEKGQRARTGAPLTRLISEALTTVIDW
FT                   RDRDVSGKELDIKRKLEVIRLRKWQTRARVQTSYERNFIQAAQELERLKSSMGVPRPCV
FT                   EQALEIYRQALEKELVRGRSVEAMAAAALYMACRMLKMPRPLDELVRYTKASRREVARC
FT                   YRLLLRELNVKVPISDPVLYISRIAEQLKLSGEAIKLAIDILQKAKKAGITAGKDPAGL
FT                   AAAAVYIASLMLGDNKTQKDFAVAAGVTEVTVRNRYKELAKALNIKVPIK"
FT   gene            552069..552377
FT                   /locus_tag="Pcal_0585"
FT   CDS_pept        552069..552377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08012"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTP5"
FT                   /protein_id="ABO08012.1"
FT                   /translation="MLSVDVPPEPFNGGHLVLKTGKPVFDLTFSELVMLKQKIDRILAA
FT                   EREKLRPEGFNIYINGNEVHIIPRWCGDVNVAFFGGIKVVPLSNEDVVRLLGDEFNN"
FT   gene            552361..552699
FT                   /locus_tag="Pcal_0586"
FT   CDS_pept        552361..552699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08013"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTP6"
FT                   /protein_id="ABO08013.1"
FT                   /translation="MNLTIEILSSLIIVAFGIYVTQRVQHDYKLVNIFRQYTLPSVVRP
FT                   GGIVDLSKLKIFVQNFNYKIETNGNLVIEVKNDIINVISGTGSITIVFEAWGFLDFYRI
FT                   VRSIKVIT"
FT   gene            complement(552701..553009)
FT                   /locus_tag="Pcal_0587"
FT   CDS_pept        complement(552701..553009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08014"
FT                   /db_xref="GOA:A3MTP7"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTP7"
FT                   /protein_id="ABO08014.1"
FT                   /translation="MHRALLVIALFKFLVALVAFTITSRIDPVLLVSCVLMAISSIIVR
FT                   VVEEGEVAIVLVGLILLIDSIGVLLSFTQVSILYVLTYIFFIVWDIQILMLFRQLIQ"
FT   gene            553085..553558
FT                   /locus_tag="Pcal_0588"
FT   CDS_pept        553085..553558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0588"
FT                   /product="LSU ribosomal protein L13E"
FT                   /note="KEGG: pai:PAE1639 ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08015"
FT                   /db_xref="GOA:A3MTP8"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018256"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTP8"
FT                   /protein_id="ABO08015.1"
FT                   /translation="MIPKPVVQVPRSIKSGGVTKWKEGRGFSLGELKEVGLNAEQARLL
FT                   GLPVDTRRDSVWPQNVEALRKWLIEVLEGKATPPEPTLPKVVKVKRKRGRAFRGLTSAG
FT                   RRSRGLISTRFRETHNYKFKKKAKERRLKKRHEATKGLGNVLRISRIINESKE"
FT   gene            complement(553566..554285)
FT                   /locus_tag="Pcal_0589"
FT   CDS_pept        complement(553566..554285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0589"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   pai:PAE1638 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08016"
FT                   /db_xref="GOA:A3MTP9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017271"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTP9"
FT                   /protein_id="ABO08016.1"
FT                   /translation="MDNEHRHIAIYIAGDIITSDNPGEVIKKWRLVFGLTQTALATRLN
FT                   TSPSVISDYESGRRKFPGSRFIRKFVQALIEADLERGGHVLNLLQRQLLRERFWTAVID
FT                   MREFTEPVPISTFLQSIEAEVLVPPPQTLDIYGYTIVDSVKLVLEVPSVEYVRLYGGTS
FT                   QRAAIFTKVSTGRSPIIAIKSMSAVLSVKPSIVVLHGIKQETVDPLAVEIAKRSYIPLA
FT                   VTNITLEKMIENLRRFK"
FT   gene            554378..555367
FT                   /locus_tag="Pcal_0590"
FT   CDS_pept        554378..555367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08017"
FT                   /db_xref="InterPro:IPR039604"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTQ0"
FT                   /protein_id="ABO08017.1"
FT                   /translation="MLSREELLAKIREINSQLDEIQKNIDAVTNEINSKRALLDEIRKQ
FT                   LAEVRSLIEGKREQLQKTRELIGSLVERKSQIINQIRSLRAELLQTNINLQKYREKLVV
FT                   YRNLLSTLNEYVGGKVPEKEKLKRLIEQLEYLFETSPTNPEWERQFIKYISQIERELNV
FT                   VDSMEKVRAHIAELKSQADALKNRREAIRNEIAKLVQDLSTIKQEIAQLKASRQEIYKE
FT                   LASLKEKREELKKRREEIKQEILQLALRRKELREKRRSVQEELEKYNVLLKALELAERS
FT                   KAKAQVQARVTQSLKERAEAIFNKLMNGERLTHEEIKILIEAGYLPEE"
FT   gene            555367..556374
FT                   /locus_tag="Pcal_0591"
FT   CDS_pept        555367..556374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08018"
FT                   /db_xref="GOA:A3MTQ1"
FT                   /db_xref="InterPro:IPR007254"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTQ1"
FT                   /protein_id="ABO08018.1"
FT                   /translation="MRLLVLYVDRDGDLKAHGIDTPIVGRDEVLRAGIKYILMNPDDSD
FT                   ANAIFAAVKTYDKLVSEYGEGNVNVAIVSGSPDPALADLTVVKELEEVLALFDADAIYF
FT                   ISDGPTDEMSVHAIQIKRPVIAVYRVVVKQARGVEETVTLFKYYFDKAVREPQYRRYTV
FT                   GVPALLAFVILLSSMANLEIVRILINMTFLFISFFLVVYGFGIYDFLRNVLKRFEITFI
FT                   ITLFSLFAIVYHIVFTIIGSSILPDYLAVIVATLPFVSYVTESYIRTKSVRYGGIVAGS
FT                   IASSFFYFIFPKITKPIIDIFDLMFSIAQYISTIFIIIILVYLLRGKWRRAELR"
FT   gene            556350..557027
FT                   /locus_tag="Pcal_0592"
FT   CDS_pept        556350..557027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0592"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; KEGG: pai:PAE1634
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08019"
FT                   /db_xref="GOA:A3MTQ2"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTQ2"
FT                   /protein_id="ABO08019.1"
FT                   /translation="METCRVEVSKRFHCLAVEEALALAEIGGCVLKERGESLEFVCPSC
FT                   QVFHRSALIKSVNGERIKRHLPTLVRSPKTLDYVTARLLVNLARVMPGSVVWEPFVGTG
FT                   AIAYEVERVGGHVVGTDVDLGALRIARLNVRGDLLLSDALRPPFSKVFDAVVGDPPYGR
FT                   LTKSTMEVRALLNAFIEVAFSHVKRGGYVVLASPIYVDLPYLRSCVMYLHGGLYRVVYF
FT                   VKL"
FT   gene            complement(557024..557455)
FT                   /locus_tag="Pcal_0593"
FT   CDS_pept        complement(557024..557455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0593"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="PFAM: Protein of unknown function DUF54; KEGG:
FT                   pai:PAE1632 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08020"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTQ3"
FT                   /protein_id="ABO08020.1"
FT                   /translation="MRVEAVVEVRLTEDKKKVLKALENVFTPVNIREEPSDVGVVLIST
FT                   CDGHKCLEKLRGAIWRQGIQDAARSVISKGVVGEDTVIFSINKQAAYVGVVSFVTEPGE
FT                   SPLGPITFTVKTSNVRQFIDWLAPRTYRGKVYYEAPPPD"
FT   gene            complement(557452..557955)
FT                   /locus_tag="Pcal_0594"
FT   CDS_pept        complement(557452..557955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0594"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: pai:PAE1629 adenylate kinase, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08021"
FT                   /db_xref="GOA:A3MTQ4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTQ4"
FT                   /protein_id="ABO08021.1"
FT                   /translation="MQFVAVAGLPGSGKTTVAKIVEKRGYVYMSMGDVVRAVAQKTGMT
FT                   PDKVAVFMRLEKGRRAVVKHILETAKGERFVIDGLRSPEELDALEEVGKTFLIYVVASK
FT                   RTRYTRLYSRGRSDDPLTYSQFLMRDLRELKFGLADLLARADYIVVNENKTIEQLEEEL
FT                   SLVI"
FT   gene            complement(557958..559034)
FT                   /locus_tag="Pcal_0595"
FT   CDS_pept        complement(557958..559034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0595"
FT                   /product="N(2),N(2)-dimethylguanosine tRNA
FT                   methyltransferase"
FT                   /note="PFAM: N2,N2-dimethylguanosine tRNA
FT                   methyltransferase; KEGG: pai:PAE1628
FT                   N2,N2-dimethylguonasine tRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08022"
FT                   /db_xref="GOA:A3MTQ5"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="InterPro:IPR022923"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042296"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTQ5"
FT                   /protein_id="ABO08022.1"
FT                   /translation="MDDYVIRREGKAVFYAPNPKKYDIYSAPVFYNPAMEKNRTLSVLL
FT                   LKVAGAQMGGGLTVCEPLSGTGIRGIRYVIESGVVGKLILNDLSKEAVHVIQKNLSING
FT                   VEADVYNEDANVLLHKLRGQCDVVDVDPFGSPAPFLSAAFRALKNEGIVCATATDTAVL
FT                   VGRYPRKCLRRYGSVIRKSPFYLEMGLRNLVGYVARIAASEDFAIRPLLSYWEGHYFRT
FT                   CVYAVKSAKDADDMLQRDVGYVEYRRYRKVTRRQSEYTSGPVWIGELGDPSIAFFMARE
FT                   GQYSDFLKLLEEEYSVSLPWFYKLPEFAVDGKSPTLEEAMAALRRAGVYAARTHMASDG
FT                   FKAEATYGEVERVLRRVT"
FT   gene            complement(559027..559773)
FT                   /locus_tag="Pcal_0596"
FT   CDS_pept        complement(559027..559773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0596"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: regulatory protein, MerR; helix-turn-helix
FT                   domain protein; Resolvase helix-turn-helix domain protein;
FT                   KEGG: pai:PAE1627 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08023"
FT                   /db_xref="GOA:A3MTQ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR020886"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTQ6"
FT                   /protein_id="ABO08023.1"
FT                   /translation="MKLLEATLNIVKARGEPLFLDVSRPYAYTLVAEINRERMLIRIAQ
FT                   NAEDVSGSSIKDLKLLSSYTNVTSLCITSTVRGEVLRRGVVYTRDNITFISLSTFTDLV
FT                   DGKPPIFRLNHGSITAAVDGKKLRQRREEAGISLGALAKELGVSRETVYRYEREEIEAP
FT                   AKIAQKLIDMFGEDVIKKISIDKVHVSAEELASRSLGKDTYKLVDSHPDALRVQDRVLF
FT                   ISTSADKFQKTVELANALGVEVEKSG"
FT   gene            559988..560494
FT                   /locus_tag="Pcal_0597"
FT   CDS_pept        559988..560494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0597"
FT                   /product="RNA-binding protein, containing PUA domain"
FT                   /note="PFAM: PUA domain containing protein; KEGG:
FT                   pai:PAE1626 PUA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08024"
FT                   /db_xref="GOA:A3MTQ7"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="InterPro:IPR022430"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTQ7"
FT                   /protein_id="ABO08024.1"
FT                   /translation="MRLSNREVRELREIYPHMGPVLDEAEVVEVVPLSGDSSLYLIDGE
FT                   PLFLKTSVKDVGEVVAPTLFFVHKSSKAKLLPQYPRAIVDAGAVKPIVNGADIMRPGIR
FT                   ELVGEFNRGDVVLVSDEKGRVIAVAVALFSKSEIVQMQKGKVLLNIHHLGDKLWQISLE
FT                   LAKKS"
FT   gene            complement(560471..561148)
FT                   /locus_tag="Pcal_0598"
FT   CDS_pept        complement(560471..561148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0598"
FT                   /product="putative serine/threonine protein kinase"
FT                   /note="KEGG: pai:PAE1625 putative serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08025"
FT                   /db_xref="GOA:A3MTQ8"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTQ8"
FT                   /protein_id="ABO08025.1"
FT                   /translation="MDTVYILASTLGGGLTHAVEVHRQLRELELELLPGGALLHNGVYV
FT                   VGKGTNSVVFRCKPRVGNLQLACKIRRGDSTRPSLALEGQYLHLANTVGVGPRLYTYSK
FT                   DVLAYRFINGVDIATWWKSATPEKRRSLVQDLLTQAFLLDEIGLSHNELARLRDHVLVE
FT                   EDKPIIMDFESASLGKSHNVTQVANGLSHLGLKPPLEALRRYKAAPCKDSFTEVLLGFL
FT                   SQL"
FT   gene            561180..561539
FT                   /locus_tag="Pcal_0599"
FT   CDS_pept        561180..561539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0599"
FT                   /product="Sjogrens syndrome scleroderma autoantigen 1"
FT                   /note="PFAM: Sjogrens syndrome scleroderma autoantigen 1;
FT                   KEGG: pai:PAE1624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08026"
FT                   /db_xref="InterPro:IPR009563"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTQ9"
FT                   /protein_id="ABO08026.1"
FT                   /translation="MEKERDVVKRIAQLVRAGATLTSYTCPVCGTVLVKLKTGELYCAN
FT                   CERTVVLVKSDEEAQQAVEVVQLREVRRIVFDKILQLGRELEKLSASEMVDHLRSMSIL
FT                   LDIYEKLSKIQSSKV"
FT   gene            complement(561514..562677)
FT                   /locus_tag="Pcal_0600"
FT   CDS_pept        complement(561514..562677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0600"
FT                   /product="glycosyl transferase, family 39"
FT                   /note="PFAM: glycosyl transferase, family 39; KEGG:
FT                   pai:PAE1623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08027"
FT                   /db_xref="GOA:A3MTR0"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTR0"
FT                   /protein_id="ABO08027.1"
FT                   /translation="MKYAVALLVVLAVYAYLAYSVASLGGVDGLPDGPGYISDEVWYVT
FT                   SARNILHDFFKTPASSPYYTTTWPCVSNATVVKTYKEIDAVTVVGNVTCYVRRGFPYPD
FT                   KEGILTYYNLEHPPLAKYVIALMEVVRDEPIFWRAPSVALGAGTLLLVYLTARRLTGRL
FT                   WALVTTTLMLFDSTFRAMAGIAMLDIYLAFFTALLTYFYVAGRDLATGAALGLAVSVKY
FT                   SGAFPIFGLAYLYAKKSLWKFVAVVLMATSVFLLVNMPMAAQLGLQRWLHEVLAAFAWH
FT                   TTSRPEGPIASTPLDWLIMRNSFALYLNPNIYAGGTPAYLLALIYAIYKRDDVSVLYIS
FT                   TYGGYWIVYALGNRTLYSFYTVHFSPIAHILLAQLLASVAKPWRTVS"
FT   sig_peptide     complement(562609..562677)
FT                   /locus_tag="Pcal_0600"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.946) with cleavage site probability 0.368 at
FT                   residue 23"
FT   gene            complement(562820..565753)
FT                   /locus_tag="Pcal_0601"
FT   CDS_pept        complement(562820..565753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0601"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   pai:PAE1617 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08028"
FT                   /db_xref="GOA:A3MTR1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTR1"
FT                   /protein_id="ABO08028.1"
FT                   /translation="MRHGDFKLGHTYSPHSVEKEVAEFWNSNGIFHKWRQWRGGPRFTF
FT                   LEGPPTTNGMPHVGHIRGRTYKDVVLRFHRLLGYDVWVQGGWDMQGMPVEWEVEKRLKL
FT                   RSKKDIEKYGLEKFALACNALVDEYLEQWKEWGTRRLGLWLDLDNAYETRKPNYLEYAW
FT                   RIVKKAHEMGLLTEDYRVLWFCPRCETSLSDHEVALGYEEREDPSIYVKFRVEGSENEY
FT                   LVIWTTTPWTLIDNEAVAVHPDYTYAKVEVGGERWWVAEQLVPKLMELWGIKEWKILEV
FT                   RRGKELQGLRYVHPFHEEVPERGTRPHYVVVADFVTLDQGTGLVHIAPGHGPEDFEVAK
FT                   KYGLKVTNSVEVNGVYNELAGKFAGKYVHDVDKEVIDELKKKGLLVYAEKIRHEYPHCW
FT                   RCGTKLILRADRQWFIAVSKIREKMYAELQRVNVVPQKLRDRFDVFVQNARDWNISRSR
FT                   VWGTPLPVWRCKKDGRILVVGSIEELKRLAKELPPVDDFKLVHRPWIDSVVLKTEDCDE
FT                   WAREPYVMDVWLDSGVAWIAAVDGERNRELWTQLFPYDFVTEGIDQTRGWFYSLLATSV
FT                   LYTGKAPYKTILIQGLILDKHGQKMSKSKGNVVWAKDLFEKYGADPVRLYILSKAAPWE
FT                   DLAFDPDEVKHVISDLNILWNVVKFADTYMSLDGFSKDKYPLEEWLNKALEEDKWLLSE
FT                   LNLLTIKVKEYLRNFEFHKAANLWREFVVETLSHRYIRLLRRRVWLEESTPDKYAAYSV
FT                   LFHVLKNVLIIGSVFVPFATEYLWQAFVRKYDKEAEESVHLAKYPEEGAVEEELIKVYD
FT                   ELFKVFSVLAEARNKAGIKLRWPIREAYVVGASYVDRYKEALKYLGNVKEVKVGKCPEG
FT                   YVKAAEEGVEVCIPGKLEPELFYEALSREIVRRIQVMRKEAGLQINDTIRVVVDTASDE
FT                   VKKAVELFRDYIMRETRAVELSVEHADEGKEWDILGEKVKISVKSAG"
FT   gene            complement(566310..566588)
FT                   /locus_tag="Pcal_0602"
FT   CDS_pept        complement(566310..566588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08029"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTR2"
FT                   /protein_id="ABO08029.1"
FT                   /translation="MKKRKEERRGPTLFDFVEDKKRERAEARDFSEEFLLFVKSRGSVT
FT                   KTEALQWAKSRGVTTAEFIRAVEKLVSEKKIRKRLNDEGELIYEAYG"
FT   gene            complement(566594..567256)
FT                   /locus_tag="Pcal_0603"
FT   CDS_pept        complement(566594..567256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08030"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTR3"
FT                   /protein_id="ABO08030.1"
FT                   /translation="MATVQRSITFPPIRLKKIDEYIAYVAKYRPSPHQLKSAGLDIGRG
FT                   RGDITRFLERVGVVASGDVVELTEVGKLLVSIRESIGVAVYHALLYQRVPQYRLLIDVV
FT                   KDGVGEFSHIYAEVNRRIAVISPTAWLNKVAFRTLLQIAQDLEAVRKMSSVYTYVGDPV
FT                   ERAVLQYFTSSAVKVGADYYTSLDRVLFKECGKLGPSGLYKVDVKCVIEKIYTSFVP"
FT   gene            567373..567954
FT                   /locus_tag="Pcal_0604"
FT   CDS_pept        567373..567954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0604"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1612 P.aerophilum family 453, possible
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08031"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTR4"
FT                   /protein_id="ABO08031.1"
FT                   /translation="MELKEAILQLLREKGELTTSDIVAILGQPRHRVLKILNKLYFEGT
FT                   VEPVKKNRKYYWRLASGYVAVAPLHFSIEPVLYIEGVVEPIYRRVDDRVDTFIFTRVRD
FT                   KEYWMCDCSTGYYIISDQPIDGCSCKLRHAFGERKLAMIYLPKELRFRYWRSYRYAEGD
FT                   VEFVILVPEDQDSPELVKKFESYSKEVKTS"
FT   gene            complement(567941..569884)
FT                   /locus_tag="Pcal_0605"
FT   CDS_pept        complement(567941..569884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0605"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: pai:PAE1611
FT                   helicase, possible DNA repair rad25"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08032"
FT                   /db_xref="GOA:A3MTR5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTR5"
FT                   /protein_id="ABO08032.1"
FT                   /translation="MPRFCVVINGVAVYREWQWDKIVKVKEELKRLGFKWDGSCWSTKT
FT                   RNLAVLSEVRRLLNLTGEEYLSLLSAFSFDVSGGAVAISGPLPEDLRRHVVASDGDVHV
FT                   VSLSGFLRSFVMESREISQVESFEEFVDLGVKRLLELLKGAQVWGNLDEAVKNAREIVL
FT                   ASDRLREAFNRRRSWRVAVVGPNYAKLNFLASGLLKRLAELKLKYNVVKKDGELEERDL
FT                   KLVKVEKGDTYLLKFPVFVRDRVVKILRELGYVAQLAEVEYPKVSYKREFSLFPFQAEA
FT                   VENWVAHGMRGTVIIPTGGGKTFVALEAMYRAGVSALVLVVTRELALQWVERIRKFLGV
FT                   QPGMLGGGERNVRDVTVAIYNSAVKYVDELVGRFGLVVFDEAHHVPAETFKEVALNIDS
FT                   PFRLALSATPEREDENEHLIFEAVGPPVYRASYRSMIESGLVVPVEHYRVYVKMDEEEA
FT                   RAYASLPPDNAILLRNVAAKSKAKIPVVLQIVSREVALGSKVLVFTQFIDQAEELYKRL
FT                   REAGIQAELITSEEGGREVALRRFSAGKSRVVVTTTVLDEGVDVPDADVAVVVSGTGSR
FT                   RQMIQRVGRVVRASPGKKVARVYEIVTRGTIEEALSEARHFDDFIEEAVCRRVLEKELA
FT                   ALLKKPTLSNWF"
FT   gene            569944..570843
FT                   /locus_tag="Pcal_0606"
FT   CDS_pept        569944..570843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0606"
FT                   /product="bifunctional phosphoglucose/phosphomannose
FT                   isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /EC_number="5.3.1.8"
FT                   /note="TIGRFAM: bifunctional phosphoglucose/phosphomannose
FT                   isomerase; PFAM: sugar isomerase (SIS); KEGG: pai:PAE1610
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08033"
FT                   /db_xref="GOA:A3MTR6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTR6"
FT                   /protein_id="ABO08033.1"
FT                   /translation="MLNDYLQWEKFILRGVEFPTRYRVDGDEVEITPSSRLYVSGMGGS
FT                   GVVGDLIRDFSIVWNWDVEVTVVKDYFLRARDGLLIAVSYSGNTVETLYSVEYAKKRRI
FT                   PTVAITTGGKLAQMGVPTIIIPKASAPRAALPQMLTAALHVVRKVYGIPIEIPEALEPP
FT                   NDPLIHKLMEDFQKRPTIVAPETMRGVAYRVKNEFNENAKIEPSVEILPEAHHNWIEGS
FT                   ERPIVALTSPHIPREHQERVKATLEILGGTLYVVEMSTRGVLTFLREVGVASIKLAESR
FT                   GVNPLATPRIEALKRRLQ"
FT   gene            570840..571448
FT                   /locus_tag="Pcal_0607"
FT   CDS_pept        570840..571448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0607"
FT                   /product="peptidase A24A, prepilin type IV"
FT                   /note="PFAM: peptidase A24A, prepilin type IV; KEGG:
FT                   pai:PAE1599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08034"
FT                   /db_xref="GOA:A3MTR7"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTR7"
FT                   /protein_id="ABO08034.1"
FT                   /translation="MIQELAAASLAALLSIAAWQDLKTREVDVWLFAAMAVPAAFLAWA
FT                   NWGNPFYYVSLAAGILLALFMRALGTGYADSLALAAVSTAPLPLPFLPTAFVVVIASAV
FT                   LLPATALWLYYKNRGKPCKMSLVERLTHVCISGAEYKEALARGTAFKYIVGEESDMERY
FT                   KPPEPPREEWIKAKYGIPYLVYLAAGYWAYLLWNFVLLR"
FT   sig_peptide     570840..570902
FT                   /locus_tag="Pcal_0607"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.627 at
FT                   residue 21"
FT   gene            complement(571445..572077)
FT                   /locus_tag="Pcal_0608"
FT   CDS_pept        complement(571445..572077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0608"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: pai:PAE1598 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08035"
FT                   /db_xref="GOA:A3MTR8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034331"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTR8"
FT                   /protein_id="ABO08035.1"
FT                   /translation="MPVRIIDHVYAQHLLTKLRDKSTKGIEFRKGLVRLGRIVGYELVK
FT                   TFPTRQVEVETPLGKATGVEIVGLDKVVIVQILRAAMPFVEGLLKAFPQARLGVVAARR
FT                   REEGGAISVEVFYSKVPQIEGDVVIVADPMLATGGTMIKAIEEVYKAGNPQRLIVASVI
FT                   ATPIGVDNVLSKYPHAEIYTVAIDPALNDRAFIVPGLGDAGDRAFSS"
FT   gene            complement(572079..574547)
FT                   /locus_tag="Pcal_0609"
FT   CDS_pept        complement(572079..574547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0609"
FT                   /product="peptidase M1, membrane alanine aminopeptidase"
FT                   /note="PFAM: peptidase M1, membrane alanine aminopeptidase;
FT                   PBS lyase HEAT domain protein repeat-containing protein;
FT                   KEGG: pai:PAE1597 aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08036"
FT                   /db_xref="GOA:A3MTR9"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTR9"
FT                   /protein_id="ABO08036.1"
FT                   /translation="MKYLVGRDFAFPEYLPRHPRSYDFDVVKMSLDVEVDLENGAVEGV
FT                   VKYVVRAKKSGAVVVLDAVDIEVLGVSHDYFYDGAKLEIRPEWKSGEQVEVVVRYRARP
FT                   RVGMFFVRRGKEVYMWTQGETEYNRYWVPLPDSPNVKFPWSVSITVPKPYVAGSNGVLV
FT                   EVKERGDKLVYVWEMRHPMSPYLLALAVGNFKVYKEKCGDVELEYYLPSYVGEEWKFSF
FT                   YNTCSIMQFLSQYLGVPYPYERYAQVVVPEFIYGGMENTTFTILTDWTIHDKHAQCPYS
FT                   GFPCLELEDFSSHPLVAHEMAHMWFGDLVTAKDWAHITINESFATFLEALWTERSKGRD
FT                   EYLYEIYTNFKIYLGEYSRRYSRPIVTNIYKIPDEVFDRHAYEKGSVVLHMLRSLLGDE
FT                   VFRRGLKTFLERYRYKAVDVEDLRKVFEEVSERDLEWFWNQFFYSAGHPVLKVSWNYSM
FT                   EDKAARVQIRQTQGEDSFPVYTLPLELKIVYEDGRREVKSLVLNDKELSFTLHGKPKYI
FT                   CVDPGFKILKSLDPQYPLESAVAMLEDEDLYCRLQAVEALKKNGSPKAVDALAKALRDN
FT                   FWGVASEAAKALGEVGTAEAVAKLIEAYPVVAHPRARRAIIEALGNTRRREAAEFLDRV
FT                   LHDVGESYYVRAEAARALGKTRWEFAEHSLRKALEYSSHLEVIKRGALEGLAELGSEEA
FT                   LRLVLKYAEEGVPTVLRMTAVQALAKFGPRREVLEVIRRALRDENFRVRYAAVAAALEL
FT                   LEPRLLPDLEERIERDLDGRIRRMAREVVEKIRKAMERGAEYQRLREEVEKLREEYRKL
FT                   LDRVARLERV"
FT   gene            complement(574591..575061)
FT                   /locus_tag="Pcal_0610"
FT   CDS_pept        complement(574591..575061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0610"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   pai:PAE1592 transcriptional regulatory protein,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08037"
FT                   /db_xref="GOA:A3MTS0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTS0"
FT                   /protein_id="ABO08037.1"
FT                   /translation="MTEEMKLTDRQFQLLNHLLQRAQPMRVYTVYGDQDEIARELGMTR
FT                   QALAIHLKRLKELGLVRTGREFVDITEKAVKLLKGQSNDVIILVKVEPKYRDKVYEAAK
FT                   KLPIEKALRLAGDFDLAVITQETVLDKVLDAINNMEGVKETKTFISIGAIKE"
FT   gene            575231..576499
FT                   /locus_tag="Pcal_0611"
FT   CDS_pept        575231..576499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08038"
FT                   /db_xref="GOA:A3MTS1"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTS1"
FT                   /protein_id="ABO08038.1"
FT                   /translation="MRYIALVLLLPLAVAGAAIIDVRDALGYPVQNATVCVEGLCKYTN
FT                   ATGLVEVPTGPVEIYVDGVLAWRTYAEGHVVATIYRVGEVAISPLPADGYVDIWVKLLN
FT                   GSYARLRINFRNNTLEREIPVGNVNYPAEIHIVSVAGRAVNTTVKTSLWELGADLAALG
FT                   IVKKCTISAREPVKAIYVYNGTNLVAVGQNVTLFTFNTAAYYAVVETDVVAPNGTRYRW
FT                   RIDVAKHCGGDVTPNASRLVVTAVDSAGAVRYDWAIRIANESFRGRAELWVLPNATYMV
FT                   EVDAVHTKRSVSVHVSRAVEEVTISVPTAYVEFRYQQPARWVYIIGNYTAREAMPRRVE
FT                   LPPGVYKVVVDLGGVNVTYTVSLRPGEVVTLTVERPPSSNETAQSYEGLSAATYALLVV
FT                   LATFVVVAVVILKKSTRRSFATL"
FT   sig_peptide     575231..575284
FT                   /locus_tag="Pcal_0611"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.949) with cleavage site probability 0.699 at
FT                   residue 18"
FT   gene            complement(576456..577232)
FT                   /locus_tag="Pcal_0612"
FT   CDS_pept        complement(576456..577232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0612"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="KEGG: pai:PAE1808 ABC transporter, putative;
FT                   TIGRFAM: FeS assembly ATPase SufC; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08039"
FT                   /db_xref="GOA:A3MTS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTS2"
FT                   /protein_id="ABO08039.1"
FT                   /translation="MHKLEVVNLRVAVGGREILKGVNLSVSSGEVVVVMGPNGSGKSTL
FT                   FQTIAGNPKYEVLDGDILLDGQSIKELAPEERFAKGIFVGFQSPVAVPEVRFAFLLQAM
FT                   ANVRMGKKLTDPNPQVLAQAQKIAAELGLRPDVFNRGVGAGFSGGEFKRAEVLQALLLK
FT                   PAFVILDEPDSGLDIDGIAAVGNAITKLASSGSGVLLSTHYARVLRFIKPTRVYVMVDG
FT                   RVALEGDETVIKRIEELGYQGYFKELQNFGELTSSK"
FT   gene            577305..578726
FT                   /locus_tag="Pcal_0613"
FT   CDS_pept        577305..578726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0613"
FT                   /product="Iron-regulated ABC transporter membrane component
FT                   SufB"
FT                   /note="TIGRFAM: FeS assembly protein SufB; PFAM: SufBD
FT                   protein; KEGG: pai:PAE1813 ABC transporter subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08040"
FT                   /db_xref="GOA:A3MTS3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTS3"
FT                   /protein_id="ABO08040.1"
FT                   /translation="MEVEALRTAISHVESVEEALGVEKKLAYQVVLKGKITRDMVEEIS
FT                   RLKGEPDWMRRLRLRMLELFEKLPMPKWVRAVEEIDLEALAHYAKPQTETVTSWDQVPK
FT                   EIREYYEKLGLPEIEAKALLGLGAQFDSEIIYFNLKKKLQEKGVVMLPMEEAVKKYPDL
FT                   VQKYFMRVFPPEHKFAALHGALWSGGVFIYVPPGVRIEQPLETFFFIGQSMESQMEHSI
FT                   VVADKGAYVHWIEGCSAPRLMKYSFHDGMVEGYAHEGATLKITTVQNWSRDVVNFNNKR
FT                   AIAEAHAKVHWVEGSIGSKTTYTFPSTVLKGEGASTEIVGITAAKGPYWKENGAKVWHL
FT                   APKTSSRVVNKSISAEGGVAVYRGLIHVQRGAKYAKSHVQCDSLVLDKDSATLTIPHDQ
FT                   VFEETAVVTHEATASTISEEKIAYLRARGLTEDAAKAAIVLGFVGDVLKDLPFEYAVVL
FT                   SRVIELEFGKLSKVG"
FT   gene            578755..579348
FT                   /locus_tag="Pcal_0614"
FT   CDS_pept        578755..579348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1815 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08041"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTS4"
FT                   /protein_id="ABO08041.1"
FT                   /translation="MNPCIQDKFTLCKPEFDPRKALDLSIDLMHQFDASPYDIIGVAIA
FT                   FGADPREAKRALGVEISGNVKKPITTFLTNYGRRHGYEKVEAALLKLYQAAKGGCLCPP
FT                   GPIAPLGDGYIVQRPYAVYICASGNCREVAPEPLQLYEHPTGCMFYNPPLVLEGQPLPA
FT                   VVNALKQLKVTEPEIVAKYLLPGLCRDLWGVRIP"
FT   gene            579410..579526
FT                   /pseudo
FT                   /locus_tag="Pcal_R0010"
FT                   /note="tRNA-OTHER3"
FT   tRNA            579410..579526
FT                   /pseudo
FT                   /locus_tag="Pcal_R0010"
FT                   /product="tRNA-OTHER"
FT   gene            complement(579836..580429)
FT                   /locus_tag="Pcal_0615"
FT   CDS_pept        complement(579836..580429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0615"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08042"
FT                   /db_xref="GOA:A3MTS5"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR029349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTS5"
FT                   /protein_id="ABO08042.1"
FT                   /translation="MRAAKTREVLYIQLLALLRTSPTPRGRRNLAEELKIGEGVARALL
FT                   EAGRHLGHIYIMRGGAKITEAGDTFLRDIFATCKIGAVVPMNDAGKYLCGKRCLAFIID
FT                   DKIPNAVAMRDELVRLGACGALIVEKQEDLVLPPTYEKLRKYIPQLAENLSEHLSQGQS
FT                   AVVTCGETYADAMSFIQIRCKNLLTGDEENPADM"
FT   gene            580474..581826
FT                   /locus_tag="Pcal_0616"
FT   CDS_pept        580474..581826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0616"
FT                   /product="TBP-interacting protein TIP49"
FT                   /note="PFAM: AAA ATPase, central domain protein;
FT                   TIP49-like; SMART: AAA ATPase; KEGG: pai:PAE1693
FT                   TBP-interacting protein TIP49"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08043"
FT                   /db_xref="GOA:A3MTS6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041048"
FT                   /db_xref="InterPro:IPR042487"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTS6"
FT                   /protein_id="ABO08043.1"
FT                   /translation="MSVRIEEVKSQFERFAAHSHIKGLGVRDGKVEFIADGFVGQVEAR
FT                   EAAYIVVKMIREGKFAGKGVLIVGPPGTGKTALALGIARELGRETPFVALSGGEIYSLE
FT                   VKKSEFLMRALRRAIGIKVREWRKVYEGEVRSIEFRYGRHPYNPYIQRVLGATIKLRTR
FT                   DEEKTLRVPAEIAEQLIELGVEEGDVIMIDEETGAVSVVGRGESGEQYDVAVRRRIEIP
FT                   KGPVYKEKEIVRFFTLHDVDVSLARQRGLISAMLFGFAEEVKEIPDEIRKQSDEIVRKT
FT                   LDEGKAELVPGVLFIDDAHLLDIESFSFLMRAMETEFAPIIIMATNRGIAKIRGTDIEA
FT                   PHGIPQDMLDRLVIIRTRPYTADEIREIIRIKAREQGISLSDEALKLLTDIGVNHSLRY
FT                   ALQLLTPAYIIAKERGKSSVEREEVEYVRRHFVSVKESVEYVKSLEEKFLK"
FT   gene            complement(581877..582332)
FT                   /locus_tag="Pcal_0617"
FT   CDS_pept        complement(581877..582332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0617"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08044"
FT                   /db_xref="GOA:A3MTS7"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTS7"
FT                   /protein_id="ABO08044.1"
FT                   /translation="MMKLYAAILAVAIVAMFLPVEYLVSDAFRPPPNKVLTPTGVKEVA
FT                   GTPLWLYPWRATVVLVTLLFAAVVATFFTRQTGRVRWTLAFLSITTAVFHYLTLLFTSS
FT                   PPGYGVEVYPLLYVIKVGNAPPQFYLDLGQILILYAAYNAYKARTPP"
FT   gene            complement(582329..583837)
FT                   /locus_tag="Pcal_0618"
FT   CDS_pept        complement(582329..583837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0618"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: pai:PAE1702 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08045"
FT                   /db_xref="GOA:A3MTS8"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTS8"
FT                   /protein_id="ABO08045.1"
FT                   /translation="MDPLVAFLVSWFAVVGIVYAVNKNAVRYFVAIYWKTERLNRRIEG
FT                   LVKRLSFVPLRAYLAVALVLALAPIFIAMPFVRPDGQVQALPGFLYMLIGGTVTAVQTL
FT                   LSGAPVAEAASRSAGVTPIIPGVTLPWGQLPYLAVAIAVGVALHEFMHAYAALRYGIPL
FT                   RHVGVFSFFYIISGAFVEPDEEAYKKSGVEAKAAVLASGVAANVALAFLAMLAGVAGAW
FT                   AGLYGAVFGVSAFGVDAGDRVLEIRGCGLAERVYTPDDFITKINVLAGMGPLMGINKTA
FT                   ACKPGDEVTLVVGKWWGTYEVKLDYSNFTTPPRINWLFEDGSLYKSGVRPGDVVKAVEG
FT                   CGVREEIRWGGQLLSTLLSLKKLCRPGDVIRVAVERNGTTVALNVTLVGKGGEVYYGLG
FT                   PGSLPMLGYDAGPIKASEIYNTEFTKFVFWFLVVNYGLAVVNALPIYPLDGGQLVAALA
FT                   QRRLGERRGQRLVNALSVVLAAMLIFNLALGVLGEQYRVLQMIR"
FT   sig_peptide     complement(583775..583837)
FT                   /locus_tag="Pcal_0618"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.677) with cleavage site probability 0.669 at
FT                   residue 21"
FT   gene            complement(583865..584448)
FT                   /pseudo
FT                   /locus_tag="Pcal_0619"
FT   gene            584466..585179
FT                   /locus_tag="Pcal_0620"
FT   CDS_pept        584466..585179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0620"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08046"
FT                   /db_xref="GOA:A3MTS9"
FT                   /db_xref="InterPro:IPR009198"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTS9"
FT                   /protein_id="ABO08046.1"
FT                   /translation="MRHGPYMRRLLISLASILAFSAILTFYPGEYFTAILLYFVLFFGI
FT                   TIAMGLRTYRRGMATVQEISKGKPLLEIDEKEVGKVMEKDKELVAEYRRLTRSSLIPLL
FT                   LLPAFMVLATVLFPTLPPLLESTAGPVIGAYPARFLAYVTIFSIFSAISMLLFKPPTMP
FT                   RIVRNVKIYEGGMVVDKVVGLKAPIEVEEYTVNPERRFIQFKLNNQIFRIYYKDVKELD
FT                   SILLKIIKPLKQRSQ"
FT   sig_peptide     584466..584531
FT                   /locus_tag="Pcal_0620"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.887) with cleavage site probability 0.620 at
FT                   residue 22"
FT   gene            complement(585159..585485)
FT                   /locus_tag="Pcal_0621"
FT   CDS_pept        complement(585159..585485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0621"
FT                   /product="LSU ribosomal protein L12AE"
FT                   /note="PFAM: ribosomal protein 60S; KEGG: pai:PAE1712
FT                   ribosomal protein L12"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08047"
FT                   /db_xref="GOA:A3MTT0"
FT                   /db_xref="InterPro:IPR022295"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTT0"
FT                   /protein_id="ABO08047.1"
FT                   /translation="MEYIYGALLLHYAKQEINEENLAKVLQAAGITPDEVRIKTLVAAL
FT                   KEVNIDEAIKSAAFAPVAAPAAAAAPAAAGGAAPAAKAEEKKEEEEKKGPSEEEIAGSL
FT                   ASLF"
FT   gene            complement(585582..585785)
FT                   /locus_tag="Pcal_0622"
FT   CDS_pept        complement(585582..585785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0622"
FT                   /product="LSU ribosomal protein L38E"
FT                   /note="KEGG: pai:PAE1714 ribosomal protein L38"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08048"
FT                   /db_xref="GOA:A3MTT1"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="InterPro:IPR038464"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTT1"
FT                   /protein_id="ABO08048.1"
FT                   /translation="MPKEIFLVELWKKYGEKAQVVRVKRYEDFVKLKARLSGYLYTIRV
FT                   PPDKAEQLISELKAKNVKVEEV"
FT   gene            complement(586023..586625)
FT                   /locus_tag="Pcal_0623"
FT   CDS_pept        complement(586023..586625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0623"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08049"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTT2"
FT                   /protein_id="ABO08049.1"
FT                   /translation="MRHDSTLSGLITIPNDAFIFKDGESIVLIKPCLLWMRCPGDSGDT
FT                   TVFWKGEARPARKDDPVVKLFGALDTAVAYSHKAANLLQRPQSRIMRLVAFSLMELGFY
FT                   LATGKPEYLDTAYELYRRALKLAYTIAPPEPLRAWLACSSPECSAVDEARVWIRWAERR
FT                   AVSLDSTAAKLMNQLSNLTFEVMRTLPHIQYRHRRVR"
FT   gene            586750..587670
FT                   /locus_tag="Pcal_0624"
FT   CDS_pept        586750..587670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0624"
FT                   /product="2,3-dimethylmalate lyase"
FT                   /EC_number="4.1.3.32"
FT                   /note="TIGRFAM: methylisocitrate lyase; KEGG: pai:PAE1716
FT                   carboxyphosphonoenolpyruvate phosphonomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08050"
FT                   /db_xref="GOA:A3MTT3"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTT3"
FT                   /protein_id="ABO08050.1"
FT                   /translation="MIVKKGRVDGARLLREELSRPGIVLVPGVFNALTALMAQSLGFKA
FT                   VYVSGAAVTASMALPDLGLITMDEMVKTVKYITDAVDIPVIVDIDTGYGEALNVMRAVR
FT                   EFEAVGAAGVQLEDQVLPKKCGHLTGKALIPPDEMAKKIKAAVEARRNPDFVIIARTDA
FT                   ANVTGFEDAVQRAQLYLEAGADVIFPEALRTEDEFREFAKRVKAPLLANMTEFGVSPLI
FT                   PAKKLEEFGYKFVIFPVTALRVAMYAIREVFKTILAEGTQVAWLDKMFTRKELYELIRY
FT                   YDYEKLDREIAESVDRLIRDKKAVR"
FT   gene            587677..589038
FT                   /locus_tag="Pcal_0625"
FT   CDS_pept        587677..589038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0625"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number="4.2.1.79"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: pai:PAE1717
FT                   propionate catabolism protein prpD"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08051"
FT                   /db_xref="GOA:A3MTT4"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTT4"
FT                   /protein_id="ABO08051.1"
FT                   /translation="MDRVTKTLAEYTAYIDFSKVPAETRHEVKRRIIDSAAVAFAAYTS
FT                   EPVALARRAASRFPTAEGARILGTRYKVSPDWATFVNGLMIRYHDFNDTYLSKEPLHPS
FT                   DLIGAALSVGDYVGARGTDLITAVALGYEASVTFCDGGTLRKRGWDHVNFLGIGSLLAS
FT                   AKLLGLDVVKTQHALAIYAVPHAAMRQTRVGELSMWKGAAAANSSRNAVFAALLAKEGF
FT                   TGPYKPFEGEMGFFKQLLQGDFDLSVLKRLEELQPPRRILDTYIKPYPVEYHAQTAVEA
FT                   ALKLREKVRLDEIEKVRIDTYEAAYTIIGPKDPEKWDPHTKETADHSIMWVTAAALVWG
FT                   PIKIEHYRDIRNPAVLSLMKKMEVNLDPELDKLYPQAFPTVITVVTKSGSKYTERVDYA
FT                   KGHPKNPMTDAELEQKFNELTQGILPDEVRKRALDIMWNLEKYSVADLLEALAV"
FT   gene            complement(589095..590057)
FT                   /locus_tag="Pcal_0626"
FT   CDS_pept        complement(589095..590057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0626"
FT                   /product="Thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A; FAD
FT                   dependent oxidoreductase; KEGG: pai:PAE1725 thioredoxin
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08052"
FT                   /db_xref="GOA:A3MTT5"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTT5"
FT                   /protein_id="ABO08052.1"
FT                   /translation="MEVDYDVVIIGAGIAGLSAALYAARQRLKTLVVSKDLGGQLNMTT
FT                   LIENYPAIPKISGPELAKRVEQQARAFGAEIIFDEVKTVEKSGDVFVIKTEGGDEYKAL
FT                   AVILAFGKTPKELGVPGESKFKNKGVSYCTICDAPFFKGQDVALVSWGDLAREPVTILS
FT                   SVANKFYWIYPSDKPIHDDEFIEQTKRLGKAVFVPNSEVVEIKGDTKVRAVVVRNKKTG
FT                   EVQELPVAAVFVEVGYVTKSDFVRHLVDLNERGEIIADWEGKTKTPGVFAAGDIVAYPY
FT                   KQAVISAAMGVAAALSATAYVMKLKGKPIHSLVDWKASK"
FT   gene            590130..590606
FT                   /locus_tag="Pcal_0627"
FT   CDS_pept        590130..590606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0627"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: pai:PAE1729 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08053"
FT                   /db_xref="GOA:A3MTT6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTT6"
FT                   /protein_id="ABO08053.1"
FT                   /translation="MSSKEAEAQKGKQGWITPTVIPPEEWGSFRYRGKTLEELLNMPMD
FT                   EFIKLLPARQRRSLKRGLKPEHRKLLEKIRKAKRLMAQGKKVTIKTHCRDMIILPEMVG
FT                   LTIHVYNGITYIPVFISPWHIGHYLGEFALTTRIVQHGEPGLKATRSSLHIAAK"
FT   gene            590608..591051
FT                   /locus_tag="Pcal_0628"
FT   CDS_pept        590608..591051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0628"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: pai:PAE1730
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08054"
FT                   /db_xref="GOA:A3MTT7"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019978"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR028333"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTT7"
FT                   /protein_id="ABO08054.1"
FT                   /translation="MTVVKLQSRPKVGDVVTLPDGKKVEVKNIGVPYVLPPAAVCDDPL
FT                   CPWHGHLKIRLKLLEVTVEKVRMHKAAVVTHEWVHYLPKYNRYERRRRRMRVRVPECIE
FT                   VKPGDKVIIAETRPLSKTIAWVVIGKKEDVVEWKAKHETLPSV"
FT   gene            591044..591688
FT                   /locus_tag="Pcal_0629"
FT   CDS_pept        591044..591688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0629"
FT                   /product="ERCC4 domain protein"
FT                   /note="PFAM: ERCC4 domain protein; KEGG: pai:PAE1735
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08055"
FT                   /db_xref="GOA:A3MTT8"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTT8"
FT                   /protein_id="ABO08055.1"
FT                   /translation="MSNAVVLVDTREHASPVLRAIKETGCGVVKTKLEVGDYVAGHYVF
FT                   ERKSASDFVNSIIDGRLFDQAERLKASGLKPLVVIEGDLWAELEFRKISPNAVLGAQLG
FT                   LYAMGVGVVYVRDESQTGALVCLAAKKGQGGVKVPSVKKSVDVKRLQIVFLSSLPGVGP
FT                   RRAEELLRRYGSPLNALLNYKSWDIDTKRHALIKRVLETPYGDNSSLDKFL"
FT   gene            complement(591652..592746)
FT                   /locus_tag="Pcal_0630"
FT   CDS_pept        complement(591652..592746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0630"
FT                   /product="glycoside hydrolase, family 1"
FT                   /note="PFAM: glycoside hydrolase, family 1; KEGG:
FT                   pai:PAE1736 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08056"
FT                   /db_xref="GOA:A3MTT9"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTT9"
FT                   /protein_id="ABO08056.1"
FT                   /translation="MLIGAAVSPYQHFGFCRCDLPDERGAQHFLFYEEDLDIARGIGLD
FT                   AFRTGVEWGLLEPREAVYDGETVKLFRTYLSSAKSRGLKLWVTLHHFTNPRWVWKWGGW
FT                   ESREVAKRFLSYVDLVARELGDLIDVALIFNEPNTYAYLAYIRGDLPPYGFLAVKHWRR
FT                   AQAVINAAIAEARDVLKQYGIPTTFTFSYTKIRASPLLRPVTYALEGHRQYMDMFREMD
FT                   YTAINYYVVGKFKDLALTYVLEPEELGRVKAPTPLAVTEFGIATRDEELRLQYLCAMAN
FT                   IFQRVKPVAVFWWSFLHGYEWGMGYQPFFALVDVVGTTRVITPLAKSFRKVLESPPPCQ
FT                   LGKLDLGLEWRWDYRNLSSDELSP"
FT   gene            complement(592746..593171)
FT                   /locus_tag="Pcal_0631"
FT   CDS_pept        complement(592746..593171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0631"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: pai:PAE1738
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08057"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTU0"
FT                   /protein_id="ABO08057.1"
FT                   /translation="MPDEPYYELAYKFRRILVPVSPMGAARLREVLSVASDFAERYGAE
FT                   VVFLYVTPREDDPSAEELKRAVDEFMSKRGVRYFFKVRRMGEMETVASEIVKELSESNY
FT                   DMVILLSRGYYGASALLYNSTSVAVAIAANTSVLILR"
FT   gene            complement(593164..594198)
FT                   /locus_tag="Pcal_0632"
FT   CDS_pept        complement(593164..594198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0632"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: pai:PAE1740 glyceraldehyde-3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type II; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase; dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08058"
FT                   /db_xref="GOA:A3MTU1"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR006436"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTU1"
FT                   /protein_id="ABO08058.1"
FT                   /translation="MIKVGVVGYGTIGKRIADAVALQDDMRVVGVVKMTPDYEAKIAAA
FT                   RGFPVYTAADRVEKFKKAGIEVAGTVEDLVKASDVVVDASPEDVGRENKEKYYRQLDKR
FT                   YIFQGGEEADVAEVSFNALANYDEARGKRYIRVVSCNTTGITRVLSALLLNGIGIRKAR
FT                   IFIARRGADPKEHKKGPINDVVPNPTAVPSHHGPDVQTVLKDVDIVTMAVAVPVTIMHM
FT                   HMAYIELDGPRSRDEVLEAFAKTPRIFLADVGSGFQSLAQFIEYARDLGRPRGDFPEVA
FT                   VFRDSVTVRGDELYLMYGVHQESIVVPENVDAIRAALGVLPKWQSIEKTDKSLKLFTEG
FT                   KRYA"
FT   gene            complement(594195..595421)
FT                   /locus_tag="Pcal_0633"
FT   CDS_pept        complement(594195..595421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0633"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: pai:PAE1742
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08059"
FT                   /db_xref="GOA:A3MTU2"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTU2"
FT                   /protein_id="ABO08059.1"
FT                   /translation="MLLNEVVEKLPNMSKCLERGKVVIIRIDINSPIVDGKILDDYRIR
FT                   AHAQTLRLASEAGVKSVVLAHQGRPGQDDFTSLEVHKPYLEKYVERPIKFVDDVAGPEA
FT                   RRQIRELRDGEILLLENVRLLAEEVIERVPEAQAETYLVKKLAPLGHYFVFDGFAVAHR
FT                   SQPSVVGFPMVLPSCIGPVFERELRALGAVFERRGEGVMLLAGGAKIPDTLKAVEQLLK
FT                   NNFVEKVAVGGLVGFVFAVAKYGLLNDEIRREVERGGYLPHVERARQLLAKYGNKIHVP
FT                   VDFAVERGGRIDVDVYSLSQAPLDIGRSTILLFKEVVEQGDIVIFSGPMGYIENKVFAT
FT                   GTVELLRAAAKKRLILGGGHTIMAAEMAGVLDRAFHVSTGGRAFIQTLGGEEMPAVKAL
FT                   LMSAKKFWP"
FT   gene            595531..596112
FT                   /locus_tag="Pcal_0634"
FT   CDS_pept        595531..596112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0634"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08060"
FT                   /db_xref="InterPro:IPR018700"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTU3"
FT                   /protein_id="ABO08060.1"
FT                   /translation="MPMRLDKYKTALKLVSTELSKRDIEHVLIGSAVLPLAYGVEYDPR
FT                   DVDLFILNKSTVLDNEMFEEIARENDWDLGTSDHGTIYYELIVGGESVRVDLLENILDI
FT                   YIPPEFFSETRKVAINGVEVASIGLEELLVLKAKIATKEAEEFINEVARIVLDKGIGLN
FT                   YQRIRALAELFPEDAEGILKRLRRNGIYVE"
FT   gene            596139..597962
FT                   /locus_tag="Pcal_0635"
FT   CDS_pept        596139..597962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0635"
FT                   /product="aminoacyl-transfer RNA synthetase, class II"
FT                   /note="PFAM: tRNA synthetase, class II (G, H, P and S);
FT                   Anticodon-binding domain protein; aminoacyl-transfer RNA
FT                   synthetase, class II; KEGG: pai:PAE1748 threonyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08061"
FT                   /db_xref="GOA:A3MTU4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTU4"
FT                   /protein_id="ABO08061.1"
FT                   /translation="MRVLYIHAERFSWESREPALDIRDEPGSGAAANALVVFVSVERGD
FT                   SSDEEFLRRVARDVVETAEKVKATAVVIYPYAHLSNDLARPYVAKEVVNKLYEVVKSEF
FT                   KGEVYKAPFGYYKAFEVKCLGHPLAELSRSFKPEEARVAKAVEERRDVYLVLTPDGREH
FT                   DPAAYSPADPDLKALIDKEVFKRELGGGEPRYLDYLRKFGFEWEPMSDVGHMRYGPEAT
FT                   VMMELVEDYAYQVAKSLGIPVFKIRGTNMFKLSEKAIETHARLFGERLYIVESDTDLIL
FT                   RYAACFQQFAMAKDWVISYRNLPFGMLEIADSYRHEQPGETVVLFRLRRFYMPDLHIFT
FT                   KDLAEAVEVSYKVHEAIFREIGKLGRTYVSLYNVTEEFYKSHRDYLVELARREGKPILV
FT                   RILPTQKYYWVLNVEYHIVDELGRPREIATFQIDVGNAQRFGIKYVDENNQVKYPVIIH
FT                   TAIIGSVERYLYAVFDTIAKAEREGKTPRLPTWLAPVQVRIIPVARDNLKFAMEVADKL
FT                   EEAGIRVDVDDRDETLSKRIRDAETSWVPYVCVVGSKEEETGTLSVRIRGEGQAKMTAE
FT                   ELIKRVREETRGYPTRPLYLPRLLSQRPTRG"
FT   gene            598069..598449
FT                   /locus_tag="Pcal_0636"
FT   CDS_pept        598069..598449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0636"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="PFAM: S-adenosylmethionine decarboxylase related;
FT                   KEGG: pai:PAE1749 S-adenosylmethionine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08062"
FT                   /db_xref="GOA:A3MTU5"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="InterPro:IPR027549"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTU5"
FT                   /protein_id="ABO08062.1"
FT                   /translation="MQATAQVQTPVVGRHVYGELYGVDESLLKDEERLRRIVIEAAHIA
FT                   NMHLVEVNSWKFKGGDKEGVSVIALVLESHIAIHTWPVYNFATVDVYTCGEHSDPMAAF
FT                   RYIVSQLNPKRFTVNYSDRSYK"
FT   gene            598469..599377
FT                   /locus_tag="Pcal_0637"
FT   CDS_pept        598469..599377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0637"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08063"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTU6"
FT                   /protein_id="ABO08063.1"
FT                   /translation="MSNVLILLLWLNEGAIADDIKKRAAYVGTAYTADAVNYVVKALYE
FT                   RLNYVDTVVVYGPDFTGAGELIVQTLRGACTEAVRVPCHYVEGLNVAVVDLRWRSEQDL
FT                   RHAVEEAYRPREAPARPNAAIEIQRPEKRMPYLGLHVLYDTDLEALRVKAIHYILTYGV
FT                   ESRDALYNVLALHSGHGGVYSAAPCDIVEEWPCGLGKHDVLIATPAFIQKRHIGQALAA
FT                   ARLDVYKRDVYDPHGNFVLSPDALRHYDARGVLLREVEISDEAVKREATMLHPDHAFYL
FT                   GQEYAAYKLLKDKYVQDKWKY"
FT   gene            599503..601281
FT                   /locus_tag="Pcal_0638"
FT   CDS_pept        599503..601281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0638"
FT                   /product="translation initiation factor eaIF-5B"
FT                   /note="TIGRFAM: translation initiation factor aIF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu, domain 2 protein; KEGG:
FT                   pai:PAE1513 putative translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08064"
FT                   /db_xref="GOA:A3MTU7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004544"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029459"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTU7"
FT                   /protein_id="ABO08064.1"
FT                   /translation="MQQKIRSPFVVVMGHVDVGKTLLLDKIRGTSVAYREPGMITQHIG
FT                   MSLVPWPAVEKFAGPLVDRLKLRGRIWIPGFLFIDTPGHAAFSNLRKRGGSVADLAILV
FT                   VDITSGLEDQGVESLKLIQSRGVPFVIAANKLDRIYGWKSVENRPFLFAVEEQEWHAVA
FT                   TLEEQIGKLITQLANLGIDADRYDRVRDFSKQVPIVPTSAVTGEGVADLLLVLAGVSQR
FT                   FIPREKLQVRDGPARGVVMEVKEERGLGVVADVILYDGKLRKGDVIVTAGLDGSRQAKV
FT                   RMLIMPKSLEEMRDPEDKFMAVQEVEAAAGVRVVAEGLEGVVAGAPLLAVWDPKDLPEA
FT                   LKSVGEEIAEIKIESDKEGVIVRADTFGTLESIILFLRQQGVPVRKADVGPPTHKDVVE
FT                   AVLSRRKNPAYGAILAFNVKVPPEVETEAQSSGVKIIRGEILYRIFDEYVKWSTEVKTK
FT                   TVEQVLSQLTRPAKIQILPGYVFRRSDPAIVGVKVLAGTLKPGVTLAKDGREVGKVMQI
FT                   QRQGKPVAEAVAGDEVAISIQGDVIVGRQIKEGDVLYVYIPDEQARQWLFRYKQYLRKD
FT                   EVEALEEYLKTRKKSA"
FT   gene            complement(601273..601641)
FT                   /locus_tag="Pcal_0639"
FT   CDS_pept        complement(601273..601641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08065"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTU8"
FT                   /protein_id="ABO08065.1"
FT                   /translation="MSDTCRPERIDLDELLVMGGQQRADYLLVGWRALMVVEEAEDVRK
FT                   RDIDQLVATVETIRRGSLVDYQGFGLIVAVAHGHRRVDPMVPKIAAALSRKQSREGVVY
FT                   LVANCDQQLGRFVKEYLC"
FT   gene            complement(601642..603027)
FT                   /locus_tag="Pcal_0640"
FT   CDS_pept        complement(601642..603027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sto:ST1576 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08066"
FT                   /db_xref="GOA:A3MTU9"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTU9"
FT                   /protein_id="ABO08066.1"
FT                   /translation="MVRLVVKDFGPFGEAEVELKPLTVFIGRNSVGKSMLAYLIWALTL
FT                   AIPRPTRLEKAIVDAGGNKALEAVIEKAKRGDDFKEELMELMNIAIYVLPKALAPSVEE
FT                   ALKKVFTFDLDELVREGANHATITLKGERTSIETTINGKNVDVSIKGPSIDEFISEIKT
FT                   SQREVTISYDKSRFTISVPLTRTSRFSIIELLYTFVSVYIMLTLGGPFKHLIPLPLPVG
FT                   LFPFLELFSALLPDSRAGISRTLLRPYIPIAITYPDKQYVELYYALAEWVAKESIDLAA
FT                   VKPLLLEMGCSVEPVIEEGVYTIHIKTWSGKRLRLPQAPSGIREVLTVAIALSSRGPPH
FT                   VVIIEEPEAHLHPRAQGALARLIAKAVNRGKHVVLTTHSDYMLYRLNDLIALSRSPERA
FT                   RALGFAEDEVLRPESVAAYLVKAEGDRAVVEKLDVGPEGFSEDEFASVAVELAEERARI
FT                   LSS"
FT   gene            complement(603113..603197)
FT                   /locus_tag="Pcal_R0011"
FT                   /note="tRNA-Leu4"
FT   tRNA            complement(603113..603197)
FT                   /locus_tag="Pcal_R0011"
FT                   /product="tRNA-Leu"
FT   gene            603628..604053
FT                   /locus_tag="Pcal_0641"
FT   CDS_pept        603628..604053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0641"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08067"
FT                   /db_xref="InterPro:IPR016618"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTV0"
FT                   /protein_id="ABO08067.1"
FT                   /translation="MLRLPPRVKVLEALGALADGRVKRVGEGVCEVVSSEGDRVYHVAV
FT                   RGVYVSSDDNGTVYRGYVGYPIIACLMAEGRLPMDWELAERLRGVPWRKLNELYKRYDE
FT                   VVKHVYAERRIDRSRAERYISTVLEQLAKMGLRREGP"
FT   gene            604040..604690
FT                   /locus_tag="Pcal_0642"
FT   CDS_pept        604040..604690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0642"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: pai:PAE0010
FT                   coenzyme PQQ synthesis protein, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08068"
FT                   /db_xref="GOA:A3MTV1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTV1"
FT                   /protein_id="ABO08068.1"
FT                   /translation="MRVLEIFASLQGEGVNLGKPAVFVRLAGCPIRCVYCDTEYSWDFN
FT                   GGVEMSPGEAVRRAEELGVRGHVVVTGGEPLVWMRRGLEELVCGLRRLGAVEVETSGVY
FT                   APTPELDACADFYDVSPKLSNAGVKAPLSPFYPKSPKVWFKFVVADVADVEEALAYVRE
FT                   RGIPLDRVMLMPMSKTPEEHAEVLRRIWDAAVRAGLRVTPRLHIVAWGNARGK"
FT   gene            606240..608600
FT                   /locus_tag="Pcal_0643"
FT   CDS_pept        606240..608600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0643"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE1089 P.aerophilum family 59 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08069"
FT                   /db_xref="GOA:A3MTV2"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTV2"
FT                   /protein_id="ABO08069.1"
FT                   /translation="MKLHVWLTVASVVLGVLQVGAQYVCATAGELGVAGRSPLVQFMVW
FT                   DGGWKPVEAYVEGVDALFVPAPLARGNEAAISLVAQRGVLPPGVLKNETLICFKPGSGI
FT                   PKLPRDTPRGLLVVYKAGGAEGHVLIVDVADVDRPAQPLAAAALPKNFTKVQVVERQWV
FT                   GSPAGRAVELAQVGALPSPISYAASFSLRSFFGAQLSPGELRCSYFDVPSETSYVAVYF
FT                   RPGTDPGTYYYEVKRNGTLASSGVISYTGGPFGTALWASETGGRATYQLCIQNKDNVTR
FT                   SVSATVYLYVRNQLNIIRDDAYYTNVIDVDMSTSQRRNYRMSNTYLYFPGYVDIDAASV
FT                   IQIYVSALLNPEAVRKDSQGRYYIDVYWGQLYMGRLYGISTASGVKFDGVLTVPAFLHW
FT                   IITNTRGYGGTISIGPFNYPAYPVKGSARVDVFVERPVELANASSAVLIHYATVRLRAD
FT                   ASYHDVMPWSSGFKGVSFKTRVEFVFSGSAGHKLVVSINPYKWNNVENDIRYRRITINI
FT                   TGIDYYGNPVKFSAGGQFDLNAQSTTGQLARLIEWASIILQGLDLGKAVVDYLAKAPSS
FT                   FPTVSFITIALDAYVNAIQEKGTVQISPDGTIMKIGVYTGYLFNIPLYLLFFLRFPVPD
FT                   LLPPSVISWFSAYYLAHGRRIFPPALYLAAFASSLLDSLYFGPRVGSLASPVVLLAALA
FT                   LAVLYAATFARGFGQRVASVVLLVLAVAVGHVLVVAAAVAWRALAPPLGFLPLPEPLDL
FT                   PLYLLAFAVFYLVHYKGLGYLHRWCESRRVRGA"
FT   sig_peptide     606240..606320
FT                   /locus_tag="Pcal_0643"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.785) with cleavage site probability 0.332 at
FT                   residue 27"
FT   gene            608975..609109
FT                   /locus_tag="Pcal_0644"
FT   CDS_pept        608975..609109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08070"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTV3"
FT                   /protein_id="ABO08070.1"
FT                   /translation="MARTKAERLRDAIEMLETAVEERDCSLVEDALEELRALLEELEE"
FT   gene            609109..610029
FT                   /locus_tag="Pcal_0645"
FT   CDS_pept        609109..610029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0645"
FT                   /product="peptidase M19, renal dipeptidase"
FT                   /note="PFAM: peptidase M19, renal dipeptidase; KEGG:
FT                   pai:PAE0005 peptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08071"
FT                   /db_xref="GOA:A3MTV4"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTV4"
FT                   /protein_id="ABO08071.1"
FT                   /translation="MLVDLHEDIAHYFLTSLNPPPFHEDAEGRQSDLPKLRRAGADVVV
FT                   AAVFPFVHVYDRWAAASQVALEGVKVYYSLAERYGVRIVERASDLWAPALKFMLALEGA
FT                   DVLNDVGDLKLFYRLGIRVLGITWNLDNKWGHSCYAKRDGGLTASGEELVAEAERLGVV
FT                   IDLAHASRRTALDVLAMAKRPVIISHANVKAVHDHPRNVDDEVLKALADNGGVIGLTLI
FT                   PSTISPSPSLNHLVKHFKYVREKFGVEVLAVGTDFLGISSAPPGLETVDKVAVLAKALV
FT                   EVGFSKEEVEAVFWRNALQVFKRAL"
FT   gene            610057..610455
FT                   /locus_tag="Pcal_0646"
FT   CDS_pept        610057..610455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0646"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE1895 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08072"
FT                   /db_xref="GOA:A3MTV5"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTV5"
FT                   /protein_id="ABO08072.1"
FT                   /translation="MGLGDVLLVLHVLGIVGWAGLTTGAYFVLREWRPREVPKSYQRLV
FT                   HLEAAAGALVFATGVAMAVYLYGFPKSPLWIHWALGIAIVVGLLEVFHVYAVRRWPLER
FT                   YVRLANRLVPVWAAVLVLMLWLMVAKPF"
FT   gene            complement(610452..611453)
FT                   /locus_tag="Pcal_0647"
FT   CDS_pept        complement(610452..611453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0647"
FT                   /product="tRNA (guanine-N1-)-methyltransferase"
FT                   /note="PFAM: tRNA (guanine-N1-)-methyltransferase; KEGG:
FT                   pai:PAE0001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08073"
FT                   /db_xref="GOA:A3MTV6"
FT                   /db_xref="InterPro:IPR007356"
FT                   /db_xref="InterPro:IPR016653"
FT                   /db_xref="InterPro:IPR016742"
FT                   /db_xref="InterPro:IPR028564"
FT                   /db_xref="InterPro:IPR038459"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTV6"
FT                   /protein_id="ABO08073.1"
FT                   /translation="MGLAADSPRDPHLTPLWRIFFDALASQGVSCLCIPRHFKCRGELA
FT                   QCVAVGVAIGKYHVCKSPCRGSPLGVWSGVELLRAGGGAECPWTLAKQCAEPINVDVSL
FT                   PEAPRIVIDLSLWDEHTPGEKHELVEQILATLGVVRGVLWDGNLWITHAPAEFVRLLEL
FT                   HARGMVHKMRIVEDMPPLQSPVVLDPEGPCLFTEEVARSHVEFIIGGIVDKEHVVKSGT
FT                   RRLAELIGVEKRCRIELRGSTVGVPDRINKVAEIVLRTLAGQSLEEAILAVQAKRDRVY
FT                   RLMWEIQKRGQRGPDGTIEISPEALREANWLGASAEEVELALKKARAKVARG"
FT   gene            complement(611444..612598)
FT                   /locus_tag="Pcal_0648"
FT   CDS_pept        complement(611444..612598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0648"
FT                   /product="methionine synthase (B12-independent)"
FT                   /EC_number="2.1.1.14"
FT                   /note="PFAM: Methionine synthase, vitamin-B12 independent;
FT                   Cobalamin-independent synthase MetE, N-terminal domain
FT                   protein; KEGG: pai:PAE3655
FT                   5-methyltetrahydropteroyltriglutamate-- homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08074"
FT                   /db_xref="GOA:A3MTV7"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTV7"
FT                   /protein_id="ABO08074.1"
FT                   /translation="MSLPRAFITSVVGSWPRPSWLIEAFEKFEKGQLDQQTFSQYLDDA
FT                   VKLAIRDQEEAGLDVITDGEQRRTSFVAFVGQKLRGFKIVRVEELHPNAKEIMKKYKAP
FT                   LTLWRPVIAGYIEDSIIAVDEVEYAKKVATRPLKVTLPSPYLIMWEAWHHKISAPYYPR
FT                   PEDAAEAYAKVLRREIARLIDKGVAFIQLDEPMLGDLIEAEPDKPDRYKQVASELYGQR
FT                   YRGLRDEIQLAVDLVNEVVQGYGTSVRLGMHLDRWPTEDSPVVGYERLAPQIFDIKVRQ
FT                   YVVEYKHPRMGNPEEFAKILPSDKEIGLGSIDVRDPKRVETVEEVVAHVERVAKYVDPT
FT                   RIWLNPDCGFAPGMYRAFPRAVALEKLKVMVKAAKALREKYWWV"
FT   gene            612710..613918
FT                   /locus_tag="Pcal_0649"
FT   CDS_pept        612710..613918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0649"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: pai:PAE3656 acetyl-CoA C-acyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08075"
FT                   /db_xref="GOA:A3MTV8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTV8"
FT                   /protein_id="ABO08075.1"
FT                   /translation="MSVGGKRLENVYLVAFARTAFTRFSRKEPQKDDFWDLRPEEIAAV
FT                   PVRAILERTGVKPEAVEDLLTGTALPVGEQWLYGGRHVVFAAKLPYTIPAAHIDRQCAS
FT                   SITTVAMGAMEVASGMADVVIAGGVEKMSKTPMYENPHIEINPKFLTDEEYVHLYNLHI
FT                   GYVMGLTAERLAEVSGIKREEMDAWSLRSHKRAAEAYEKGYFKEEIVPVAVEKEGQKKV
FT                   VDRDQAVRPDTTLEALAKLPPAFKPDGVITAGNSSPLNSGAAYVMLASGEAVKKYGLQP
FT                   LAKVRAVAFAGVPPEVMGMGPVPASRKALEKAGLTVKQIGRWEINEAFAVVTLYAIKEL
FT                   GIDPELVNTRGGAIAIGHPLGATGARIIGTLARQLQLDGVDYGVATLCVGGGQGAAVVL
FT                   ERV"
FT   gene            613941..615344
FT                   /locus_tag="Pcal_0650"
FT   CDS_pept        613941..615344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0650"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08076"
FT                   /db_xref="GOA:A3MTV9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTV9"
FT                   /protein_id="ABO08076.1"
FT                   /translation="MRLLAAVLLLAIAAFSVTIVTRADQASIDRALPVLQRYFPDVKIV
FT                   PADPTQWRALIDRGGVDFLWAGAPVLYEVLLKEGRLAPMPNVPELQALPDKVGNIPLKR
FT                   VVNGSVYYVVYGLLGYVIGYNQEALKRAGLEPVCSWSGFSSPKLVQYYLQTGSRPVALA
FT                   KPTKSTSTAAMMQLVTEIYGWEEGWRYLTAMAAVARFVDSSGAVRDAVKRGEALFGPMV
FT                   DYYVFIAGLGYCVPEDGTDILFDPIAVPKGANMTAAAVLTRVFLTDIEKTLVDRYIIPG
FT                   NPAVLDSPDVNQTKAAVLKRHLELLKSKVKAVPPEKSASFYYSFIYYYEATLVDLQDVL
FT                   TDVWTKVVKAYLAGNITRQQFEELLSLLAAPVNFTDPATGERLKFTYDVAVKLNDKVGS
FT                   DPTYRDLVYQAWREAARAKYREVERRLESYLASKPAGGAPSAALLTAAAVGAFAVAVGA
FT                   YLLMRRRAG"
FT   sig_peptide     613941..614012
FT                   /locus_tag="Pcal_0650"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.860 at
FT                   residue 24"
FT   gene            complement(615341..615601)
FT                   /locus_tag="Pcal_0651"
FT   CDS_pept        complement(615341..615601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0651"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08077"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTW0"
FT                   /protein_id="ABO08077.1"
FT                   /translation="MARKRRRSRLEIVIDILETVKAECKPPTRIATEANLAYDRMVKIL
FT                   EALVARGLVRENAGTFCISAEGLKLLESYSQWKWLLDLLGV"
FT   gene            complement(615576..616121)
FT                   /locus_tag="Pcal_0652"
FT   CDS_pept        complement(615576..616121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0652"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08078"
FT                   /db_xref="GOA:A3MTW1"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTW1"
FT                   /protein_id="ABO08078.1"
FT                   /translation="MIFIPDLIIVALALYIGYLTLRAWRSLADWRLSLYSFGMLMLAVS
FT                   LAVEAVADFLLRLAAGQAPWRFVIHQAAGLRAVLLLLQLAALVPLAIAVTPTSLYAAVP
FT                   LLLFLLPVNVALSLYIAVVTLLRSLERGVAPWISIAFIFFAASIMTPLFAFQDVVFRSL
FT                   TALFLALGLAYGQEKKEK"
FT   gene            complement(616118..617341)
FT                   /locus_tag="Pcal_0653"
FT   CDS_pept        complement(616118..617341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0653"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   pai:PAE3663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08079"
FT                   /db_xref="GOA:A3MTW2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTW2"
FT                   /protein_id="ABO08079.1"
FT                   /translation="MYAEMLRLAWQALWERKGRTIGAIVGIVIAFTALSYALLTGQTFK
FT                   DYTTRFFTSNFGANTLFVTGSQFTDADVGVLAGIQGVDAVVPLASTRGVVRVPGSNSPI
FT                   PVTVYGVNPADLQRVLPSTALYDGTMFVGSNFALVGYYVAFDRSTGQQRVLVGSPLSLS
FT                   VGRRSTTIAASGILATGSVGFFDTSRGVIMDLSTFRQLTGITSYNVVIVLARDPSLVDS
FT                   VANEIRANYPNVDVISPQAILQTVNTYLTAFQLFMGMLAGVSTVITALWLYDTMSINVV
FT                   QRTKEIGIMRAVGFKRRHITLMFLGEALIIAAIGVAIGAILLIPVSQAGLSLLFGNGAT
FT                   SAGGGQRGAPGGPPGFGGGAFQISSLVLDPVILAGTAALVVAVNLLGALVPAVRGSRID
FT                   LVQALKYE"
FT   gene            617423..619528
FT                   /locus_tag="Pcal_0654"
FT   CDS_pept        617423..619528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0654"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08080"
FT                   /db_xref="GOA:A3MTW3"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTW3"
FT                   /protein_id="ABO08080.1"
FT                   /translation="MKKWLILAALLAALAYSQAVVFTPKVDYLFLGAQWVQVPKFPGDV
FT                   GVISLSFYLADQYVDVSISLSPQCPYLTALGSAQMPTAGPGVVTATLKVMATALNATCP
FT                   TNVYLKATYKASGSTLTNGIEKLEYVSVYIPPYPTAQVYAEGAAYVGLPSTVKLVVVSP
FT                   YLLTGAVSVQGQGARVVAPTGPVVVNSTRAEIPATLIADSYTAALAVVINSRDWLGNPV
FT                   TLTYTVPISAAPPPPAVVSISPTMLSANKYNAVNITVALPIRANGTATATVAGGIMPQS
FT                   AVTFPIVNGVGKATVSVYPTASVVTFNVVATYQAAGVARTEQVAASAAVQQTFGGLSRL
FT                   QVAPSKLIAGIANNVTLVVQAPGPFNVSVTVTGAASDKPSPYYFGGVDKATANLLLTPL
FT                   STQPVSLTVYVYHSAGVDQYVVNLPVVSSSIFTVLPTPSVVKSGGNRTVTITVINSGDV
FT                   AIQKAVVAVSPASPSVVASTYTYQLGRLAPLDSAQLPISFIVPATFSGAIAFTYTITYT
FT                   TELGTSATTQGTFYIQALQTPAVNITTVNVVPATPEPRRTFYVSITIVNKGFSPVSNLQ
FT                   VEARAPPGIRPITSPIYFVGILDTQQTTNVPFSFNATRPGTYEIDFTISYTDQYGNIYT
FT                   IPYKVTVTVSNSTTRFFPGGTAPPGARQQQQQQSLPLATIAVAIVAVVAVAAGLVVYRR
FT                   RHRKTQQ"
FT   sig_peptide     617423..617482
FT                   /locus_tag="Pcal_0654"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.916 at
FT                   residue 20"
FT   gene            619676..620095
FT                   /locus_tag="Pcal_0655"
FT   CDS_pept        619676..620095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0655"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   pai:PAE1017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08081"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTW4"
FT                   /protein_id="ABO08081.1"
FT                   /translation="MDVMKVHVEEFTVATRAREDIVVVTEQVERVVARSGVKNGIVLIY
FT                   LPHATAIVTANENEPRLREDILNKLRALFPRGAGYRHDEIDDNANAHLANLFTGFHLVM
FT                   PVVGGRLRRGTWQEVMVIEMDGPRTRTIVVVVLGE"
FT   gene            620176..620508
FT                   /locus_tag="Pcal_0656"
FT   CDS_pept        620176..620508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0656"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08082"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTW5"
FT                   /protein_id="ABO08082.1"
FT                   /translation="MNHRFNVSDFRTVLKTVYAGMAKIVGEARGSCVSFTPRRVLEFGG
FT                   IDTTMPIALTLVKHILEKLVEAGLMQRDDSRARVRYVLCKNSPLWQKLRSGDDDTLKML
FT                   EEVTAE"
FT   gene            620820..621701
FT                   /locus_tag="Pcal_0657"
FT   CDS_pept        620820..621701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0657"
FT                   /product="Thiamine monophosphate kinase-like protein"
FT                   /note="KEGG: pai:PAE1022 thiamine-monophosphate kinase part
FT                   2, authentic frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08083"
FT                   /db_xref="GOA:A3MTW6"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3MTW6"
FT                   /protein_id="ABO08083.1"
FT                   /translation="MSGFGGRGVDEKGFLRWLLGELGVEEDDVAYVDGLVVKVDGAAAS
FT                   TSRLPFQTWADFGWRNVAAAYSDVRVKFAEARLLLASVTAPDLGTAAEVVQGVREASQF
FT                   FSLAYVGGDLNEGRDVVVDVVLVGWARARVGRAPRPGDVLVTIPQFGYTSLAYRFWQMG
FT                   GAVVERGVEALKRPKPLWPLPPAECVTAAMDSSDGLGDVLWSMARGVDIVVKELPAPRE
FT                   VLEFAAERGLDVGEIVFNGGEEFLPVFAVRRDCPVESPYVSFAEVVPGEGRVWWRGEEL
FT                   KWRGWAYFRGWG"
FT   gene            622217..623302
FT                   /locus_tag="Pcal_0658"
FT   CDS_pept        622217..623302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0658"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   pai:PAE3670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08084"
FT                   /db_xref="GOA:A3MTW7"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTW7"
FT                   /protein_id="ABO08084.1"
FT                   /translation="MHRVYRIALVLKSARCEGRVKNSLLLFFVSLLSLYARGRRKIAVA
FT                   LFFLSMLATGATAAALVMWGVGGALYGQLAELLGPGRYVVFGGSFSDADLLAAVQAVCS
FT                   PGGYGVVYRPVKVRYVNGSVATFTAAFVPRGLMRGIEVLDAVALRHVAAAGDVVDVEVG
FT                   GRWYQVRIAEVRDFTVFVPGLAADLYLDAELLGPARYDVLVVEKGNCGGARELEALFPR
FT                   AQVFDADLVLTGVWSQLLAYLGATALVSASSIATAASLTYTAAALTLAASYKEFAVLRL
FT                   LGLKRRSLVALMAALFLTPSAAGALVVLLASLSVEDVLGVSVRLYTAASAALVTAASAL
FT                   SLAPTLRKLYSLTPLEAIRAE"
FT   sig_peptide     622217..622393
FT                   /locus_tag="Pcal_0658"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.799 at
FT                   residue 59"
FT   gene            complement(623357..624058)
FT                   /locus_tag="Pcal_0659"
FT   CDS_pept        complement(623357..624058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0659"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08085"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTW8"
FT                   /protein_id="ABO08085.1"
FT                   /translation="MWWLFFTVAVLVLLFIAGVLAVLEAAYKGALEAYRLAKFALDQWT
FT                   SLTAELNRGLCIAAEDKAAEAVKRLDIETYRSLGKLFQGAVERVREASLLKRLNATWGF
FT                   QGDVFYYTLRFRNKTYEGKVDWLRPSALIDAVNSIKSTSFDLSAASVSDHLRPLVPNNA
FT                   RLTGVVEGVLTGNGTYTGVLKGYYTLTDKTPLKCTSGYISVDFTAEHYATLTINSTAPS
FT                   VYVYEAVYIDK"
FT   sig_peptide     complement(623993..624058)
FT                   /locus_tag="Pcal_0659"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.814 at
FT                   residue 22"
FT   gene            624117..624332
FT                   /locus_tag="Pcal_0660"
FT   CDS_pept        624117..624332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0660"
FT                   /product="PaREP6 domain containing protein / PaREP6 domain
FT                   containing protein"
FT                   /note="KEGG: pai:PAE2849 paREP6"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08086"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTW9"
FT                   /protein_id="ABO08086.1"
FT                   /translation="MDEVVEAFEEARRLRRERADWQFIESLPPRLRAAVKFFIETGDLR
FT                   LAQLLSGLDYEDFRELLRRARVPVLL"
FT   gene            624459..624977
FT                   /locus_tag="Pcal_0661"
FT   CDS_pept        624459..624977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pcal_0661"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pcal_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABO08087"
FT                   /db_xref="GOA:A3MTX0"
FT                   /db_xref="UniProtKB/TrEMBL:A3MTX0"
FT                   /protein_id="ABO08087.1"
FT                   /translation="MYSPSRWAVVGVRNLSPYCILPVRWTVFAAVGFLHVPLLWDHLLW
FT                   FYPAFFSLDALAPIALVAVGVDAHIAFLATSTALVGLYGLTYEALGMSHHVRKVVERIA
FT